Warning, /frameworks/kdelibs4support/po/wa/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Walloon 0002 # Ratournaedje e walon des messaedjes di KDE. 0003 # 0004 # Lorint Hendschel <lorint.hendschel@skynet.be>, 2002. 0005 # Pablo Saratxaga <pablo@walon.org>, 2002-2004, 2007. 0006 # Jean Cayron <jean.cayron@gmail.com>, 2007, 2008, 2009. 0007 # Jean Cayron <jean.cayron@tele2allin.be>, 2007, 2011, 2012. 0008 # Djan Cayron <jean.cayron@gmail.com>, 2011. 0009 msgid "" 0010 msgstr "" 0011 "Project-Id-Version: kdelibs4\n" 0012 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0013 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0014 "PO-Revision-Date: 2012-01-03 14:56+0100\n" 0015 "Last-Translator: Jean Cayron <jean.cayron@base.be>\n" 0016 "Language-Team: Walloon <linux-wa@walon.org>\n" 0017 "Language: wa\n" 0018 "MIME-Version: 1.0\n" 0019 "Content-Type: text/plain; charset=UTF-8\n" 0020 "Content-Transfer-Encoding: 8bit\n" 0021 "X-Generator: Lokalize 1.2\n" 0022 "Plural-Forms: nplurals=2; plural=n != 1;\n" 0023 0024 #, kde-format 0025 msgctxt "NAME OF TRANSLATORS" 0026 msgid "Your names" 0027 msgstr "Djan Cayron" 0028 0029 #, kde-format 0030 msgctxt "EMAIL OF TRANSLATORS" 0031 msgid "Your emails" 0032 msgstr "jean.cayron@gmail.com" 0033 0034 #, kde-format 0035 msgctxt "color" 0036 msgid "AliceBlue" 0037 msgstr "" 0038 0039 #, kde-format 0040 msgctxt "color" 0041 msgid "AntiqueWhite" 0042 msgstr "" 0043 0044 #, kde-format 0045 msgctxt "color" 0046 msgid "AntiqueWhite1" 0047 msgstr "" 0048 0049 #, kde-format 0050 msgctxt "color" 0051 msgid "AntiqueWhite2" 0052 msgstr "" 0053 0054 #, kde-format 0055 msgctxt "color" 0056 msgid "AntiqueWhite3" 0057 msgstr "" 0058 0059 #, kde-format 0060 msgctxt "color" 0061 msgid "AntiqueWhite4" 0062 msgstr "" 0063 0064 #, kde-format 0065 msgctxt "color" 0066 msgid "BlanchedAlmond" 0067 msgstr "" 0068 0069 #, kde-format 0070 msgctxt "color" 0071 msgid "BlueViolet" 0072 msgstr "" 0073 0074 #, kde-format 0075 msgctxt "color" 0076 msgid "CadetBlue" 0077 msgstr "" 0078 0079 #, kde-format 0080 msgctxt "color" 0081 msgid "CadetBlue1" 0082 msgstr "" 0083 0084 #, kde-format 0085 msgctxt "color" 0086 msgid "CadetBlue2" 0087 msgstr "" 0088 0089 #, kde-format 0090 msgctxt "color" 0091 msgid "CadetBlue3" 0092 msgstr "" 0093 0094 #, kde-format 0095 msgctxt "color" 0096 msgid "CadetBlue4" 0097 msgstr "" 0098 0099 #, kde-format 0100 msgctxt "color" 0101 msgid "CornflowerBlue" 0102 msgstr "" 0103 0104 #, kde-format 0105 msgctxt "color" 0106 msgid "DarkBlue" 0107 msgstr "" 0108 0109 #, kde-format 0110 msgctxt "color" 0111 msgid "DarkCyan" 0112 msgstr "" 0113 0114 #, kde-format 0115 msgctxt "color" 0116 msgid "DarkGoldenrod" 0117 msgstr "" 0118 0119 #, kde-format 0120 msgctxt "color" 0121 msgid "DarkGoldenrod1" 0122 msgstr "" 0123 0124 #, kde-format 0125 msgctxt "color" 0126 msgid "DarkGoldenrod2" 0127 msgstr "" 0128 0129 #, kde-format 0130 msgctxt "color" 0131 msgid "DarkGoldenrod3" 0132 msgstr "" 0133 0134 #, kde-format 0135 msgctxt "color" 0136 msgid "DarkGoldenrod4" 0137 msgstr "" 0138 0139 #, kde-format 0140 msgctxt "color" 0141 msgid "DarkGray" 0142 msgstr "" 0143 0144 #, kde-format 0145 msgctxt "color" 0146 msgid "DarkGreen" 0147 msgstr "" 0148 0149 #, kde-format 0150 msgctxt "color" 0151 msgid "DarkGrey" 0152 msgstr "" 0153 0154 #, kde-format 0155 msgctxt "color" 0156 msgid "DarkKhaki" 0157 msgstr "" 0158 0159 #, kde-format 0160 msgctxt "color" 0161 msgid "DarkMagenta" 0162 msgstr "" 0163 0164 #, kde-format 0165 msgctxt "color" 0166 msgid "DarkOliveGreen" 0167 msgstr "" 0168 0169 #, kde-format 0170 msgctxt "color" 0171 msgid "DarkOliveGreen1" 0172 msgstr "" 0173 0174 #, kde-format 0175 msgctxt "color" 0176 msgid "DarkOliveGreen2" 0177 msgstr "" 0178 0179 #, kde-format 0180 msgctxt "color" 0181 msgid "DarkOliveGreen3" 0182 msgstr "" 0183 0184 #, kde-format 0185 msgctxt "color" 0186 msgid "DarkOliveGreen4" 0187 msgstr "" 0188 0189 #, kde-format 0190 msgctxt "color" 0191 msgid "DarkOrange" 0192 msgstr "" 0193 0194 #, kde-format 0195 msgctxt "color" 0196 msgid "DarkOrange1" 0197 msgstr "" 0198 0199 #, kde-format 0200 msgctxt "color" 0201 msgid "DarkOrange2" 0202 msgstr "" 0203 0204 #, kde-format 0205 msgctxt "color" 0206 msgid "DarkOrange3" 0207 msgstr "" 0208 0209 #, kde-format 0210 msgctxt "color" 0211 msgid "DarkOrange4" 0212 msgstr "" 0213 0214 #, kde-format 0215 msgctxt "color" 0216 msgid "DarkOrchid" 0217 msgstr "" 0218 0219 #, kde-format 0220 msgctxt "color" 0221 msgid "DarkOrchid1" 0222 msgstr "" 0223 0224 #, kde-format 0225 msgctxt "color" 0226 msgid "DarkOrchid2" 0227 msgstr "" 0228 0229 #, kde-format 0230 msgctxt "color" 0231 msgid "DarkOrchid3" 0232 msgstr "" 0233 0234 #, kde-format 0235 msgctxt "color" 0236 msgid "DarkOrchid4" 0237 msgstr "" 0238 0239 #, kde-format 0240 msgctxt "color" 0241 msgid "DarkRed" 0242 msgstr "" 0243 0244 #, kde-format 0245 msgctxt "color" 0246 msgid "DarkSalmon" 0247 msgstr "" 0248 0249 #, kde-format 0250 msgctxt "color" 0251 msgid "DarkSeaGreen" 0252 msgstr "" 0253 0254 #, kde-format 0255 msgctxt "color" 0256 msgid "DarkSeaGreen1" 0257 msgstr "" 0258 0259 #, kde-format 0260 msgctxt "color" 0261 msgid "DarkSeaGreen2" 0262 msgstr "" 0263 0264 #, kde-format 0265 msgctxt "color" 0266 msgid "DarkSeaGreen3" 0267 msgstr "" 0268 0269 #, kde-format 0270 msgctxt "color" 0271 msgid "DarkSeaGreen4" 0272 msgstr "" 0273 0274 #, kde-format 0275 msgctxt "color" 0276 msgid "DarkSlateBlue" 0277 msgstr "" 0278 0279 #, kde-format 0280 msgctxt "color" 0281 msgid "DarkSlateGray" 0282 msgstr "" 0283 0284 #, kde-format 0285 msgctxt "color" 0286 msgid "DarkSlateGray1" 0287 msgstr "" 0288 0289 #, kde-format 0290 msgctxt "color" 0291 msgid "DarkSlateGray2" 0292 msgstr "" 0293 0294 #, kde-format 0295 msgctxt "color" 0296 msgid "DarkSlateGray3" 0297 msgstr "" 0298 0299 #, kde-format 0300 msgctxt "color" 0301 msgid "DarkSlateGray4" 0302 msgstr "" 0303 0304 #, kde-format 0305 msgctxt "color" 0306 msgid "DarkSlateGrey" 0307 msgstr "" 0308 0309 #, kde-format 0310 msgctxt "color" 0311 msgid "DarkTurquoise" 0312 msgstr "" 0313 0314 #, kde-format 0315 msgctxt "color" 0316 msgid "DarkViolet" 0317 msgstr "" 0318 0319 #, kde-format 0320 msgctxt "color" 0321 msgid "DeepPink" 0322 msgstr "" 0323 0324 #, kde-format 0325 msgctxt "color" 0326 msgid "DeepPink1" 0327 msgstr "" 0328 0329 #, kde-format 0330 msgctxt "color" 0331 msgid "DeepPink2" 0332 msgstr "" 0333 0334 #, kde-format 0335 msgctxt "color" 0336 msgid "DeepPink3" 0337 msgstr "" 0338 0339 #, kde-format 0340 msgctxt "color" 0341 msgid "DeepPink4" 0342 msgstr "" 0343 0344 #, kde-format 0345 msgctxt "color" 0346 msgid "DeepSkyBlue" 0347 msgstr "" 0348 0349 #, kde-format 0350 msgctxt "color" 0351 msgid "DeepSkyBlue1" 0352 msgstr "" 0353 0354 #, kde-format 0355 msgctxt "color" 0356 msgid "DeepSkyBlue2" 0357 msgstr "" 0358 0359 #, kde-format 0360 msgctxt "color" 0361 msgid "DeepSkyBlue3" 0362 msgstr "" 0363 0364 #, kde-format 0365 msgctxt "color" 0366 msgid "DeepSkyBlue4" 0367 msgstr "" 0368 0369 #, kde-format 0370 msgctxt "color" 0371 msgid "DimGray" 0372 msgstr "" 0373 0374 #, kde-format 0375 msgctxt "color" 0376 msgid "DimGrey" 0377 msgstr "" 0378 0379 #, kde-format 0380 msgctxt "color" 0381 msgid "DodgerBlue" 0382 msgstr "" 0383 0384 #, kde-format 0385 msgctxt "color" 0386 msgid "DodgerBlue1" 0387 msgstr "" 0388 0389 #, kde-format 0390 msgctxt "color" 0391 msgid "DodgerBlue2" 0392 msgstr "" 0393 0394 #, kde-format 0395 msgctxt "color" 0396 msgid "DodgerBlue3" 0397 msgstr "" 0398 0399 #, kde-format 0400 msgctxt "color" 0401 msgid "DodgerBlue4" 0402 msgstr "" 0403 0404 #, kde-format 0405 msgctxt "color" 0406 msgid "FloralWhite" 0407 msgstr "" 0408 0409 #, kde-format 0410 msgctxt "color" 0411 msgid "ForestGreen" 0412 msgstr "" 0413 0414 #, kde-format 0415 msgctxt "color" 0416 msgid "GhostWhite" 0417 msgstr "" 0418 0419 #, kde-format 0420 msgctxt "color" 0421 msgid "GreenYellow" 0422 msgstr "" 0423 0424 #, kde-format 0425 msgctxt "color" 0426 msgid "HotPink" 0427 msgstr "" 0428 0429 #, kde-format 0430 msgctxt "color" 0431 msgid "HotPink1" 0432 msgstr "" 0433 0434 #, kde-format 0435 msgctxt "color" 0436 msgid "HotPink2" 0437 msgstr "" 0438 0439 #, kde-format 0440 msgctxt "color" 0441 msgid "HotPink3" 0442 msgstr "" 0443 0444 #, kde-format 0445 msgctxt "color" 0446 msgid "HotPink4" 0447 msgstr "" 0448 0449 #, kde-format 0450 msgctxt "color" 0451 msgid "IndianRed" 0452 msgstr "" 0453 0454 #, kde-format 0455 msgctxt "color" 0456 msgid "IndianRed1" 0457 msgstr "" 0458 0459 #, kde-format 0460 msgctxt "color" 0461 msgid "IndianRed2" 0462 msgstr "" 0463 0464 #, kde-format 0465 msgctxt "color" 0466 msgid "IndianRed3" 0467 msgstr "" 0468 0469 #, kde-format 0470 msgctxt "color" 0471 msgid "IndianRed4" 0472 msgstr "" 0473 0474 #, kde-format 0475 msgctxt "color" 0476 msgid "LavenderBlush" 0477 msgstr "" 0478 0479 #, kde-format 0480 msgctxt "color" 0481 msgid "LavenderBlush1" 0482 msgstr "" 0483 0484 #, kde-format 0485 msgctxt "color" 0486 msgid "LavenderBlush2" 0487 msgstr "" 0488 0489 #, kde-format 0490 msgctxt "color" 0491 msgid "LavenderBlush3" 0492 msgstr "" 0493 0494 #, kde-format 0495 msgctxt "color" 0496 msgid "LavenderBlush4" 0497 msgstr "" 0498 0499 #, kde-format 0500 msgctxt "color" 0501 msgid "LawnGreen" 0502 msgstr "" 0503 0504 #, kde-format 0505 msgctxt "color" 0506 msgid "LemonChiffon" 0507 msgstr "" 0508 0509 #, kde-format 0510 msgctxt "color" 0511 msgid "LemonChiffon1" 0512 msgstr "" 0513 0514 #, kde-format 0515 msgctxt "color" 0516 msgid "LemonChiffon2" 0517 msgstr "" 0518 0519 #, kde-format 0520 msgctxt "color" 0521 msgid "LemonChiffon3" 0522 msgstr "" 0523 0524 #, kde-format 0525 msgctxt "color" 0526 msgid "LemonChiffon4" 0527 msgstr "" 0528 0529 #, kde-format 0530 msgctxt "color" 0531 msgid "LightBlue" 0532 msgstr "" 0533 0534 #, kde-format 0535 msgctxt "color" 0536 msgid "LightBlue1" 0537 msgstr "" 0538 0539 #, kde-format 0540 msgctxt "color" 0541 msgid "LightBlue2" 0542 msgstr "" 0543 0544 #, kde-format 0545 msgctxt "color" 0546 msgid "LightBlue3" 0547 msgstr "" 0548 0549 #, kde-format 0550 msgctxt "color" 0551 msgid "LightBlue4" 0552 msgstr "" 0553 0554 #, kde-format 0555 msgctxt "color" 0556 msgid "LightCoral" 0557 msgstr "" 0558 0559 #, kde-format 0560 msgctxt "color" 0561 msgid "LightCyan" 0562 msgstr "" 0563 0564 #, kde-format 0565 msgctxt "color" 0566 msgid "LightCyan1" 0567 msgstr "" 0568 0569 #, kde-format 0570 msgctxt "color" 0571 msgid "LightCyan2" 0572 msgstr "" 0573 0574 #, kde-format 0575 msgctxt "color" 0576 msgid "LightCyan3" 0577 msgstr "" 0578 0579 #, kde-format 0580 msgctxt "color" 0581 msgid "LightCyan4" 0582 msgstr "" 0583 0584 #, kde-format 0585 msgctxt "color" 0586 msgid "LightGoldenrod" 0587 msgstr "" 0588 0589 #, kde-format 0590 msgctxt "color" 0591 msgid "LightGoldenrod1" 0592 msgstr "" 0593 0594 #, kde-format 0595 msgctxt "color" 0596 msgid "LightGoldenrod2" 0597 msgstr "" 0598 0599 #, kde-format 0600 msgctxt "color" 0601 msgid "LightGoldenrod3" 0602 msgstr "" 0603 0604 #, kde-format 0605 msgctxt "color" 0606 msgid "LightGoldenrod4" 0607 msgstr "" 0608 0609 #, kde-format 0610 msgctxt "color" 0611 msgid "LightGoldenrodYellow" 0612 msgstr "" 0613 0614 #, kde-format 0615 msgctxt "color" 0616 msgid "LightGray" 0617 msgstr "" 0618 0619 #, kde-format 0620 msgctxt "color" 0621 msgid "LightGreen" 0622 msgstr "" 0623 0624 #, kde-format 0625 msgctxt "color" 0626 msgid "LightGrey" 0627 msgstr "" 0628 0629 #, kde-format 0630 msgctxt "color" 0631 msgid "LightPink" 0632 msgstr "" 0633 0634 #, kde-format 0635 msgctxt "color" 0636 msgid "LightPink1" 0637 msgstr "" 0638 0639 #, kde-format 0640 msgctxt "color" 0641 msgid "LightPink2" 0642 msgstr "" 0643 0644 #, kde-format 0645 msgctxt "color" 0646 msgid "LightPink3" 0647 msgstr "" 0648 0649 #, kde-format 0650 msgctxt "color" 0651 msgid "LightPink4" 0652 msgstr "" 0653 0654 #, kde-format 0655 msgctxt "color" 0656 msgid "LightSalmon" 0657 msgstr "" 0658 0659 #, kde-format 0660 msgctxt "color" 0661 msgid "LightSalmon1" 0662 msgstr "" 0663 0664 #, kde-format 0665 msgctxt "color" 0666 msgid "LightSalmon2" 0667 msgstr "" 0668 0669 #, kde-format 0670 msgctxt "color" 0671 msgid "LightSalmon3" 0672 msgstr "" 0673 0674 #, kde-format 0675 msgctxt "color" 0676 msgid "LightSalmon4" 0677 msgstr "" 0678 0679 #, kde-format 0680 msgctxt "color" 0681 msgid "LightSeaGreen" 0682 msgstr "" 0683 0684 #, kde-format 0685 msgctxt "color" 0686 msgid "LightSkyBlue" 0687 msgstr "" 0688 0689 #, kde-format 0690 msgctxt "color" 0691 msgid "LightSkyBlue1" 0692 msgstr "" 0693 0694 #, kde-format 0695 msgctxt "color" 0696 msgid "LightSkyBlue2" 0697 msgstr "" 0698 0699 #, kde-format 0700 msgctxt "color" 0701 msgid "LightSkyBlue3" 0702 msgstr "" 0703 0704 #, kde-format 0705 msgctxt "color" 0706 msgid "LightSkyBlue4" 0707 msgstr "" 0708 0709 #, kde-format 0710 msgctxt "color" 0711 msgid "LightSlateBlue" 0712 msgstr "" 0713 0714 #, kde-format 0715 msgctxt "color" 0716 msgid "LightSlateGray" 0717 msgstr "" 0718 0719 #, kde-format 0720 msgctxt "color" 0721 msgid "LightSlateGrey" 0722 msgstr "" 0723 0724 #, kde-format 0725 msgctxt "color" 0726 msgid "LightSteelBlue" 0727 msgstr "" 0728 0729 #, kde-format 0730 msgctxt "color" 0731 msgid "LightSteelBlue1" 0732 msgstr "" 0733 0734 #, kde-format 0735 msgctxt "color" 0736 msgid "LightSteelBlue2" 0737 msgstr "" 0738 0739 #, kde-format 0740 msgctxt "color" 0741 msgid "LightSteelBlue3" 0742 msgstr "" 0743 0744 #, kde-format 0745 msgctxt "color" 0746 msgid "LightSteelBlue4" 0747 msgstr "" 0748 0749 #, kde-format 0750 msgctxt "color" 0751 msgid "LightYellow" 0752 msgstr "" 0753 0754 #, kde-format 0755 msgctxt "color" 0756 msgid "LightYellow1" 0757 msgstr "" 0758 0759 #, kde-format 0760 msgctxt "color" 0761 msgid "LightYellow2" 0762 msgstr "" 0763 0764 #, kde-format 0765 msgctxt "color" 0766 msgid "LightYellow3" 0767 msgstr "" 0768 0769 #, kde-format 0770 msgctxt "color" 0771 msgid "LightYellow4" 0772 msgstr "" 0773 0774 #, kde-format 0775 msgctxt "color" 0776 msgid "LimeGreen" 0777 msgstr "" 0778 0779 #, kde-format 0780 msgctxt "color" 0781 msgid "MediumAquamarine" 0782 msgstr "" 0783 0784 #, kde-format 0785 msgctxt "color" 0786 msgid "MediumBlue" 0787 msgstr "" 0788 0789 #, kde-format 0790 msgctxt "color" 0791 msgid "MediumOrchid" 0792 msgstr "" 0793 0794 #, kde-format 0795 msgctxt "color" 0796 msgid "MediumOrchid1" 0797 msgstr "" 0798 0799 #, kde-format 0800 msgctxt "color" 0801 msgid "MediumOrchid2" 0802 msgstr "" 0803 0804 #, kde-format 0805 msgctxt "color" 0806 msgid "MediumOrchid3" 0807 msgstr "" 0808 0809 #, kde-format 0810 msgctxt "color" 0811 msgid "MediumOrchid4" 0812 msgstr "" 0813 0814 #, kde-format 0815 msgctxt "color" 0816 msgid "MediumPurple" 0817 msgstr "" 0818 0819 #, kde-format 0820 msgctxt "color" 0821 msgid "MediumPurple1" 0822 msgstr "" 0823 0824 #, kde-format 0825 msgctxt "color" 0826 msgid "MediumPurple2" 0827 msgstr "" 0828 0829 #, kde-format 0830 msgctxt "color" 0831 msgid "MediumPurple3" 0832 msgstr "" 0833 0834 #, kde-format 0835 msgctxt "color" 0836 msgid "MediumPurple4" 0837 msgstr "" 0838 0839 #, kde-format 0840 msgctxt "color" 0841 msgid "MediumSeaGreen" 0842 msgstr "" 0843 0844 #, kde-format 0845 msgctxt "color" 0846 msgid "MediumSlateBlue" 0847 msgstr "" 0848 0849 #, kde-format 0850 msgctxt "color" 0851 msgid "MediumSpringGreen" 0852 msgstr "" 0853 0854 #, kde-format 0855 msgctxt "color" 0856 msgid "MediumTurquoise" 0857 msgstr "" 0858 0859 #, kde-format 0860 msgctxt "color" 0861 msgid "MediumVioletRed" 0862 msgstr "" 0863 0864 #, kde-format 0865 msgctxt "color" 0866 msgid "MidnightBlue" 0867 msgstr "" 0868 0869 #, kde-format 0870 msgctxt "color" 0871 msgid "MintCream" 0872 msgstr "" 0873 0874 #, kde-format 0875 msgctxt "color" 0876 msgid "MistyRose" 0877 msgstr "" 0878 0879 #, kde-format 0880 msgctxt "color" 0881 msgid "MistyRose1" 0882 msgstr "" 0883 0884 #, kde-format 0885 msgctxt "color" 0886 msgid "MistyRose2" 0887 msgstr "" 0888 0889 #, kde-format 0890 msgctxt "color" 0891 msgid "MistyRose3" 0892 msgstr "" 0893 0894 #, kde-format 0895 msgctxt "color" 0896 msgid "MistyRose4" 0897 msgstr "" 0898 0899 #, kde-format 0900 msgctxt "color" 0901 msgid "NavajoWhite" 0902 msgstr "" 0903 0904 #, kde-format 0905 msgctxt "color" 0906 msgid "NavajoWhite1" 0907 msgstr "" 0908 0909 #, kde-format 0910 msgctxt "color" 0911 msgid "NavajoWhite2" 0912 msgstr "" 0913 0914 #, kde-format 0915 msgctxt "color" 0916 msgid "NavajoWhite3" 0917 msgstr "" 0918 0919 #, kde-format 0920 msgctxt "color" 0921 msgid "NavajoWhite4" 0922 msgstr "" 0923 0924 #, kde-format 0925 msgctxt "color" 0926 msgid "NavyBlue" 0927 msgstr "" 0928 0929 #, kde-format 0930 msgctxt "color" 0931 msgid "OldLace" 0932 msgstr "" 0933 0934 #, kde-format 0935 msgctxt "color" 0936 msgid "OliveDrab" 0937 msgstr "" 0938 0939 #, kde-format 0940 msgctxt "color" 0941 msgid "OliveDrab1" 0942 msgstr "" 0943 0944 #, kde-format 0945 msgctxt "color" 0946 msgid "OliveDrab2" 0947 msgstr "" 0948 0949 #, kde-format 0950 msgctxt "color" 0951 msgid "OliveDrab3" 0952 msgstr "" 0953 0954 #, kde-format 0955 msgctxt "color" 0956 msgid "OliveDrab4" 0957 msgstr "" 0958 0959 #, kde-format 0960 msgctxt "color" 0961 msgid "OrangeRed" 0962 msgstr "" 0963 0964 #, kde-format 0965 msgctxt "color" 0966 msgid "OrangeRed1" 0967 msgstr "" 0968 0969 #, kde-format 0970 msgctxt "color" 0971 msgid "OrangeRed2" 0972 msgstr "" 0973 0974 #, kde-format 0975 msgctxt "color" 0976 msgid "OrangeRed3" 0977 msgstr "" 0978 0979 #, kde-format 0980 msgctxt "color" 0981 msgid "OrangeRed4" 0982 msgstr "" 0983 0984 #, kde-format 0985 msgctxt "color" 0986 msgid "PaleGoldenrod" 0987 msgstr "" 0988 0989 #, kde-format 0990 msgctxt "color" 0991 msgid "PaleGreen" 0992 msgstr "" 0993 0994 #, kde-format 0995 msgctxt "color" 0996 msgid "PaleGreen1" 0997 msgstr "" 0998 0999 #, kde-format 1000 msgctxt "color" 1001 msgid "PaleGreen2" 1002 msgstr "" 1003 1004 #, kde-format 1005 msgctxt "color" 1006 msgid "PaleGreen3" 1007 msgstr "" 1008 1009 #, kde-format 1010 msgctxt "color" 1011 msgid "PaleGreen4" 1012 msgstr "" 1013 1014 #, kde-format 1015 msgctxt "color" 1016 msgid "PaleTurquoise" 1017 msgstr "" 1018 1019 #, kde-format 1020 msgctxt "color" 1021 msgid "PaleTurquoise1" 1022 msgstr "" 1023 1024 #, kde-format 1025 msgctxt "color" 1026 msgid "PaleTurquoise2" 1027 msgstr "" 1028 1029 #, kde-format 1030 msgctxt "color" 1031 msgid "PaleTurquoise3" 1032 msgstr "" 1033 1034 #, kde-format 1035 msgctxt "color" 1036 msgid "PaleTurquoise4" 1037 msgstr "" 1038 1039 #, kde-format 1040 msgctxt "color" 1041 msgid "PaleVioletRed" 1042 msgstr "" 1043 1044 #, kde-format 1045 msgctxt "color" 1046 msgid "PaleVioletRed1" 1047 msgstr "" 1048 1049 #, kde-format 1050 msgctxt "color" 1051 msgid "PaleVioletRed2" 1052 msgstr "" 1053 1054 #, kde-format 1055 msgctxt "color" 1056 msgid "PaleVioletRed3" 1057 msgstr "" 1058 1059 #, kde-format 1060 msgctxt "color" 1061 msgid "PaleVioletRed4" 1062 msgstr "" 1063 1064 #, kde-format 1065 msgctxt "color" 1066 msgid "PapayaWhip" 1067 msgstr "" 1068 1069 #, kde-format 1070 msgctxt "color" 1071 msgid "PeachPuff" 1072 msgstr "" 1073 1074 #, kde-format 1075 msgctxt "color" 1076 msgid "PeachPuff1" 1077 msgstr "" 1078 1079 #, kde-format 1080 msgctxt "color" 1081 msgid "PeachPuff2" 1082 msgstr "" 1083 1084 #, kde-format 1085 msgctxt "color" 1086 msgid "PeachPuff3" 1087 msgstr "" 1088 1089 #, kde-format 1090 msgctxt "color" 1091 msgid "PeachPuff4" 1092 msgstr "" 1093 1094 #, kde-format 1095 msgctxt "color" 1096 msgid "PowderBlue" 1097 msgstr "" 1098 1099 #, kde-format 1100 msgctxt "color" 1101 msgid "RosyBrown" 1102 msgstr "" 1103 1104 #, kde-format 1105 msgctxt "color" 1106 msgid "RosyBrown1" 1107 msgstr "" 1108 1109 #, kde-format 1110 msgctxt "color" 1111 msgid "RosyBrown2" 1112 msgstr "" 1113 1114 #, kde-format 1115 msgctxt "color" 1116 msgid "RosyBrown3" 1117 msgstr "" 1118 1119 #, kde-format 1120 msgctxt "color" 1121 msgid "RosyBrown4" 1122 msgstr "" 1123 1124 #, kde-format 1125 msgctxt "color" 1126 msgid "RoyalBlue" 1127 msgstr "" 1128 1129 #, kde-format 1130 msgctxt "color" 1131 msgid "RoyalBlue1" 1132 msgstr "" 1133 1134 #, kde-format 1135 msgctxt "color" 1136 msgid "RoyalBlue2" 1137 msgstr "" 1138 1139 #, kde-format 1140 msgctxt "color" 1141 msgid "RoyalBlue3" 1142 msgstr "" 1143 1144 #, kde-format 1145 msgctxt "color" 1146 msgid "RoyalBlue4" 1147 msgstr "" 1148 1149 #, kde-format 1150 msgctxt "color" 1151 msgid "SaddleBrown" 1152 msgstr "" 1153 1154 #, kde-format 1155 msgctxt "color" 1156 msgid "SandyBrown" 1157 msgstr "" 1158 1159 #, kde-format 1160 msgctxt "color" 1161 msgid "SeaGreen" 1162 msgstr "" 1163 1164 #, kde-format 1165 msgctxt "color" 1166 msgid "SeaGreen1" 1167 msgstr "" 1168 1169 #, kde-format 1170 msgctxt "color" 1171 msgid "SeaGreen2" 1172 msgstr "" 1173 1174 #, kde-format 1175 msgctxt "color" 1176 msgid "SeaGreen3" 1177 msgstr "" 1178 1179 #, kde-format 1180 msgctxt "color" 1181 msgid "SeaGreen4" 1182 msgstr "" 1183 1184 #, kde-format 1185 msgctxt "color" 1186 msgid "SkyBlue" 1187 msgstr "" 1188 1189 #, kde-format 1190 msgctxt "color" 1191 msgid "SkyBlue1" 1192 msgstr "" 1193 1194 #, kde-format 1195 msgctxt "color" 1196 msgid "SkyBlue2" 1197 msgstr "" 1198 1199 #, kde-format 1200 msgctxt "color" 1201 msgid "SkyBlue3" 1202 msgstr "" 1203 1204 #, kde-format 1205 msgctxt "color" 1206 msgid "SkyBlue4" 1207 msgstr "" 1208 1209 #, kde-format 1210 msgctxt "color" 1211 msgid "SlateBlue" 1212 msgstr "" 1213 1214 #, kde-format 1215 msgctxt "color" 1216 msgid "SlateBlue1" 1217 msgstr "" 1218 1219 #, kde-format 1220 msgctxt "color" 1221 msgid "SlateBlue2" 1222 msgstr "" 1223 1224 #, kde-format 1225 msgctxt "color" 1226 msgid "SlateBlue3" 1227 msgstr "" 1228 1229 #, kde-format 1230 msgctxt "color" 1231 msgid "SlateBlue4" 1232 msgstr "" 1233 1234 #, kde-format 1235 msgctxt "color" 1236 msgid "SlateGray" 1237 msgstr "" 1238 1239 #, kde-format 1240 msgctxt "color" 1241 msgid "SlateGray1" 1242 msgstr "" 1243 1244 #, kde-format 1245 msgctxt "color" 1246 msgid "SlateGray2" 1247 msgstr "" 1248 1249 #, kde-format 1250 msgctxt "color" 1251 msgid "SlateGray3" 1252 msgstr "" 1253 1254 #, kde-format 1255 msgctxt "color" 1256 msgid "SlateGray4" 1257 msgstr "" 1258 1259 #, kde-format 1260 msgctxt "color" 1261 msgid "SlateGrey" 1262 msgstr "" 1263 1264 #, kde-format 1265 msgctxt "color" 1266 msgid "SpringGreen" 1267 msgstr "" 1268 1269 #, kde-format 1270 msgctxt "color" 1271 msgid "SpringGreen1" 1272 msgstr "" 1273 1274 #, kde-format 1275 msgctxt "color" 1276 msgid "SpringGreen2" 1277 msgstr "" 1278 1279 #, kde-format 1280 msgctxt "color" 1281 msgid "SpringGreen3" 1282 msgstr "" 1283 1284 #, kde-format 1285 msgctxt "color" 1286 msgid "SpringGreen4" 1287 msgstr "" 1288 1289 #, kde-format 1290 msgctxt "color" 1291 msgid "SteelBlue" 1292 msgstr "" 1293 1294 #, kde-format 1295 msgctxt "color" 1296 msgid "SteelBlue1" 1297 msgstr "" 1298 1299 #, kde-format 1300 msgctxt "color" 1301 msgid "SteelBlue2" 1302 msgstr "" 1303 1304 #, kde-format 1305 msgctxt "color" 1306 msgid "SteelBlue3" 1307 msgstr "" 1308 1309 #, kde-format 1310 msgctxt "color" 1311 msgid "SteelBlue4" 1312 msgstr "" 1313 1314 #, kde-format 1315 msgctxt "color" 1316 msgid "VioletRed" 1317 msgstr "" 1318 1319 #, kde-format 1320 msgctxt "color" 1321 msgid "VioletRed1" 1322 msgstr "" 1323 1324 #, kde-format 1325 msgctxt "color" 1326 msgid "VioletRed2" 1327 msgstr "" 1328 1329 #, kde-format 1330 msgctxt "color" 1331 msgid "VioletRed3" 1332 msgstr "" 1333 1334 #, kde-format 1335 msgctxt "color" 1336 msgid "VioletRed4" 1337 msgstr "" 1338 1339 #, kde-format 1340 msgctxt "color" 1341 msgid "WhiteSmoke" 1342 msgstr "" 1343 1344 #, kde-format 1345 msgctxt "color" 1346 msgid "YellowGreen" 1347 msgstr "" 1348 1349 #, kde-format 1350 msgctxt "color" 1351 msgid "aquamarine" 1352 msgstr "" 1353 1354 #, kde-format 1355 msgctxt "color" 1356 msgid "aquamarine1" 1357 msgstr "" 1358 1359 #, kde-format 1360 msgctxt "color" 1361 msgid "aquamarine2" 1362 msgstr "" 1363 1364 #, kde-format 1365 msgctxt "color" 1366 msgid "aquamarine3" 1367 msgstr "" 1368 1369 #, kde-format 1370 msgctxt "color" 1371 msgid "aquamarine4" 1372 msgstr "" 1373 1374 #, kde-format 1375 msgctxt "color" 1376 msgid "azure" 1377 msgstr "" 1378 1379 #, kde-format 1380 msgctxt "color" 1381 msgid "azure1" 1382 msgstr "" 1383 1384 #, kde-format 1385 msgctxt "color" 1386 msgid "azure2" 1387 msgstr "" 1388 1389 #, kde-format 1390 msgctxt "color" 1391 msgid "azure3" 1392 msgstr "" 1393 1394 #, kde-format 1395 msgctxt "color" 1396 msgid "azure4" 1397 msgstr "" 1398 1399 #, kde-format 1400 msgctxt "color" 1401 msgid "beige" 1402 msgstr "" 1403 1404 #, kde-format 1405 msgctxt "color" 1406 msgid "bisque" 1407 msgstr "" 1408 1409 #, kde-format 1410 msgctxt "color" 1411 msgid "bisque1" 1412 msgstr "" 1413 1414 #, kde-format 1415 msgctxt "color" 1416 msgid "bisque2" 1417 msgstr "" 1418 1419 #, kde-format 1420 msgctxt "color" 1421 msgid "bisque3" 1422 msgstr "" 1423 1424 #, kde-format 1425 msgctxt "color" 1426 msgid "bisque4" 1427 msgstr "" 1428 1429 #, kde-format 1430 msgctxt "color" 1431 msgid "black" 1432 msgstr "" 1433 1434 #, kde-format 1435 msgctxt "color" 1436 msgid "blue" 1437 msgstr "" 1438 1439 #, kde-format 1440 msgctxt "color" 1441 msgid "blue1" 1442 msgstr "" 1443 1444 #, kde-format 1445 msgctxt "color" 1446 msgid "blue2" 1447 msgstr "" 1448 1449 #, kde-format 1450 msgctxt "color" 1451 msgid "blue3" 1452 msgstr "" 1453 1454 #, kde-format 1455 msgctxt "color" 1456 msgid "blue4" 1457 msgstr "" 1458 1459 #, kde-format 1460 msgctxt "color" 1461 msgid "brown" 1462 msgstr "" 1463 1464 #, kde-format 1465 msgctxt "color" 1466 msgid "brown1" 1467 msgstr "" 1468 1469 #, kde-format 1470 msgctxt "color" 1471 msgid "brown2" 1472 msgstr "" 1473 1474 #, kde-format 1475 msgctxt "color" 1476 msgid "brown3" 1477 msgstr "" 1478 1479 #, kde-format 1480 msgctxt "color" 1481 msgid "brown4" 1482 msgstr "" 1483 1484 #, kde-format 1485 msgctxt "color" 1486 msgid "burlywood" 1487 msgstr "" 1488 1489 #, kde-format 1490 msgctxt "color" 1491 msgid "burlywood1" 1492 msgstr "" 1493 1494 #, kde-format 1495 msgctxt "color" 1496 msgid "burlywood2" 1497 msgstr "" 1498 1499 #, kde-format 1500 msgctxt "color" 1501 msgid "burlywood3" 1502 msgstr "" 1503 1504 #, kde-format 1505 msgctxt "color" 1506 msgid "burlywood4" 1507 msgstr "" 1508 1509 #, kde-format 1510 msgctxt "color" 1511 msgid "chartreuse" 1512 msgstr "" 1513 1514 #, kde-format 1515 msgctxt "color" 1516 msgid "chartreuse1" 1517 msgstr "" 1518 1519 #, kde-format 1520 msgctxt "color" 1521 msgid "chartreuse2" 1522 msgstr "" 1523 1524 #, kde-format 1525 msgctxt "color" 1526 msgid "chartreuse3" 1527 msgstr "" 1528 1529 #, kde-format 1530 msgctxt "color" 1531 msgid "chartreuse4" 1532 msgstr "" 1533 1534 #, kde-format 1535 msgctxt "color" 1536 msgid "chocolate" 1537 msgstr "" 1538 1539 #, kde-format 1540 msgctxt "color" 1541 msgid "chocolate1" 1542 msgstr "" 1543 1544 #, kde-format 1545 msgctxt "color" 1546 msgid "chocolate2" 1547 msgstr "" 1548 1549 #, kde-format 1550 msgctxt "color" 1551 msgid "chocolate3" 1552 msgstr "" 1553 1554 #, kde-format 1555 msgctxt "color" 1556 msgid "chocolate4" 1557 msgstr "" 1558 1559 #, kde-format 1560 msgctxt "color" 1561 msgid "coral" 1562 msgstr "" 1563 1564 #, kde-format 1565 msgctxt "color" 1566 msgid "coral1" 1567 msgstr "" 1568 1569 #, kde-format 1570 msgctxt "color" 1571 msgid "coral2" 1572 msgstr "" 1573 1574 #, kde-format 1575 msgctxt "color" 1576 msgid "coral3" 1577 msgstr "" 1578 1579 #, kde-format 1580 msgctxt "color" 1581 msgid "coral4" 1582 msgstr "" 1583 1584 #, kde-format 1585 msgctxt "color" 1586 msgid "cornsilk" 1587 msgstr "" 1588 1589 #, kde-format 1590 msgctxt "color" 1591 msgid "cornsilk1" 1592 msgstr "" 1593 1594 #, kde-format 1595 msgctxt "color" 1596 msgid "cornsilk2" 1597 msgstr "" 1598 1599 #, kde-format 1600 msgctxt "color" 1601 msgid "cornsilk3" 1602 msgstr "" 1603 1604 #, kde-format 1605 msgctxt "color" 1606 msgid "cornsilk4" 1607 msgstr "" 1608 1609 #, kde-format 1610 msgctxt "color" 1611 msgid "cyan" 1612 msgstr "" 1613 1614 #, kde-format 1615 msgctxt "color" 1616 msgid "cyan1" 1617 msgstr "" 1618 1619 #, kde-format 1620 msgctxt "color" 1621 msgid "cyan2" 1622 msgstr "" 1623 1624 #, kde-format 1625 msgctxt "color" 1626 msgid "cyan3" 1627 msgstr "" 1628 1629 #, kde-format 1630 msgctxt "color" 1631 msgid "cyan4" 1632 msgstr "" 1633 1634 #, kde-format 1635 msgctxt "color" 1636 msgid "firebrick" 1637 msgstr "" 1638 1639 #, kde-format 1640 msgctxt "color" 1641 msgid "firebrick1" 1642 msgstr "" 1643 1644 #, kde-format 1645 msgctxt "color" 1646 msgid "firebrick2" 1647 msgstr "" 1648 1649 #, kde-format 1650 msgctxt "color" 1651 msgid "firebrick3" 1652 msgstr "" 1653 1654 #, kde-format 1655 msgctxt "color" 1656 msgid "firebrick4" 1657 msgstr "" 1658 1659 #, kde-format 1660 msgctxt "color" 1661 msgid "gainsboro" 1662 msgstr "" 1663 1664 #, kde-format 1665 msgctxt "color" 1666 msgid "gold" 1667 msgstr "" 1668 1669 #, kde-format 1670 msgctxt "color" 1671 msgid "gold1" 1672 msgstr "" 1673 1674 #, kde-format 1675 msgctxt "color" 1676 msgid "gold2" 1677 msgstr "" 1678 1679 #, kde-format 1680 msgctxt "color" 1681 msgid "gold3" 1682 msgstr "" 1683 1684 #, kde-format 1685 msgctxt "color" 1686 msgid "gold4" 1687 msgstr "" 1688 1689 #, kde-format 1690 msgctxt "color" 1691 msgid "goldenrod" 1692 msgstr "" 1693 1694 #, kde-format 1695 msgctxt "color" 1696 msgid "goldenrod1" 1697 msgstr "" 1698 1699 #, kde-format 1700 msgctxt "color" 1701 msgid "goldenrod2" 1702 msgstr "" 1703 1704 #, kde-format 1705 msgctxt "color" 1706 msgid "goldenrod3" 1707 msgstr "" 1708 1709 #, kde-format 1710 msgctxt "color" 1711 msgid "goldenrod4" 1712 msgstr "" 1713 1714 #, kde-format 1715 msgctxt "color" 1716 msgid "green" 1717 msgstr "" 1718 1719 #, kde-format 1720 msgctxt "color" 1721 msgid "green1" 1722 msgstr "" 1723 1724 #, kde-format 1725 msgctxt "color" 1726 msgid "green2" 1727 msgstr "" 1728 1729 #, kde-format 1730 msgctxt "color" 1731 msgid "green3" 1732 msgstr "" 1733 1734 #, kde-format 1735 msgctxt "color" 1736 msgid "green4" 1737 msgstr "" 1738 1739 #, kde-format 1740 msgctxt "color" 1741 msgid "honeydew" 1742 msgstr "" 1743 1744 #, kde-format 1745 msgctxt "color" 1746 msgid "honeydew1" 1747 msgstr "" 1748 1749 #, kde-format 1750 msgctxt "color" 1751 msgid "honeydew2" 1752 msgstr "" 1753 1754 #, kde-format 1755 msgctxt "color" 1756 msgid "honeydew3" 1757 msgstr "" 1758 1759 #, kde-format 1760 msgctxt "color" 1761 msgid "honeydew4" 1762 msgstr "" 1763 1764 #, kde-format 1765 msgctxt "color" 1766 msgid "ivory" 1767 msgstr "" 1768 1769 #, kde-format 1770 msgctxt "color" 1771 msgid "ivory1" 1772 msgstr "" 1773 1774 #, kde-format 1775 msgctxt "color" 1776 msgid "ivory2" 1777 msgstr "" 1778 1779 #, kde-format 1780 msgctxt "color" 1781 msgid "ivory3" 1782 msgstr "" 1783 1784 #, kde-format 1785 msgctxt "color" 1786 msgid "ivory4" 1787 msgstr "" 1788 1789 #, kde-format 1790 msgctxt "color" 1791 msgid "khaki" 1792 msgstr "" 1793 1794 #, kde-format 1795 msgctxt "color" 1796 msgid "khaki1" 1797 msgstr "" 1798 1799 #, kde-format 1800 msgctxt "color" 1801 msgid "khaki2" 1802 msgstr "" 1803 1804 #, kde-format 1805 msgctxt "color" 1806 msgid "khaki3" 1807 msgstr "" 1808 1809 #, kde-format 1810 msgctxt "color" 1811 msgid "khaki4" 1812 msgstr "" 1813 1814 #, kde-format 1815 msgctxt "color" 1816 msgid "lavender" 1817 msgstr "" 1818 1819 #, kde-format 1820 msgctxt "color" 1821 msgid "linen" 1822 msgstr "" 1823 1824 #, kde-format 1825 msgctxt "color" 1826 msgid "magenta" 1827 msgstr "" 1828 1829 #, kde-format 1830 msgctxt "color" 1831 msgid "magenta1" 1832 msgstr "" 1833 1834 #, kde-format 1835 msgctxt "color" 1836 msgid "magenta2" 1837 msgstr "" 1838 1839 #, kde-format 1840 msgctxt "color" 1841 msgid "magenta3" 1842 msgstr "" 1843 1844 #, kde-format 1845 msgctxt "color" 1846 msgid "magenta4" 1847 msgstr "" 1848 1849 #, kde-format 1850 msgctxt "color" 1851 msgid "maroon" 1852 msgstr "" 1853 1854 #, kde-format 1855 msgctxt "color" 1856 msgid "maroon1" 1857 msgstr "" 1858 1859 #, kde-format 1860 msgctxt "color" 1861 msgid "maroon2" 1862 msgstr "" 1863 1864 #, kde-format 1865 msgctxt "color" 1866 msgid "maroon3" 1867 msgstr "" 1868 1869 #, kde-format 1870 msgctxt "color" 1871 msgid "maroon4" 1872 msgstr "" 1873 1874 #, kde-format 1875 msgctxt "color" 1876 msgid "moccasin" 1877 msgstr "" 1878 1879 #, kde-format 1880 msgctxt "color" 1881 msgid "navy" 1882 msgstr "" 1883 1884 #, kde-format 1885 msgctxt "color" 1886 msgid "orange" 1887 msgstr "" 1888 1889 #, kde-format 1890 msgctxt "color" 1891 msgid "orange1" 1892 msgstr "" 1893 1894 #, kde-format 1895 msgctxt "color" 1896 msgid "orange2" 1897 msgstr "" 1898 1899 #, kde-format 1900 msgctxt "color" 1901 msgid "orange3" 1902 msgstr "" 1903 1904 #, kde-format 1905 msgctxt "color" 1906 msgid "orange4" 1907 msgstr "" 1908 1909 #, kde-format 1910 msgctxt "color" 1911 msgid "orchid" 1912 msgstr "" 1913 1914 #, kde-format 1915 msgctxt "color" 1916 msgid "orchid1" 1917 msgstr "" 1918 1919 #, kde-format 1920 msgctxt "color" 1921 msgid "orchid2" 1922 msgstr "" 1923 1924 #, kde-format 1925 msgctxt "color" 1926 msgid "orchid3" 1927 msgstr "" 1928 1929 #, kde-format 1930 msgctxt "color" 1931 msgid "orchid4" 1932 msgstr "" 1933 1934 #, kde-format 1935 msgctxt "color" 1936 msgid "peru" 1937 msgstr "" 1938 1939 #, kde-format 1940 msgctxt "color" 1941 msgid "pink" 1942 msgstr "" 1943 1944 #, kde-format 1945 msgctxt "color" 1946 msgid "pink1" 1947 msgstr "" 1948 1949 #, kde-format 1950 msgctxt "color" 1951 msgid "pink2" 1952 msgstr "" 1953 1954 #, kde-format 1955 msgctxt "color" 1956 msgid "pink3" 1957 msgstr "" 1958 1959 #, kde-format 1960 msgctxt "color" 1961 msgid "pink4" 1962 msgstr "" 1963 1964 #, kde-format 1965 msgctxt "color" 1966 msgid "plum" 1967 msgstr "" 1968 1969 #, kde-format 1970 msgctxt "color" 1971 msgid "plum1" 1972 msgstr "" 1973 1974 #, kde-format 1975 msgctxt "color" 1976 msgid "plum2" 1977 msgstr "" 1978 1979 #, kde-format 1980 msgctxt "color" 1981 msgid "plum3" 1982 msgstr "" 1983 1984 #, kde-format 1985 msgctxt "color" 1986 msgid "plum4" 1987 msgstr "" 1988 1989 #, kde-format 1990 msgctxt "color" 1991 msgid "purple" 1992 msgstr "" 1993 1994 #, kde-format 1995 msgctxt "color" 1996 msgid "purple1" 1997 msgstr "" 1998 1999 #, kde-format 2000 msgctxt "color" 2001 msgid "purple2" 2002 msgstr "" 2003 2004 #, kde-format 2005 msgctxt "color" 2006 msgid "purple3" 2007 msgstr "" 2008 2009 #, kde-format 2010 msgctxt "color" 2011 msgid "purple4" 2012 msgstr "" 2013 2014 #, fuzzy, kde-format 2015 msgctxt "color" 2016 msgid "red" 2017 msgstr "mie" 2018 2019 #, kde-format 2020 msgctxt "color" 2021 msgid "red1" 2022 msgstr "" 2023 2024 #, kde-format 2025 msgctxt "color" 2026 msgid "red2" 2027 msgstr "" 2028 2029 #, kde-format 2030 msgctxt "color" 2031 msgid "red3" 2032 msgstr "" 2033 2034 #, kde-format 2035 msgctxt "color" 2036 msgid "red4" 2037 msgstr "" 2038 2039 #, kde-format 2040 msgctxt "color" 2041 msgid "salmon" 2042 msgstr "" 2043 2044 #, kde-format 2045 msgctxt "color" 2046 msgid "salmon1" 2047 msgstr "" 2048 2049 #, kde-format 2050 msgctxt "color" 2051 msgid "salmon2" 2052 msgstr "" 2053 2054 #, kde-format 2055 msgctxt "color" 2056 msgid "salmon3" 2057 msgstr "" 2058 2059 #, kde-format 2060 msgctxt "color" 2061 msgid "salmon4" 2062 msgstr "" 2063 2064 #, kde-format 2065 msgctxt "color" 2066 msgid "seashell" 2067 msgstr "" 2068 2069 #, kde-format 2070 msgctxt "color" 2071 msgid "seashell1" 2072 msgstr "" 2073 2074 #, kde-format 2075 msgctxt "color" 2076 msgid "seashell2" 2077 msgstr "" 2078 2079 #, kde-format 2080 msgctxt "color" 2081 msgid "seashell3" 2082 msgstr "" 2083 2084 #, kde-format 2085 msgctxt "color" 2086 msgid "seashell4" 2087 msgstr "" 2088 2089 #, kde-format 2090 msgctxt "color" 2091 msgid "sienna" 2092 msgstr "" 2093 2094 #, kde-format 2095 msgctxt "color" 2096 msgid "sienna1" 2097 msgstr "" 2098 2099 #, kde-format 2100 msgctxt "color" 2101 msgid "sienna2" 2102 msgstr "" 2103 2104 #, kde-format 2105 msgctxt "color" 2106 msgid "sienna3" 2107 msgstr "" 2108 2109 #, kde-format 2110 msgctxt "color" 2111 msgid "sienna4" 2112 msgstr "" 2113 2114 #, kde-format 2115 msgctxt "color" 2116 msgid "snow" 2117 msgstr "" 2118 2119 #, kde-format 2120 msgctxt "color" 2121 msgid "snow1" 2122 msgstr "" 2123 2124 #, kde-format 2125 msgctxt "color" 2126 msgid "snow2" 2127 msgstr "" 2128 2129 #, kde-format 2130 msgctxt "color" 2131 msgid "snow3" 2132 msgstr "" 2133 2134 #, kde-format 2135 msgctxt "color" 2136 msgid "snow4" 2137 msgstr "" 2138 2139 #, fuzzy, kde-format 2140 msgctxt "color" 2141 msgid "tan" 2142 msgstr "Dja" 2143 2144 #, kde-format 2145 msgctxt "color" 2146 msgid "tan1" 2147 msgstr "" 2148 2149 #, kde-format 2150 msgctxt "color" 2151 msgid "tan2" 2152 msgstr "" 2153 2154 #, kde-format 2155 msgctxt "color" 2156 msgid "tan3" 2157 msgstr "" 2158 2159 #, kde-format 2160 msgctxt "color" 2161 msgid "tan4" 2162 msgstr "" 2163 2164 #, kde-format 2165 msgctxt "color" 2166 msgid "thistle" 2167 msgstr "" 2168 2169 #, kde-format 2170 msgctxt "color" 2171 msgid "thistle1" 2172 msgstr "" 2173 2174 #, kde-format 2175 msgctxt "color" 2176 msgid "thistle2" 2177 msgstr "" 2178 2179 #, kde-format 2180 msgctxt "color" 2181 msgid "thistle3" 2182 msgstr "" 2183 2184 #, kde-format 2185 msgctxt "color" 2186 msgid "thistle4" 2187 msgstr "" 2188 2189 #, kde-format 2190 msgctxt "color" 2191 msgid "tomato" 2192 msgstr "" 2193 2194 #, kde-format 2195 msgctxt "color" 2196 msgid "tomato1" 2197 msgstr "" 2198 2199 #, kde-format 2200 msgctxt "color" 2201 msgid "tomato2" 2202 msgstr "" 2203 2204 #, kde-format 2205 msgctxt "color" 2206 msgid "tomato3" 2207 msgstr "" 2208 2209 #, kde-format 2210 msgctxt "color" 2211 msgid "tomato4" 2212 msgstr "" 2213 2214 #, kde-format 2215 msgctxt "color" 2216 msgid "turquoise" 2217 msgstr "" 2218 2219 #, kde-format 2220 msgctxt "color" 2221 msgid "turquoise1" 2222 msgstr "" 2223 2224 #, kde-format 2225 msgctxt "color" 2226 msgid "turquoise2" 2227 msgstr "" 2228 2229 #, kde-format 2230 msgctxt "color" 2231 msgid "turquoise3" 2232 msgstr "" 2233 2234 #, kde-format 2235 msgctxt "color" 2236 msgid "turquoise4" 2237 msgstr "" 2238 2239 #, kde-format 2240 msgctxt "color" 2241 msgid "violet" 2242 msgstr "" 2243 2244 #, kde-format 2245 msgctxt "color" 2246 msgid "wheat" 2247 msgstr "" 2248 2249 #, kde-format 2250 msgctxt "color" 2251 msgid "wheat1" 2252 msgstr "" 2253 2254 #, kde-format 2255 msgctxt "color" 2256 msgid "wheat2" 2257 msgstr "" 2258 2259 #, kde-format 2260 msgctxt "color" 2261 msgid "wheat3" 2262 msgstr "" 2263 2264 #, kde-format 2265 msgctxt "color" 2266 msgid "wheat4" 2267 msgstr "" 2268 2269 #, kde-format 2270 msgctxt "color" 2271 msgid "white" 2272 msgstr "" 2273 2274 #, kde-format 2275 msgctxt "color" 2276 msgid "yellow" 2277 msgstr "" 2278 2279 #, kde-format 2280 msgctxt "color" 2281 msgid "yellow1" 2282 msgstr "" 2283 2284 #, kde-format 2285 msgctxt "color" 2286 msgid "yellow2" 2287 msgstr "" 2288 2289 #, kde-format 2290 msgctxt "color" 2291 msgid "yellow3" 2292 msgstr "" 2293 2294 #, kde-format 2295 msgctxt "color" 2296 msgid "yellow4" 2297 msgstr "" 2298 2299 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2300 #, kde-format 2301 msgid "Debug Settings" 2302 msgstr "Tchuzes di disbugaedje" 2303 2304 #: kdebugdialog/kdebugdialog.cpp:59 2305 #, kde-format 2306 msgid "File" 2307 msgstr "Fitchî" 2308 2309 #: kdebugdialog/kdebugdialog.cpp:60 2310 #, kde-format 2311 msgid "Message Box" 2312 msgstr "Boesse a messaedje" 2313 2314 #: kdebugdialog/kdebugdialog.cpp:61 2315 #, kde-format 2316 msgid "Shell" 2317 msgstr "Shell" 2318 2319 #: kdebugdialog/kdebugdialog.cpp:62 2320 #, kde-format 2321 msgid "Syslog" 2322 msgstr "Djournå sistinme" 2323 2324 #: kdebugdialog/kdebugdialog.cpp:63 2325 #, kde-format 2326 msgid "None" 2327 msgstr "Nolu" 2328 2329 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2330 #: kdebugdialog/kdebugdialog.ui:48 2331 #, kde-format 2332 msgid "Information" 2333 msgstr "Informåcion" 2334 2335 #. i18n: ectx: property (text), widget (QLabel, label_2) 2336 #. i18n: ectx: property (text), widget (QLabel, label_8) 2337 #. i18n: ectx: property (text), widget (QLabel, label_4) 2338 #. i18n: ectx: property (text), widget (QLabel, label_6) 2339 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2340 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2341 #, kde-format 2342 msgid "Output to:" 2343 msgstr "Rexhowe viè:" 2344 2345 #. i18n: ectx: property (text), widget (QLabel, label_3) 2346 #. i18n: ectx: property (text), widget (QLabel, label_9) 2347 #. i18n: ectx: property (text), widget (QLabel, label_5) 2348 #. i18n: ectx: property (text), widget (QLabel, label_7) 2349 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2350 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2351 #, kde-format 2352 msgid "Filename:" 2353 msgstr "No d' fitchî:" 2354 2355 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2356 #: kdebugdialog/kdebugdialog.ui:83 2357 #, kde-format 2358 msgid "Error" 2359 msgstr "Aroke" 2360 2361 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2362 #: kdebugdialog/kdebugdialog.ui:118 2363 #, kde-format 2364 msgid "Abort on fatal errors" 2365 msgstr "Abandner cwand aroke moirt" 2366 2367 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2368 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2369 #, kde-format 2370 msgid "Disable all debug output" 2371 msgstr "Essocter totes les rexhowes di disbugaedje" 2372 2373 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2374 #: kdebugdialog/kdebugdialog.ui:145 2375 #, kde-format 2376 msgid "Warning" 2377 msgstr "Adviertixhmint" 2378 2379 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2380 #: kdebugdialog/kdebugdialog.ui:180 2381 #, kde-format 2382 msgid "Fatal Error" 2383 msgstr "Aroke moirt" 2384 2385 #: kdebugdialog/klistdebugdialog.cpp:69 2386 #, kde-format 2387 msgid "&Select All" 2388 msgstr "&Tot tchoezi" 2389 2390 #: kdebugdialog/klistdebugdialog.cpp:70 2391 #, kde-format 2392 msgid "&Deselect All" 2393 msgstr "Tot &distchoezi" 2394 2395 #: kdebugdialog/main.cpp:100 2396 #, kde-format 2397 msgid "KDebugDialog" 2398 msgstr "KDivizeDisbugaedje" 2399 2400 #: kdebugdialog/main.cpp:101 2401 #, kde-format 2402 msgid "A dialog box for setting preferences for debug output" 2403 msgstr "Ene divize di preferinces des tchuzes pol rexhowe di disbugaedje" 2404 2405 #: kdebugdialog/main.cpp:102 2406 #, fuzzy, kde-format 2407 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2408 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2409 msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2410 2411 #: kdebugdialog/main.cpp:103 2412 #, kde-format 2413 msgid "David Faure" 2414 msgstr "David Faure" 2415 2416 #: kdebugdialog/main.cpp:103 2417 #, kde-format 2418 msgid "Maintainer" 2419 msgstr "Mintneu" 2420 2421 #: kdebugdialog/main.cpp:108 2422 #, kde-format 2423 msgid "Show the fully-fledged dialog instead of the default list dialog" 2424 msgstr "" 2425 "Mostere li dvize tote sitindowe al plaece del prémetowe divize di djivêye" 2426 2427 #: kdebugdialog/main.cpp:109 2428 #, kde-format 2429 msgid "Turn area on" 2430 msgstr "Eclitchî li redjon" 2431 2432 #: kdebugdialog/main.cpp:110 2433 #, kde-format 2434 msgid "Turn area off" 2435 msgstr "Disclitchî li redjon" 2436 2437 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2438 #, kde-format 2439 msgid "no error" 2440 msgstr "nole aroke" 2441 2442 #: kdecore/k3resolver.cpp:534 2443 #, kde-format 2444 msgid "requested family not supported for this host name" 2445 msgstr "famile di dmandêye nén sopoirté po ç' no d' lodjoe" 2446 2447 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2448 #, kde-format 2449 msgid "temporary failure in name resolution" 2450 msgstr "aroke timporaire dins l' translataedje des nos" 2451 2452 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2453 #, kde-format 2454 msgid "non-recoverable failure in name resolution" 2455 msgstr "aroke moirt tins do translataedje do no" 2456 2457 #: kdecore/k3resolver.cpp:537 2458 #, kde-format 2459 msgid "invalid flags" 2460 msgstr "mwaijhe valixhance po flags" 2461 2462 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2463 #, kde-format 2464 msgid "memory allocation failure" 2465 msgstr "aroke dins l' dispårtixhaedje del memwere" 2466 2467 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2468 #, kde-format 2469 msgid "name or service not known" 2470 msgstr "no ou siervice nén cnoxhou" 2471 2472 #: kdecore/k3resolver.cpp:540 2473 #, kde-format 2474 msgid "requested family not supported" 2475 msgstr "famile di dmandêye nén sopoirtêye" 2476 2477 #: kdecore/k3resolver.cpp:541 2478 #, kde-format 2479 msgid "requested service not supported for this socket type" 2480 msgstr "no di siervice di dimandé nén sopoirté po cisse sôre di prijhe" 2481 2482 #: kdecore/k3resolver.cpp:542 2483 #, kde-format 2484 msgid "requested socket type not supported" 2485 msgstr "sôre di prijhe di dmandêye nén sopoirtêye" 2486 2487 #: kdecore/k3resolver.cpp:543 2488 #, kde-format 2489 msgid "unknown error" 2490 msgstr "aroke nén cnoxhowe" 2491 2492 #: kdecore/k3resolver.cpp:545 2493 #, kde-format 2494 msgctxt "1: the i18n'ed system error code, from errno" 2495 msgid "system error: %1" 2496 msgstr "aroke sistinme: %1" 2497 2498 #: kdecore/k3resolver.cpp:556 2499 #, kde-format 2500 msgid "request was canceled" 2501 msgstr "dimande rinonceye" 2502 2503 #: kdecore/k3socketaddress.cpp:631 2504 #, kde-format 2505 msgctxt "1: the unknown socket address family number" 2506 msgid "Unknown family %1" 2507 msgstr "Famile %1di fitchî nén cnoxhowe" 2508 2509 #: kdecore/k3socketbase.cpp:215 2510 #, kde-format 2511 msgctxt "Socket error code NoError" 2512 msgid "no error" 2513 msgstr "nole aroke" 2514 2515 #: kdecore/k3socketbase.cpp:220 2516 #, kde-format 2517 msgctxt "Socket error code LookupFailure" 2518 msgid "name lookup has failed" 2519 msgstr "no del bûze a fwait berwete" 2520 2521 #: kdecore/k3socketbase.cpp:225 2522 #, kde-format 2523 msgctxt "Socket error code AddressInUse" 2524 msgid "address already in use" 2525 msgstr "adresse dedja en alaedje" 2526 2527 #: kdecore/k3socketbase.cpp:230 2528 #, kde-format 2529 msgctxt "Socket error code AlreadyBound" 2530 msgid "socket is already bound" 2531 msgstr "prijhe dedja montêye" 2532 2533 #: kdecore/k3socketbase.cpp:235 2534 #, kde-format 2535 msgctxt "Socket error code AlreadyCreated" 2536 msgid "socket is already created" 2537 msgstr "prijhe dedja askepieye" 2538 2539 #: kdecore/k3socketbase.cpp:240 2540 #, kde-format 2541 msgctxt "Socket error code NotBound" 2542 msgid "socket is not bound" 2543 msgstr "prijhe nén montêye" 2544 2545 #: kdecore/k3socketbase.cpp:245 2546 #, kde-format 2547 msgctxt "Socket error code NotCreated" 2548 msgid "socket has not been created" 2549 msgstr "prijhe nén stî askepieye" 2550 2551 #: kdecore/k3socketbase.cpp:250 2552 #, kde-format 2553 msgctxt "Socket error code WouldBlock" 2554 msgid "operation would block" 2555 msgstr "operåcion djocreut" 2556 2557 #: kdecore/k3socketbase.cpp:255 2558 #, kde-format 2559 msgctxt "Socket error code ConnectionRefused" 2560 msgid "connection actively refused" 2561 msgstr "raloyaedje activmint rifuzé" 2562 2563 #: kdecore/k3socketbase.cpp:260 2564 #, kde-format 2565 msgctxt "Socket error code ConnectionTimedOut" 2566 msgid "connection timed out" 2567 msgstr "tins po s' raloyî est houte." 2568 2569 #: kdecore/k3socketbase.cpp:265 2570 #, kde-format 2571 msgctxt "Socket error code InProgress" 2572 msgid "operation is already in progress" 2573 msgstr "operåcion dedja enondêye" 2574 2575 #: kdecore/k3socketbase.cpp:270 2576 #, kde-format 2577 msgctxt "Socket error code NetFailure" 2578 msgid "network failure occurred" 2579 msgstr "aroke del rantoele" 2580 2581 #: kdecore/k3socketbase.cpp:275 2582 #, kde-format 2583 msgctxt "Socket error code NotSupported" 2584 msgid "operation is not supported" 2585 msgstr "operåcion nén sopoirtêye" 2586 2587 #: kdecore/k3socketbase.cpp:280 2588 #, kde-format 2589 msgctxt "Socket error code Timeout" 2590 msgid "timed operation timed out" 2591 msgstr "tins d' l' operåcion houte" 2592 2593 #: kdecore/k3socketbase.cpp:285 2594 #, kde-format 2595 msgctxt "Socket error code UnknownError" 2596 msgid "an unknown/unexpected error has happened" 2597 msgstr "åk n' a nén stî, ki ça n' esteut nén ratindou ou cnoxhou%s" 2598 2599 #: kdecore/k3socketbase.cpp:290 2600 #, kde-format 2601 msgctxt "Socket error code RemotelyDisconnected" 2602 msgid "remote host closed connection" 2603 msgstr "lodjoe å lon a seré li raloyaedje" 2604 2605 #: kdecore/k4aboutdata.cpp:267 2606 #, kde-format 2607 msgid "" 2608 "No licensing terms for this program have been specified.\n" 2609 "Please check the documentation or the source for any\n" 2610 "licensing terms.\n" 2611 msgstr "" 2612 2613 #: kdecore/k4aboutdata.cpp:273 2614 #, kde-format 2615 msgid "This program is distributed under the terms of the %1." 2616 msgstr "" 2617 2618 #: kdecore/k4aboutdata.cpp:297 2619 #, kde-format 2620 msgctxt "@item license (short name)" 2621 msgid "GPL v2" 2622 msgstr "GPL m2" 2623 2624 #: kdecore/k4aboutdata.cpp:298 2625 #, kde-format 2626 msgctxt "@item license" 2627 msgid "GNU General Public License Version 2" 2628 msgstr "Licince publike djeneråle GNU (GPL) modêye 2" 2629 2630 #: kdecore/k4aboutdata.cpp:301 2631 #, kde-format 2632 msgctxt "@item license (short name)" 2633 msgid "LGPL v2" 2634 msgstr "LGPL m2" 2635 2636 #: kdecore/k4aboutdata.cpp:302 2637 #, kde-format 2638 msgctxt "@item license" 2639 msgid "GNU Lesser General Public License Version 2" 2640 msgstr "Schate licince publike djeneråle GNU (GPL) modêye 2" 2641 2642 #: kdecore/k4aboutdata.cpp:305 2643 #, kde-format 2644 msgctxt "@item license (short name)" 2645 msgid "BSD License" 2646 msgstr "Licince BSD" 2647 2648 #: kdecore/k4aboutdata.cpp:306 2649 #, kde-format 2650 msgctxt "@item license" 2651 msgid "BSD License" 2652 msgstr "Licince BSD" 2653 2654 #: kdecore/k4aboutdata.cpp:309 2655 #, kde-format 2656 msgctxt "@item license (short name)" 2657 msgid "Artistic License" 2658 msgstr "Licince årtistike" 2659 2660 #: kdecore/k4aboutdata.cpp:310 2661 #, kde-format 2662 msgctxt "@item license" 2663 msgid "Artistic License" 2664 msgstr "Licince årtistike" 2665 2666 #: kdecore/k4aboutdata.cpp:313 2667 #, kde-format 2668 msgctxt "@item license (short name)" 2669 msgid "QPL v1.0" 2670 msgstr "QPL m1.0" 2671 2672 #: kdecore/k4aboutdata.cpp:314 2673 #, kde-format 2674 msgctxt "@item license" 2675 msgid "Q Public License" 2676 msgstr "Licince publike Q" 2677 2678 #: kdecore/k4aboutdata.cpp:317 2679 #, kde-format 2680 msgctxt "@item license (short name)" 2681 msgid "GPL v3" 2682 msgstr "GPL m3" 2683 2684 #: kdecore/k4aboutdata.cpp:318 2685 #, kde-format 2686 msgctxt "@item license" 2687 msgid "GNU General Public License Version 3" 2688 msgstr "Licince publike djeneråle GNU (GPL) modêye 3" 2689 2690 #: kdecore/k4aboutdata.cpp:321 2691 #, kde-format 2692 msgctxt "@item license (short name)" 2693 msgid "LGPL v3" 2694 msgstr "LGPL m3" 2695 2696 #: kdecore/k4aboutdata.cpp:322 2697 #, kde-format 2698 msgctxt "@item license" 2699 msgid "GNU Lesser General Public License Version 3" 2700 msgstr "Schate licince publike djeneråle GNU (GPL) modêye 3" 2701 2702 #: kdecore/k4aboutdata.cpp:326 2703 #, kde-format 2704 msgctxt "@item license" 2705 msgid "Custom" 2706 msgstr "Licince prôpe" 2707 2708 #: kdecore/k4aboutdata.cpp:329 2709 #, kde-format 2710 msgctxt "@item license" 2711 msgid "Not specified" 2712 msgstr "Nén specifieye" 2713 2714 #: kdecore/k4aboutdata.cpp:891 2715 #, kde-format 2716 msgctxt "replace this with information about your translation team" 2717 msgid "" 2718 "<p>KDE is translated into many languages thanks to the work of the " 2719 "translation teams all over the world.</p><p>For more information on KDE " 2720 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2721 "org</a></p>" 2722 msgstr "" 2723 "<p>KDE a stî ratourné dins tot plin di lingaedjes gråces a l' ovraedje des " 2724 "ekipes di ratournaedje tot avå l' Daegne.</p><p>Li ratournaedje e walon a " 2725 "stî fwait tot shuvant les rîles del novele ortografeye do walon, li «rfondou " 2726 "walon».</p><p>Po pus d' infôrmåcions so l' eternåcionålijhaedje di KDE, " 2727 "vizitez <a href=\"http://l10n.kde.org\">http://l10n.kde.org</a></p><p>Po pus " 2728 "d' infôrmåcions sol rifondou walon, vizitez <a href=\"http://rifondou.walon." 2729 "org\">http://rifondou.walon.org/</a></p>" 2730 2731 #: kdecore/kcalendarsystem.cpp:108 2732 #, kde-format 2733 msgctxt "@item Calendar system" 2734 msgid "Gregorian" 2735 msgstr "Gregoryin" 2736 2737 #: kdecore/kcalendarsystem.cpp:110 2738 #, kde-format 2739 msgctxt "@item Calendar system" 2740 msgid "Coptic" 2741 msgstr "Cope" 2742 2743 #: kdecore/kcalendarsystem.cpp:112 2744 #, kde-format 2745 msgctxt "@item Calendar system" 2746 msgid "Ethiopian" 2747 msgstr "Etiopyin" 2748 2749 #: kdecore/kcalendarsystem.cpp:114 2750 #, kde-format 2751 msgctxt "@item Calendar system" 2752 msgid "Hebrew" 2753 msgstr "Ebreu" 2754 2755 #: kdecore/kcalendarsystem.cpp:116 2756 #, kde-format 2757 msgctxt "@item Calendar system" 2758 msgid "Islamic / Hijri (Civil)" 2759 msgstr "" 2760 2761 #: kdecore/kcalendarsystem.cpp:118 2762 #, kde-format 2763 msgctxt "@item Calendar system" 2764 msgid "Indian National" 2765 msgstr "" 2766 2767 #: kdecore/kcalendarsystem.cpp:120 2768 #, kde-format 2769 msgctxt "@item Calendar system" 2770 msgid "Jalali" 2771 msgstr "Iranyin (Djalali)" 2772 2773 #: kdecore/kcalendarsystem.cpp:122 2774 #, kde-format 2775 msgctxt "@item Calendar system" 2776 msgid "Japanese" 2777 msgstr "Djaponès" 2778 2779 #: kdecore/kcalendarsystem.cpp:124 2780 #, kde-format 2781 msgctxt "@item Calendar system" 2782 msgid "Julian" 2783 msgstr "Djulyin" 2784 2785 #: kdecore/kcalendarsystem.cpp:126 2786 #, kde-format 2787 msgctxt "@item Calendar system" 2788 msgid "Taiwanese" 2789 msgstr "" 2790 2791 #: kdecore/kcalendarsystem.cpp:128 2792 #, kde-format 2793 msgctxt "@item Calendar system" 2794 msgid "Thai" 2795 msgstr "Taylandès" 2796 2797 #: kdecore/kcalendarsystem.cpp:131 2798 #, kde-format 2799 msgctxt "@item Calendar system" 2800 msgid "Invalid Calendar Type" 2801 msgstr "Mwaijhe sôre di calindrî" 2802 2803 #: kdecore/kcalendarsystem.cpp:1495 2804 #, kde-format 2805 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2806 msgid "-" 2807 msgstr "-" 2808 2809 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2810 #: kio/kfilemetadataprovider.cpp:199 2811 #, kde-format 2812 msgid "Today" 2813 msgstr "Ouy" 2814 2815 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2816 #: kio/kfilemetadataprovider.cpp:202 2817 #, kde-format 2818 msgid "Yesterday" 2819 msgstr "Ayir" 2820 2821 #: kdecore/kcalendarsystemcoptic.cpp:45 2822 #, kde-format 2823 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2824 msgid "Anno Martyrum" 2825 msgstr "Anno Martyrum" 2826 2827 #: kdecore/kcalendarsystemcoptic.cpp:46 2828 #, kde-format 2829 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2830 msgid "AM" 2831 msgstr "AM" 2832 2833 #: kdecore/kcalendarsystemcoptic.cpp:47 2834 #, kde-format 2835 msgctxt "" 2836 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2837 msgid "%Ey %EC" 2838 msgstr "%Ey %EC" 2839 2840 #: kdecore/kcalendarsystemcoptic.cpp:153 2841 #, kde-format 2842 msgctxt "Coptic month 1 - KLocale::NarrowName" 2843 msgid "T" 2844 msgstr "" 2845 2846 #: kdecore/kcalendarsystemcoptic.cpp:155 2847 #, kde-format 2848 msgctxt "Coptic month 2 - KLocale::NarrowName" 2849 msgid "P" 2850 msgstr "" 2851 2852 #: kdecore/kcalendarsystemcoptic.cpp:157 2853 #, kde-format 2854 msgctxt "Coptic month 3 - KLocale::NarrowName" 2855 msgid "H" 2856 msgstr "" 2857 2858 #: kdecore/kcalendarsystemcoptic.cpp:159 2859 #, kde-format 2860 msgctxt "Coptic month 4 - KLocale::NarrowName" 2861 msgid "K" 2862 msgstr "" 2863 2864 #: kdecore/kcalendarsystemcoptic.cpp:161 2865 #, kde-format 2866 msgctxt "Coptic month 5 - KLocale::NarrowName" 2867 msgid "T" 2868 msgstr "" 2869 2870 #: kdecore/kcalendarsystemcoptic.cpp:163 2871 #, kde-format 2872 msgctxt "Coptic month 6 - KLocale::NarrowName" 2873 msgid "M" 2874 msgstr "" 2875 2876 #: kdecore/kcalendarsystemcoptic.cpp:165 2877 #, kde-format 2878 msgctxt "Coptic month 7 - KLocale::NarrowName" 2879 msgid "P" 2880 msgstr "" 2881 2882 #: kdecore/kcalendarsystemcoptic.cpp:167 2883 #, kde-format 2884 msgctxt "Coptic month 8 - KLocale::NarrowName" 2885 msgid "P" 2886 msgstr "" 2887 2888 #: kdecore/kcalendarsystemcoptic.cpp:169 2889 #, kde-format 2890 msgctxt "Coptic month 9 - KLocale::NarrowName" 2891 msgid "P" 2892 msgstr "" 2893 2894 #: kdecore/kcalendarsystemcoptic.cpp:171 2895 #, kde-format 2896 msgctxt "Coptic month 10 - KLocale::NarrowName" 2897 msgid "P" 2898 msgstr "" 2899 2900 #: kdecore/kcalendarsystemcoptic.cpp:173 2901 #, kde-format 2902 msgctxt "Coptic month 11 - KLocale::NarrowName" 2903 msgid "E" 2904 msgstr "" 2905 2906 #: kdecore/kcalendarsystemcoptic.cpp:175 2907 #, kde-format 2908 msgctxt "Coptic month 12 - KLocale::NarrowName" 2909 msgid "M" 2910 msgstr "" 2911 2912 #: kdecore/kcalendarsystemcoptic.cpp:177 2913 #, kde-format 2914 msgctxt "Coptic month 13 - KLocale::NarrowName" 2915 msgid "K" 2916 msgstr "" 2917 2918 #: kdecore/kcalendarsystemcoptic.cpp:186 2919 #, fuzzy, kde-format 2920 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2921 msgid "of Tho" 2922 msgstr "di Kho" 2923 2924 #: kdecore/kcalendarsystemcoptic.cpp:188 2925 #, fuzzy, kde-format 2926 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2927 msgid "of Pao" 2928 msgstr "di Tamuz" 2929 2930 #: kdecore/kcalendarsystemcoptic.cpp:190 2931 #, fuzzy, kde-format 2932 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2933 msgid "of Hat" 2934 msgstr "di Shvat" 2935 2936 #: kdecore/kcalendarsystemcoptic.cpp:192 2937 #, fuzzy, kde-format 2938 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2939 msgid "of Kia" 2940 msgstr "di Nisan" 2941 2942 #: kdecore/kcalendarsystemcoptic.cpp:194 2943 #, fuzzy, kde-format 2944 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2945 msgid "of Tob" 2946 msgstr "di Fev" 2947 2948 #: kdecore/kcalendarsystemcoptic.cpp:196 2949 #, fuzzy, kde-format 2950 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2951 msgid "of Mes" 2952 msgstr "di Meh" 2953 2954 #: kdecore/kcalendarsystemcoptic.cpp:198 2955 #, fuzzy, kde-format 2956 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2957 msgid "of Par" 2958 msgstr "di Mås" 2959 2960 #: kdecore/kcalendarsystemcoptic.cpp:200 2961 #, fuzzy, kde-format 2962 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2963 msgid "of Pam" 2964 msgstr "di Tamuz" 2965 2966 #: kdecore/kcalendarsystemcoptic.cpp:202 2967 #, fuzzy, kde-format 2968 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2969 msgid "of Pas" 2970 msgstr "di Bah" 2971 2972 #: kdecore/kcalendarsystemcoptic.cpp:204 2973 #, fuzzy, kde-format 2974 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2975 msgid "of Pan" 2976 msgstr "di Dja" 2977 2978 #: kdecore/kcalendarsystemcoptic.cpp:206 2979 #, fuzzy, kde-format 2980 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2981 msgid "of Epe" 2982 msgstr "di Fev" 2983 2984 #: kdecore/kcalendarsystemcoptic.cpp:208 2985 #, fuzzy, kde-format 2986 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2987 msgid "of Meo" 2988 msgstr "di Mor" 2989 2990 #: kdecore/kcalendarsystemcoptic.cpp:210 2991 #, fuzzy, kde-format 2992 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 2993 msgid "of Kou" 2994 msgstr "di Kho" 2995 2996 #: kdecore/kcalendarsystemcoptic.cpp:219 2997 #, fuzzy, kde-format 2998 msgctxt "Coptic month 1 - KLocale::ShortName" 2999 msgid "Tho" 3000 msgstr "Thl" 3001 3002 #: kdecore/kcalendarsystemcoptic.cpp:221 3003 #, fuzzy, kde-format 3004 msgctxt "Coptic month 2 - KLocale::ShortName" 3005 msgid "Pao" 3006 msgstr "Djoker" 3007 3008 #: kdecore/kcalendarsystemcoptic.cpp:223 3009 #, fuzzy, kde-format 3010 msgctxt "Coptic month 3 - KLocale::ShortName" 3011 msgid "Hat" 3012 msgstr "sem" 3013 3014 #: kdecore/kcalendarsystemcoptic.cpp:225 3015 #, fuzzy, kde-format 3016 msgctxt "Coptic month 4 - KLocale::ShortName" 3017 msgid "Kia" 3018 msgstr "Kha" 3019 3020 #: kdecore/kcalendarsystemcoptic.cpp:227 3021 #, fuzzy, kde-format 3022 msgctxt "Coptic month 5 - KLocale::ShortName" 3023 msgid "Tob" 3024 msgstr "Bouye" 3025 3026 #: kdecore/kcalendarsystemcoptic.cpp:229 3027 #, fuzzy, kde-format 3028 msgctxt "Coptic month 6 - KLocale::ShortName" 3029 msgid "Mes" 3030 msgstr "Oyi" 3031 3032 #: kdecore/kcalendarsystemcoptic.cpp:231 3033 #, fuzzy, kde-format 3034 msgctxt "Coptic month 7 - KLocale::ShortName" 3035 msgid "Par" 3036 msgstr "Mås" 3037 3038 #: kdecore/kcalendarsystemcoptic.cpp:233 3039 #, fuzzy, kde-format 3040 msgctxt "Coptic month 8 - KLocale::ShortName" 3041 msgid "Pam" 3042 msgstr "am" 3043 3044 #: kdecore/kcalendarsystemcoptic.cpp:235 3045 #, fuzzy, kde-format 3046 msgctxt "Coptic month 9 - KLocale::ShortName" 3047 msgid "Pas" 3048 msgstr "Pådjes" 3049 3050 #: kdecore/kcalendarsystemcoptic.cpp:237 3051 #, fuzzy, kde-format 3052 msgctxt "Coptic month 10 - KLocale::ShortName" 3053 msgid "Pan" 3054 msgstr "Dja" 3055 3056 #: kdecore/kcalendarsystemcoptic.cpp:239 3057 #, fuzzy, kde-format 3058 msgctxt "Coptic month 11 - KLocale::ShortName" 3059 msgid "Epe" 3060 msgstr "Cwiter" 3061 3062 #: kdecore/kcalendarsystemcoptic.cpp:241 3063 #, fuzzy, kde-format 3064 msgctxt "Coptic month 12 - KLocale::ShortName" 3065 msgid "Meo" 3066 msgstr "lon" 3067 3068 #: kdecore/kcalendarsystemcoptic.cpp:243 3069 #, fuzzy, kde-format 3070 msgctxt "Coptic month 12 - KLocale::ShortName" 3071 msgid "Kou" 3072 msgstr "Kho" 3073 3074 #: kdecore/kcalendarsystemcoptic.cpp:252 3075 #, fuzzy, kde-format 3076 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3077 msgid "of Thoout" 3078 msgstr "di Kho" 3079 3080 #: kdecore/kcalendarsystemcoptic.cpp:254 3081 #, fuzzy, kde-format 3082 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3083 msgid "of Paope" 3084 msgstr "di Tamuz" 3085 3086 #: kdecore/kcalendarsystemcoptic.cpp:256 3087 #, fuzzy, kde-format 3088 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3089 msgid "of Hathor" 3090 msgstr "di Hijjah" 3091 3092 #: kdecore/kcalendarsystemcoptic.cpp:258 3093 #, fuzzy, kde-format 3094 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3095 msgid "of Kiahk" 3096 msgstr "di Kho" 3097 3098 #: kdecore/kcalendarsystemcoptic.cpp:260 3099 #, fuzzy, kde-format 3100 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3101 msgid "of Tobe" 3102 msgstr "d' octôbe" 3103 3104 #: kdecore/kcalendarsystemcoptic.cpp:262 3105 #, fuzzy, kde-format 3106 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3107 msgid "of Meshir" 3108 msgstr "di Mehr" 3109 3110 #: kdecore/kcalendarsystemcoptic.cpp:264 3111 #, fuzzy, kde-format 3112 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3113 msgid "of Paremhotep" 3114 msgstr "Paramete" 3115 3116 #: kdecore/kcalendarsystemcoptic.cpp:266 3117 #, fuzzy, kde-format 3118 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3119 msgid "of Parmoute" 3120 msgstr "di Tamuz" 3121 3122 #: kdecore/kcalendarsystemcoptic.cpp:268 3123 #, fuzzy, kde-format 3124 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3125 msgid "of Pashons" 3126 msgstr "di Bah" 3127 3128 #: kdecore/kcalendarsystemcoptic.cpp:270 3129 #, fuzzy, kde-format 3130 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3131 msgid "of Paone" 3132 msgstr "di Dja" 3133 3134 #: kdecore/kcalendarsystemcoptic.cpp:272 3135 #, fuzzy, kde-format 3136 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3137 msgid "of Epep" 3138 msgstr "di Set" 3139 3140 #: kdecore/kcalendarsystemcoptic.cpp:274 3141 #, fuzzy, kde-format 3142 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3143 msgid "of Mesore" 3144 msgstr "di Mor" 3145 3146 #: kdecore/kcalendarsystemcoptic.cpp:276 3147 #, fuzzy, kde-format 3148 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3149 msgid "of Kouji nabot" 3150 msgstr "di Fev" 3151 3152 #: kdecore/kcalendarsystemcoptic.cpp:285 3153 #, fuzzy, kde-format 3154 msgctxt "Coptic month 1 - KLocale::LongName" 3155 msgid "Thoout" 3156 msgstr "dju" 3157 3158 #: kdecore/kcalendarsystemcoptic.cpp:287 3159 #, fuzzy, kde-format 3160 msgctxt "Coptic month 2 - KLocale::LongName" 3161 msgid "Paope" 3162 msgstr "Prôpietés" 3163 3164 #: kdecore/kcalendarsystemcoptic.cpp:289 3165 #, fuzzy, kde-format 3166 msgctxt "Coptic month 3 - KLocale::LongName" 3167 msgid "Hathor" 3168 msgstr "Oteur" 3169 3170 #: kdecore/kcalendarsystemcoptic.cpp:291 3171 #, fuzzy, kde-format 3172 msgctxt "Coptic month 4 - KLocale::LongName" 3173 msgid "Kiahk" 3174 msgstr "di Kho" 3175 3176 #: kdecore/kcalendarsystemcoptic.cpp:293 3177 #, fuzzy, kde-format 3178 msgctxt "Coptic month 5 - KLocale::LongName" 3179 msgid "Tobe" 3180 msgstr "Bouye" 3181 3182 #: kdecore/kcalendarsystemcoptic.cpp:295 3183 #, fuzzy, kde-format 3184 msgctxt "Coptic month 6 - KLocale::LongName" 3185 msgid "Meshir" 3186 msgstr "Mehr" 3187 3188 #: kdecore/kcalendarsystemcoptic.cpp:297 3189 #, fuzzy, kde-format 3190 msgctxt "Coptic month 7 - KLocale::LongName" 3191 msgid "Paremhotep" 3192 msgstr "Paramete" 3193 3194 #: kdecore/kcalendarsystemcoptic.cpp:299 3195 #, fuzzy, kde-format 3196 msgctxt "Coptic month 8 - KLocale::LongName" 3197 msgid "Parmoute" 3198 msgstr "Paramete" 3199 3200 #: kdecore/kcalendarsystemcoptic.cpp:301 3201 #, fuzzy, kde-format 3202 msgctxt "Coptic month 9 - KLocale::LongName" 3203 msgid "Pashons" 3204 msgstr "Djoker" 3205 3206 #: kdecore/kcalendarsystemcoptic.cpp:303 3207 #, fuzzy, kde-format 3208 msgctxt "Coptic month 10 - KLocale::LongName" 3209 msgid "Paone" 3210 msgstr "Pont" 3211 3212 #: kdecore/kcalendarsystemcoptic.cpp:305 3213 #, fuzzy, kde-format 3214 msgctxt "Coptic month 11 - KLocale::LongName" 3215 msgid "Epep" 3216 msgstr "Cwiter" 3217 3218 #: kdecore/kcalendarsystemcoptic.cpp:307 3219 #, fuzzy, kde-format 3220 msgctxt "Coptic month 12 - KLocale::LongName" 3221 msgid "Mesore" 3222 msgstr "&Rimete come divant" 3223 3224 #: kdecore/kcalendarsystemcoptic.cpp:309 3225 #, fuzzy, kde-format 3226 msgctxt "Coptic month 12 - KLocale::LongName" 3227 msgid "Kouji nabot" 3228 msgstr "di Fev" 3229 3230 #: kdecore/kcalendarsystemcoptic.cpp:324 3231 #, kde-format 3232 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3233 msgid "P" 3234 msgstr "" 3235 3236 #: kdecore/kcalendarsystemcoptic.cpp:326 3237 #, kde-format 3238 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3239 msgid "P" 3240 msgstr "" 3241 3242 #: kdecore/kcalendarsystemcoptic.cpp:328 3243 #, kde-format 3244 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3245 msgid "P" 3246 msgstr "" 3247 3248 #: kdecore/kcalendarsystemcoptic.cpp:330 3249 #, kde-format 3250 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3251 msgid "P" 3252 msgstr "" 3253 3254 #: kdecore/kcalendarsystemcoptic.cpp:332 3255 #, kde-format 3256 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3257 msgid "P" 3258 msgstr "" 3259 3260 #: kdecore/kcalendarsystemcoptic.cpp:334 3261 #, kde-format 3262 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3263 msgid "P" 3264 msgstr "" 3265 3266 #: kdecore/kcalendarsystemcoptic.cpp:336 3267 #, kde-format 3268 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3269 msgid "T" 3270 msgstr "" 3271 3272 #: kdecore/kcalendarsystemcoptic.cpp:345 3273 #, fuzzy, kde-format 3274 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3275 msgid "Pes" 3276 msgstr "Pådjes" 3277 3278 #: kdecore/kcalendarsystemcoptic.cpp:347 3279 #, fuzzy, kde-format 3280 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3281 msgid "Psh" 3282 msgstr "Djoker" 3283 3284 #: kdecore/kcalendarsystemcoptic.cpp:349 3285 #, fuzzy, kde-format 3286 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3287 msgid "Pef" 3288 msgstr "Pådjes" 3289 3290 #: kdecore/kcalendarsystemcoptic.cpp:351 3291 #, kde-format 3292 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3293 msgid "Pti" 3294 msgstr "" 3295 3296 #: kdecore/kcalendarsystemcoptic.cpp:353 3297 #, fuzzy, kde-format 3298 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3299 msgid "Pso" 3300 msgstr "Djoker" 3301 3302 #: kdecore/kcalendarsystemcoptic.cpp:355 3303 #, fuzzy, kde-format 3304 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3305 msgid "Psa" 3306 msgstr "Djoker" 3307 3308 #: kdecore/kcalendarsystemcoptic.cpp:357 3309 #, kde-format 3310 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3311 msgid "Tky" 3312 msgstr "" 3313 3314 #: kdecore/kcalendarsystemcoptic.cpp:365 3315 #, fuzzy, kde-format 3316 msgctxt "Coptic weekday 1 - KLocale::LongName" 3317 msgid "Pesnau" 3318 msgstr "Djoker" 3319 3320 #: kdecore/kcalendarsystemcoptic.cpp:367 3321 #, fuzzy, kde-format 3322 msgctxt "Coptic weekday 2 - KLocale::LongName" 3323 msgid "Pshoment" 3324 msgstr "Rawete" 3325 3326 #: kdecore/kcalendarsystemcoptic.cpp:369 3327 #, kde-format 3328 msgctxt "Coptic weekday 3 - KLocale::LongName" 3329 msgid "Peftoou" 3330 msgstr "" 3331 3332 #: kdecore/kcalendarsystemcoptic.cpp:371 3333 #, kde-format 3334 msgctxt "Coptic weekday 4 - KLocale::LongName" 3335 msgid "Ptiou" 3336 msgstr "" 3337 3338 #: kdecore/kcalendarsystemcoptic.cpp:373 3339 #, fuzzy, kde-format 3340 msgctxt "Coptic weekday 5 - KLocale::LongName" 3341 msgid "Psoou" 3342 msgstr "Djoker" 3343 3344 #: kdecore/kcalendarsystemcoptic.cpp:375 3345 #, kde-format 3346 msgctxt "Coptic weekday 6 - KLocale::LongName" 3347 msgid "Psabbaton" 3348 msgstr "" 3349 3350 #: kdecore/kcalendarsystemcoptic.cpp:377 3351 #, kde-format 3352 msgctxt "Coptic weekday 7 - KLocale::LongName" 3353 msgid "Tkyriakē" 3354 msgstr "" 3355 3356 #: kdecore/kcalendarsystemethiopian.cpp:50 3357 #, kde-format 3358 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3359 msgid "Amata Mehrat" 3360 msgstr "" 3361 3362 #: kdecore/kcalendarsystemethiopian.cpp:51 3363 #, kde-format 3364 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3365 msgid "AM" 3366 msgstr "" 3367 3368 #: kdecore/kcalendarsystemethiopian.cpp:52 3369 #, kde-format 3370 msgctxt "" 3371 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3372 msgid "%Ey %EC" 3373 msgstr "" 3374 3375 #: kdecore/kcalendarsystemethiopian.cpp:66 3376 #, kde-format 3377 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3378 msgid "M" 3379 msgstr "" 3380 3381 #: kdecore/kcalendarsystemethiopian.cpp:68 3382 #, kde-format 3383 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3384 msgid "T" 3385 msgstr "" 3386 3387 #: kdecore/kcalendarsystemethiopian.cpp:70 3388 #, kde-format 3389 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3390 msgid "H" 3391 msgstr "" 3392 3393 #: kdecore/kcalendarsystemethiopian.cpp:72 3394 #, kde-format 3395 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3396 msgid "T" 3397 msgstr "" 3398 3399 #: kdecore/kcalendarsystemethiopian.cpp:74 3400 #, kde-format 3401 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3402 msgid "T" 3403 msgstr "" 3404 3405 #: kdecore/kcalendarsystemethiopian.cpp:76 3406 #, kde-format 3407 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3408 msgid "Y" 3409 msgstr "" 3410 3411 #: kdecore/kcalendarsystemethiopian.cpp:78 3412 #, kde-format 3413 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3414 msgid "M" 3415 msgstr "" 3416 3417 #: kdecore/kcalendarsystemethiopian.cpp:80 3418 #, kde-format 3419 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3420 msgid "M" 3421 msgstr "" 3422 3423 #: kdecore/kcalendarsystemethiopian.cpp:82 3424 #, kde-format 3425 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3426 msgid "G" 3427 msgstr "" 3428 3429 #: kdecore/kcalendarsystemethiopian.cpp:84 3430 #, kde-format 3431 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3432 msgid "S" 3433 msgstr "" 3434 3435 #: kdecore/kcalendarsystemethiopian.cpp:86 3436 #, kde-format 3437 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3438 msgid "H" 3439 msgstr "" 3440 3441 #: kdecore/kcalendarsystemethiopian.cpp:88 3442 #, kde-format 3443 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3444 msgid "N" 3445 msgstr "" 3446 3447 #: kdecore/kcalendarsystemethiopian.cpp:90 3448 #, kde-format 3449 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3450 msgid "P" 3451 msgstr "" 3452 3453 #: kdecore/kcalendarsystemethiopian.cpp:99 3454 #, fuzzy, kde-format 3455 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3456 msgid "of Mes" 3457 msgstr "di Meh" 3458 3459 #: kdecore/kcalendarsystemethiopian.cpp:101 3460 #, fuzzy, kde-format 3461 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3462 msgid "of Teq" 3463 msgstr "di Tevet" 3464 3465 #: kdecore/kcalendarsystemethiopian.cpp:103 3466 #, fuzzy, kde-format 3467 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3468 msgid "of Hed" 3469 msgstr "di Fev" 3470 3471 #: kdecore/kcalendarsystemethiopian.cpp:105 3472 #, fuzzy, kde-format 3473 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3474 msgid "of Tah" 3475 msgstr "di Bah" 3476 3477 #: kdecore/kcalendarsystemethiopian.cpp:107 3478 #, fuzzy, kde-format 3479 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3480 msgid "of Ter" 3481 msgstr "di Tir" 3482 3483 #: kdecore/kcalendarsystemethiopian.cpp:109 3484 #, fuzzy, kde-format 3485 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3486 msgid "of Yak" 3487 msgstr "di Dja" 3488 3489 #: kdecore/kcalendarsystemethiopian.cpp:111 3490 #, fuzzy, kde-format 3491 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3492 msgid "of Mag" 3493 msgstr "di Mås" 3494 3495 #: kdecore/kcalendarsystemethiopian.cpp:113 3496 #, fuzzy, kde-format 3497 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3498 msgid "of Miy" 3499 msgstr "di May" 3500 3501 #: kdecore/kcalendarsystemethiopian.cpp:115 3502 #, fuzzy, kde-format 3503 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3504 msgid "of Gen" 3505 msgstr "di Dja" 3506 3507 #: kdecore/kcalendarsystemethiopian.cpp:117 3508 #, fuzzy, kde-format 3509 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3510 msgid "of Sen" 3511 msgstr "di Set" 3512 3513 #: kdecore/kcalendarsystemethiopian.cpp:119 3514 #, fuzzy, kde-format 3515 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3516 msgid "of Ham" 3517 msgstr "di Tamuz" 3518 3519 #: kdecore/kcalendarsystemethiopian.cpp:121 3520 #, fuzzy, kde-format 3521 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3522 msgid "of Neh" 3523 msgstr "di Meh" 3524 3525 #: kdecore/kcalendarsystemethiopian.cpp:123 3526 #, fuzzy, kde-format 3527 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3528 msgid "of Pag" 3529 msgstr "di Tamuz" 3530 3531 #: kdecore/kcalendarsystemethiopian.cpp:132 3532 #, fuzzy, kde-format 3533 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3534 msgid "Mes" 3535 msgstr "Oyi" 3536 3537 #: kdecore/kcalendarsystemethiopian.cpp:134 3538 #, fuzzy, kde-format 3539 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3540 msgid "Teq" 3541 msgstr "mår" 3542 3543 #: kdecore/kcalendarsystemethiopian.cpp:136 3544 #, fuzzy, kde-format 3545 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3546 msgid "Hed" 3547 msgstr "mie" 3548 3549 #: kdecore/kcalendarsystemethiopian.cpp:138 3550 #, fuzzy, kde-format 3551 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3552 msgid "Tah" 3553 msgstr "Batch" 3554 3555 #: kdecore/kcalendarsystemethiopian.cpp:140 3556 #, fuzzy, kde-format 3557 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3558 msgid "Ter" 3559 msgstr "mår" 3560 3561 #: kdecore/kcalendarsystemethiopian.cpp:142 3562 #, fuzzy, kde-format 3563 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3564 msgid "Yak" 3565 msgstr "di Dja" 3566 3567 #: kdecore/kcalendarsystemethiopian.cpp:144 3568 #, fuzzy, kde-format 3569 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3570 msgid "Mag" 3571 msgstr "Mås" 3572 3573 #: kdecore/kcalendarsystemethiopian.cpp:146 3574 #, fuzzy, kde-format 3575 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3576 msgid "Miy" 3577 msgstr "May" 3578 3579 #: kdecore/kcalendarsystemethiopian.cpp:148 3580 #, fuzzy, kde-format 3581 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3582 msgid "Gen" 3583 msgstr "Vert:" 3584 3585 #: kdecore/kcalendarsystemethiopian.cpp:150 3586 #, fuzzy, kde-format 3587 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3588 msgid "Sen" 3589 msgstr "&Evoyî" 3590 3591 #: kdecore/kcalendarsystemethiopian.cpp:152 3592 #, fuzzy, kde-format 3593 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3594 msgid "Ham" 3595 msgstr "am" 3596 3597 #: kdecore/kcalendarsystemethiopian.cpp:154 3598 #, fuzzy, kde-format 3599 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3600 msgid "Neh" 3601 msgstr "Meh" 3602 3603 #: kdecore/kcalendarsystemethiopian.cpp:156 3604 #, fuzzy, kde-format 3605 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3606 msgid "Pag" 3607 msgstr "Pådjes" 3608 3609 #: kdecore/kcalendarsystemethiopian.cpp:165 3610 #, fuzzy, kde-format 3611 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3612 msgid "of Meskerem" 3613 msgstr "di Mehr" 3614 3615 #: kdecore/kcalendarsystemethiopian.cpp:167 3616 #, fuzzy, kde-format 3617 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3618 msgid "of Tequemt" 3619 msgstr "di Tevet" 3620 3621 #: kdecore/kcalendarsystemethiopian.cpp:169 3622 #, fuzzy, kde-format 3623 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3624 msgid "of Hedar" 3625 msgstr "d' Adar" 3626 3627 #: kdecore/kcalendarsystemethiopian.cpp:171 3628 #, fuzzy, kde-format 3629 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3630 msgid "of Tahsas" 3631 msgstr "di Bahman" 3632 3633 #: kdecore/kcalendarsystemethiopian.cpp:173 3634 #, fuzzy, kde-format 3635 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3636 msgid "of Ter" 3637 msgstr "di Tir" 3638 3639 #: kdecore/kcalendarsystemethiopian.cpp:175 3640 #, fuzzy, kde-format 3641 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3642 msgid "of Yakatit" 3643 msgstr "di Far" 3644 3645 #: kdecore/kcalendarsystemethiopian.cpp:177 3646 #, fuzzy, kde-format 3647 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3648 msgid "of Magabit" 3649 msgstr "di Rajab" 3650 3651 #: kdecore/kcalendarsystemethiopian.cpp:179 3652 #, fuzzy, kde-format 3653 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3654 msgid "of Miyazya" 3655 msgstr "di May" 3656 3657 #: kdecore/kcalendarsystemethiopian.cpp:181 3658 #, fuzzy, kde-format 3659 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3660 msgid "of Genbot" 3661 msgstr "di Fev" 3662 3663 #: kdecore/kcalendarsystemethiopian.cpp:183 3664 #, fuzzy, kde-format 3665 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3666 msgid "of Sene" 3667 msgstr "di Set" 3668 3669 #: kdecore/kcalendarsystemethiopian.cpp:185 3670 #, fuzzy, kde-format 3671 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3672 msgid "of Hamle" 3673 msgstr "di Tamuz" 3674 3675 #: kdecore/kcalendarsystemethiopian.cpp:187 3676 #, fuzzy, kde-format 3677 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3678 msgid "of Nehase" 3679 msgstr "di Sha" 3680 3681 #: kdecore/kcalendarsystemethiopian.cpp:189 3682 #, fuzzy, kde-format 3683 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3684 msgid "of Pagumen" 3685 msgstr "di Tamuz" 3686 3687 #: kdecore/kcalendarsystemethiopian.cpp:198 3688 #, fuzzy, kde-format 3689 msgctxt "Ethiopian month 1 - KLocale::LongName" 3690 msgid "Meskerem" 3691 msgstr "di Mehr" 3692 3693 #: kdecore/kcalendarsystemethiopian.cpp:200 3694 #, fuzzy, kde-format 3695 msgctxt "Ethiopian month 2 - KLocale::LongName" 3696 msgid "Tequemt" 3697 msgstr "Tevet" 3698 3699 #: kdecore/kcalendarsystemethiopian.cpp:202 3700 #, fuzzy, kde-format 3701 msgctxt "Ethiopian month 3 - KLocale::LongName" 3702 msgid "Hedar" 3703 msgstr "Adar" 3704 3705 #: kdecore/kcalendarsystemethiopian.cpp:204 3706 #, fuzzy, kde-format 3707 msgctxt "Ethiopian month 4 - KLocale::LongName" 3708 msgid "Tahsas" 3709 msgstr "Bouye" 3710 3711 #: kdecore/kcalendarsystemethiopian.cpp:206 3712 #, fuzzy, kde-format 3713 msgctxt "Ethiopian month 5 - KLocale::LongName" 3714 msgid "Ter" 3715 msgstr "mår" 3716 3717 #: kdecore/kcalendarsystemethiopian.cpp:208 3718 #, fuzzy, kde-format 3719 msgctxt "Ethiopian month 6 - KLocale::LongName" 3720 msgid "Yakatit" 3721 msgstr "di Far" 3722 3723 #: kdecore/kcalendarsystemethiopian.cpp:210 3724 #, fuzzy, kde-format 3725 msgctxt "Ethiopian month 7 - KLocale::LongName" 3726 msgid "Magabit" 3727 msgstr "di Rajab" 3728 3729 #: kdecore/kcalendarsystemethiopian.cpp:212 3730 #, fuzzy, kde-format 3731 msgctxt "Ethiopian month 8 - KLocale::LongName" 3732 msgid "Miyazya" 3733 msgstr "di May" 3734 3735 #: kdecore/kcalendarsystemethiopian.cpp:214 3736 #, fuzzy, kde-format 3737 msgctxt "Ethiopian month 9 - KLocale::LongName" 3738 msgid "Genbot" 3739 msgstr "di Fev" 3740 3741 #: kdecore/kcalendarsystemethiopian.cpp:216 3742 #, fuzzy, kde-format 3743 msgctxt "Ethiopian month 10 - KLocale::LongName" 3744 msgid "Sene" 3745 msgstr "&Evoyî" 3746 3747 #: kdecore/kcalendarsystemethiopian.cpp:218 3748 #, fuzzy, kde-format 3749 msgctxt "Ethiopian month 11 - KLocale::LongName" 3750 msgid "Hamle" 3751 msgstr "No" 3752 3753 #: kdecore/kcalendarsystemethiopian.cpp:220 3754 #, fuzzy, kde-format 3755 msgctxt "Ethiopian month 12 - KLocale::LongName" 3756 msgid "Nehase" 3757 msgstr "No" 3758 3759 #: kdecore/kcalendarsystemethiopian.cpp:222 3760 #, fuzzy, kde-format 3761 msgctxt "Ethiopian month 13 - KLocale::LongName" 3762 msgid "Pagumen" 3763 msgstr "Pådjes" 3764 3765 #: kdecore/kcalendarsystemethiopian.cpp:236 3766 #, kde-format 3767 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3768 msgid "S" 3769 msgstr "" 3770 3771 #: kdecore/kcalendarsystemethiopian.cpp:238 3772 #, kde-format 3773 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3774 msgid "M" 3775 msgstr "" 3776 3777 #: kdecore/kcalendarsystemethiopian.cpp:240 3778 #, kde-format 3779 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3780 msgid "R" 3781 msgstr "" 3782 3783 #: kdecore/kcalendarsystemethiopian.cpp:242 3784 #, kde-format 3785 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3786 msgid "H" 3787 msgstr "" 3788 3789 #: kdecore/kcalendarsystemethiopian.cpp:244 3790 #, fuzzy, kde-format 3791 #| msgid "Av" 3792 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3793 msgid "A" 3794 msgstr "Av" 3795 3796 #: kdecore/kcalendarsystemethiopian.cpp:246 3797 #, kde-format 3798 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3799 msgid "Q" 3800 msgstr "" 3801 3802 #: kdecore/kcalendarsystemethiopian.cpp:248 3803 #, kde-format 3804 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3805 msgid "E" 3806 msgstr "" 3807 3808 #: kdecore/kcalendarsystemethiopian.cpp:257 3809 #, fuzzy, kde-format 3810 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3811 msgid "Seg" 3812 msgstr "Set" 3813 3814 #: kdecore/kcalendarsystemethiopian.cpp:259 3815 #, fuzzy, kde-format 3816 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3817 msgid "Mak" 3818 msgstr "Mås" 3819 3820 #: kdecore/kcalendarsystemethiopian.cpp:261 3821 #, fuzzy, kde-format 3822 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3823 msgid "Rob" 3824 msgstr "Bouye" 3825 3826 #: kdecore/kcalendarsystemethiopian.cpp:263 3827 #, fuzzy, kde-format 3828 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3829 msgid "Ham" 3830 msgstr "am" 3831 3832 #: kdecore/kcalendarsystemethiopian.cpp:265 3833 #, fuzzy, kde-format 3834 #| msgid "Arb" 3835 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3836 msgid "Arb" 3837 msgstr "Arb" 3838 3839 #: kdecore/kcalendarsystemethiopian.cpp:267 3840 #, fuzzy, kde-format 3841 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3842 msgid "Qed" 3843 msgstr "mie" 3844 3845 #: kdecore/kcalendarsystemethiopian.cpp:269 3846 #, fuzzy, kde-format 3847 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3848 msgid "Ehu" 3849 msgstr "dju" 3850 3851 #: kdecore/kcalendarsystemethiopian.cpp:276 3852 #, fuzzy, kde-format 3853 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3854 msgid "Segno" 3855 msgstr "&Evoyî" 3856 3857 #: kdecore/kcalendarsystemethiopian.cpp:278 3858 #, fuzzy, kde-format 3859 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3860 msgid "Maksegno" 3861 msgstr "&Evoyî" 3862 3863 #: kdecore/kcalendarsystemethiopian.cpp:280 3864 #, fuzzy, kde-format 3865 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3866 msgid "Rob" 3867 msgstr "Bouye" 3868 3869 #: kdecore/kcalendarsystemethiopian.cpp:282 3870 #, fuzzy, kde-format 3871 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3872 msgid "Hamus" 3873 msgstr "Djoker" 3874 3875 #: kdecore/kcalendarsystemethiopian.cpp:284 3876 #, fuzzy, kde-format 3877 #| msgid "Arb" 3878 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3879 msgid "Arb" 3880 msgstr "Arb" 3881 3882 #: kdecore/kcalendarsystemethiopian.cpp:286 3883 #, fuzzy, kde-format 3884 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3885 msgid "Qedame" 3886 msgstr "No" 3887 3888 #: kdecore/kcalendarsystemethiopian.cpp:288 3889 #, fuzzy, kde-format 3890 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3891 msgid "Ehud" 3892 msgstr "dju" 3893 3894 #: kdecore/kcalendarsystemgregorian.cpp:53 3895 #, kde-format 3896 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3897 msgid "Before Common Era" 3898 msgstr "Divant l' Ere comone" 3899 3900 #: kdecore/kcalendarsystemgregorian.cpp:54 3901 #, kde-format 3902 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3903 msgid "BCE" 3904 msgstr "DEC" 3905 3906 #: kdecore/kcalendarsystemgregorian.cpp:56 3907 #, kde-format 3908 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3909 msgid "Before Christ" 3910 msgstr "Divant Djezus-Crisse" 3911 3912 #: kdecore/kcalendarsystemgregorian.cpp:57 3913 #, kde-format 3914 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3915 msgid "BC" 3916 msgstr "Div. Dj.-C." 3917 3918 #: kdecore/kcalendarsystemgregorian.cpp:59 3919 #, kde-format 3920 msgctxt "" 3921 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3922 msgid "%Ey %EC" 3923 msgstr "%Ey %EC" 3924 3925 #: kdecore/kcalendarsystemgregorian.cpp:63 3926 #, kde-format 3927 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3928 msgid "Common Era" 3929 msgstr "Ere comone" 3930 3931 #: kdecore/kcalendarsystemgregorian.cpp:64 3932 #, kde-format 3933 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3934 msgid "CE" 3935 msgstr "EC" 3936 3937 #: kdecore/kcalendarsystemgregorian.cpp:66 3938 #: kdecore/kcalendarsystemjapanese.cpp:57 3939 #, kde-format 3940 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3941 msgid "Anno Domini" 3942 msgstr "Anno Domini" 3943 3944 #: kdecore/kcalendarsystemgregorian.cpp:67 3945 #: kdecore/kcalendarsystemjapanese.cpp:58 3946 #, kde-format 3947 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3948 msgid "AD" 3949 msgstr "AD" 3950 3951 #: kdecore/kcalendarsystemgregorian.cpp:69 3952 #: kdecore/kcalendarsystemjapanese.cpp:59 3953 #, kde-format 3954 msgctxt "" 3955 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3956 msgid "%Ey %EC" 3957 msgstr "%Ey %EC" 3958 3959 #: kdecore/kcalendarsystemgregorian.cpp:138 3960 #, kde-format 3961 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3962 msgid "J" 3963 msgstr "D" 3964 3965 #: kdecore/kcalendarsystemgregorian.cpp:140 3966 #, kde-format 3967 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3968 msgid "F" 3969 msgstr "F" 3970 3971 #: kdecore/kcalendarsystemgregorian.cpp:142 3972 #, kde-format 3973 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3974 msgid "M" 3975 msgstr "M" 3976 3977 #: kdecore/kcalendarsystemgregorian.cpp:144 3978 #, kde-format 3979 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3980 msgid "A" 3981 msgstr "A" 3982 3983 #: kdecore/kcalendarsystemgregorian.cpp:146 3984 #, kde-format 3985 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3986 msgid "M" 3987 msgstr "M" 3988 3989 #: kdecore/kcalendarsystemgregorian.cpp:148 3990 #, kde-format 3991 msgctxt "Gregorian month 6 - KLocale::NarrowName" 3992 msgid "J" 3993 msgstr "D" 3994 3995 #: kdecore/kcalendarsystemgregorian.cpp:150 3996 #, kde-format 3997 msgctxt "Gregorian month 7 - KLocale::NarrowName" 3998 msgid "J" 3999 msgstr "D" 4000 4001 #: kdecore/kcalendarsystemgregorian.cpp:152 4002 #, kde-format 4003 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4004 msgid "A" 4005 msgstr "A" 4006 4007 #: kdecore/kcalendarsystemgregorian.cpp:154 4008 #, kde-format 4009 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4010 msgid "S" 4011 msgstr "S" 4012 4013 #: kdecore/kcalendarsystemgregorian.cpp:156 4014 #, kde-format 4015 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4016 msgid "O" 4017 msgstr "O" 4018 4019 #: kdecore/kcalendarsystemgregorian.cpp:158 4020 #, kde-format 4021 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4022 msgid "N" 4023 msgstr "N" 4024 4025 #: kdecore/kcalendarsystemgregorian.cpp:160 4026 #, kde-format 4027 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4028 msgid "D" 4029 msgstr "D" 4030 4031 #: kdecore/kcalendarsystemgregorian.cpp:169 4032 #, kde-format 4033 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4034 msgid "of Jan" 4035 msgstr "di dja" 4036 4037 #: kdecore/kcalendarsystemgregorian.cpp:171 4038 #, kde-format 4039 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4040 msgid "of Feb" 4041 msgstr "di fev" 4042 4043 #: kdecore/kcalendarsystemgregorian.cpp:173 4044 #, kde-format 4045 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4046 msgid "of Mar" 4047 msgstr "di mås" 4048 4049 #: kdecore/kcalendarsystemgregorian.cpp:175 4050 #, kde-format 4051 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4052 msgid "of Apr" 4053 msgstr "d' avr" 4054 4055 #: kdecore/kcalendarsystemgregorian.cpp:177 4056 #, kde-format 4057 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4058 msgid "of May" 4059 msgstr "di may" 4060 4061 #: kdecore/kcalendarsystemgregorian.cpp:179 4062 #, kde-format 4063 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4064 msgid "of Jun" 4065 msgstr "di djn" 4066 4067 #: kdecore/kcalendarsystemgregorian.cpp:181 4068 #, kde-format 4069 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4070 msgid "of Jul" 4071 msgstr "di djl" 4072 4073 #: kdecore/kcalendarsystemgregorian.cpp:183 4074 #, kde-format 4075 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4076 msgid "of Aug" 4077 msgstr "d' awo" 4078 4079 #: kdecore/kcalendarsystemgregorian.cpp:185 4080 #, kde-format 4081 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4082 msgid "of Sep" 4083 msgstr "di set" 4084 4085 #: kdecore/kcalendarsystemgregorian.cpp:187 4086 #, kde-format 4087 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4088 msgid "of Oct" 4089 msgstr "d' oct" 4090 4091 #: kdecore/kcalendarsystemgregorian.cpp:189 4092 #, kde-format 4093 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4094 msgid "of Nov" 4095 msgstr "di nôv" 4096 4097 #: kdecore/kcalendarsystemgregorian.cpp:191 4098 #, kde-format 4099 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4100 msgid "of Dec" 4101 msgstr "di dec" 4102 4103 #: kdecore/kcalendarsystemgregorian.cpp:200 4104 #, kde-format 4105 msgctxt "Gregorian month 1 - KLocale::ShortName" 4106 msgid "Jan" 4107 msgstr "dja" 4108 4109 #: kdecore/kcalendarsystemgregorian.cpp:202 4110 #, kde-format 4111 msgctxt "Gregorian month 2 - KLocale::ShortName" 4112 msgid "Feb" 4113 msgstr "fev" 4114 4115 #: kdecore/kcalendarsystemgregorian.cpp:204 4116 #, kde-format 4117 msgctxt "Gregorian month 3 - KLocale::ShortName" 4118 msgid "Mar" 4119 msgstr "mås" 4120 4121 #: kdecore/kcalendarsystemgregorian.cpp:206 4122 #, kde-format 4123 msgctxt "Gregorian month 4 - KLocale::ShortName" 4124 msgid "Apr" 4125 msgstr "avr" 4126 4127 #: kdecore/kcalendarsystemgregorian.cpp:208 4128 #, kde-format 4129 msgctxt "Gregorian month 5 - KLocale::ShortName" 4130 msgid "May" 4131 msgstr "may" 4132 4133 #: kdecore/kcalendarsystemgregorian.cpp:210 4134 #, kde-format 4135 msgctxt "Gregorian month 6 - KLocale::ShortName" 4136 msgid "Jun" 4137 msgstr "djn" 4138 4139 #: kdecore/kcalendarsystemgregorian.cpp:212 4140 #, kde-format 4141 msgctxt "Gregorian month 7 - KLocale::ShortName" 4142 msgid "Jul" 4143 msgstr "djl" 4144 4145 #: kdecore/kcalendarsystemgregorian.cpp:214 4146 #, kde-format 4147 msgctxt "Gregorian month 8 - KLocale::ShortName" 4148 msgid "Aug" 4149 msgstr "awo" 4150 4151 #: kdecore/kcalendarsystemgregorian.cpp:216 4152 #, kde-format 4153 msgctxt "Gregorian month 9 - KLocale::ShortName" 4154 msgid "Sep" 4155 msgstr "set" 4156 4157 #: kdecore/kcalendarsystemgregorian.cpp:218 4158 #, kde-format 4159 msgctxt "Gregorian month 10 - KLocale::ShortName" 4160 msgid "Oct" 4161 msgstr "oct" 4162 4163 #: kdecore/kcalendarsystemgregorian.cpp:220 4164 #, kde-format 4165 msgctxt "Gregorian month 11 - KLocale::ShortName" 4166 msgid "Nov" 4167 msgstr "nôv" 4168 4169 #: kdecore/kcalendarsystemgregorian.cpp:222 4170 #, kde-format 4171 msgctxt "Gregorian month 12 - KLocale::ShortName" 4172 msgid "Dec" 4173 msgstr "dec" 4174 4175 #: kdecore/kcalendarsystemgregorian.cpp:231 4176 #, kde-format 4177 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4178 msgid "of January" 4179 msgstr "di djanvî" 4180 4181 #: kdecore/kcalendarsystemgregorian.cpp:233 4182 #, kde-format 4183 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4184 msgid "of February" 4185 msgstr "di fevrî" 4186 4187 #: kdecore/kcalendarsystemgregorian.cpp:235 4188 #, kde-format 4189 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4190 msgid "of March" 4191 msgstr "di måss" 4192 4193 #: kdecore/kcalendarsystemgregorian.cpp:237 4194 #, kde-format 4195 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4196 msgid "of April" 4197 msgstr "d' avri" 4198 4199 #: kdecore/kcalendarsystemgregorian.cpp:239 4200 #, kde-format 4201 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4202 msgid "of May" 4203 msgstr "di may" 4204 4205 #: kdecore/kcalendarsystemgregorian.cpp:241 4206 #, kde-format 4207 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4208 msgid "of June" 4209 msgstr "di djun" 4210 4211 #: kdecore/kcalendarsystemgregorian.cpp:243 4212 #, kde-format 4213 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4214 msgid "of July" 4215 msgstr "di djulete" 4216 4217 #: kdecore/kcalendarsystemgregorian.cpp:245 4218 #, kde-format 4219 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4220 msgid "of August" 4221 msgstr "d' awousse" 4222 4223 #: kdecore/kcalendarsystemgregorian.cpp:247 4224 #, kde-format 4225 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4226 msgid "of September" 4227 msgstr "di setimbe" 4228 4229 #: kdecore/kcalendarsystemgregorian.cpp:249 4230 #, kde-format 4231 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4232 msgid "of October" 4233 msgstr "d' octôbe" 4234 4235 #: kdecore/kcalendarsystemgregorian.cpp:251 4236 #, kde-format 4237 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4238 msgid "of November" 4239 msgstr "di nôvimbe" 4240 4241 #: kdecore/kcalendarsystemgregorian.cpp:253 4242 #, kde-format 4243 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4244 msgid "of December" 4245 msgstr "di decimbe" 4246 4247 #: kdecore/kcalendarsystemgregorian.cpp:262 4248 #, kde-format 4249 msgctxt "Gregorian month 1 - KLocale::LongName" 4250 msgid "January" 4251 msgstr "djanvî" 4252 4253 #: kdecore/kcalendarsystemgregorian.cpp:264 4254 #, kde-format 4255 msgctxt "Gregorian month 2 - KLocale::LongName" 4256 msgid "February" 4257 msgstr "fevrî" 4258 4259 #: kdecore/kcalendarsystemgregorian.cpp:266 4260 #, kde-format 4261 msgctxt "Gregorian month 3 - KLocale::LongName" 4262 msgid "March" 4263 msgstr "måss" 4264 4265 #: kdecore/kcalendarsystemgregorian.cpp:268 4266 #, kde-format 4267 msgctxt "Gregorian month 4 - KLocale::LongName" 4268 msgid "April" 4269 msgstr "avri" 4270 4271 #: kdecore/kcalendarsystemgregorian.cpp:270 4272 #, kde-format 4273 msgctxt "Gregorian month 5 - KLocale::LongName" 4274 msgid "May" 4275 msgstr "may" 4276 4277 #: kdecore/kcalendarsystemgregorian.cpp:272 4278 #, kde-format 4279 msgctxt "Gregorian month 6 - KLocale::LongName" 4280 msgid "June" 4281 msgstr "djun" 4282 4283 #: kdecore/kcalendarsystemgregorian.cpp:274 4284 #, kde-format 4285 msgctxt "Gregorian month 7 - KLocale::LongName" 4286 msgid "July" 4287 msgstr "djulete" 4288 4289 #: kdecore/kcalendarsystemgregorian.cpp:276 4290 #, kde-format 4291 msgctxt "Gregorian month 8 - KLocale::LongName" 4292 msgid "August" 4293 msgstr "awousse" 4294 4295 #: kdecore/kcalendarsystemgregorian.cpp:278 4296 #, kde-format 4297 msgctxt "Gregorian month 9 - KLocale::LongName" 4298 msgid "September" 4299 msgstr "setimbe" 4300 4301 #: kdecore/kcalendarsystemgregorian.cpp:280 4302 #, kde-format 4303 msgctxt "Gregorian month 10 - KLocale::LongName" 4304 msgid "October" 4305 msgstr "octôbe" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:282 4308 #, kde-format 4309 msgctxt "Gregorian month 11 - KLocale::LongName" 4310 msgid "November" 4311 msgstr "nôvimbe" 4312 4313 #: kdecore/kcalendarsystemgregorian.cpp:284 4314 #, kde-format 4315 msgctxt "Gregorian month 12 - KLocale::LongName" 4316 msgid "December" 4317 msgstr "decimbe" 4318 4319 #: kdecore/kcalendarsystemgregorian.cpp:297 4320 #: kdecore/kcalendarsystemhebrew.cpp:807 4321 #, kde-format 4322 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4323 msgid "M" 4324 msgstr "L" 4325 4326 #: kdecore/kcalendarsystemgregorian.cpp:299 4327 #: kdecore/kcalendarsystemhebrew.cpp:809 4328 #, kde-format 4329 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4330 msgid "T" 4331 msgstr "M" 4332 4333 #: kdecore/kcalendarsystemgregorian.cpp:301 4334 #: kdecore/kcalendarsystemhebrew.cpp:811 4335 #, kde-format 4336 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4337 msgid "W" 4338 msgstr "M" 4339 4340 #: kdecore/kcalendarsystemgregorian.cpp:303 4341 #: kdecore/kcalendarsystemhebrew.cpp:813 4342 #, kde-format 4343 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4344 msgid "T" 4345 msgstr "D" 4346 4347 #: kdecore/kcalendarsystemgregorian.cpp:305 4348 #: kdecore/kcalendarsystemhebrew.cpp:815 4349 #, kde-format 4350 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4351 msgid "F" 4352 msgstr "V" 4353 4354 #: kdecore/kcalendarsystemgregorian.cpp:307 4355 #: kdecore/kcalendarsystemhebrew.cpp:817 4356 #, kde-format 4357 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4358 msgid "S" 4359 msgstr "S" 4360 4361 #: kdecore/kcalendarsystemgregorian.cpp:309 4362 #: kdecore/kcalendarsystemhebrew.cpp:819 4363 #, kde-format 4364 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4365 msgid "S" 4366 msgstr "D" 4367 4368 #: kdecore/kcalendarsystemgregorian.cpp:318 4369 #: kdecore/kcalendarsystemhebrew.cpp:828 4370 #, kde-format 4371 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4372 msgid "Mon" 4373 msgstr "Lon" 4374 4375 #: kdecore/kcalendarsystemgregorian.cpp:320 4376 #: kdecore/kcalendarsystemhebrew.cpp:830 4377 #, kde-format 4378 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4379 msgid "Tue" 4380 msgstr "Mår" 4381 4382 #: kdecore/kcalendarsystemgregorian.cpp:322 4383 #: kdecore/kcalendarsystemhebrew.cpp:832 4384 #, kde-format 4385 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4386 msgid "Wed" 4387 msgstr "Mie" 4388 4389 #: kdecore/kcalendarsystemgregorian.cpp:324 4390 #: kdecore/kcalendarsystemhebrew.cpp:834 4391 #, kde-format 4392 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4393 msgid "Thu" 4394 msgstr "Dju" 4395 4396 #: kdecore/kcalendarsystemgregorian.cpp:326 4397 #: kdecore/kcalendarsystemhebrew.cpp:836 4398 #, kde-format 4399 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4400 msgid "Fri" 4401 msgstr "Vén" 4402 4403 #: kdecore/kcalendarsystemgregorian.cpp:328 4404 #: kdecore/kcalendarsystemhebrew.cpp:838 4405 #, kde-format 4406 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4407 msgid "Sat" 4408 msgstr "Sem" 4409 4410 #: kdecore/kcalendarsystemgregorian.cpp:330 4411 #: kdecore/kcalendarsystemhebrew.cpp:840 4412 #, kde-format 4413 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4414 msgid "Sun" 4415 msgstr "Dim" 4416 4417 #: kdecore/kcalendarsystemgregorian.cpp:337 4418 #: kdecore/kcalendarsystemhebrew.cpp:847 4419 #, kde-format 4420 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4421 msgid "Monday" 4422 msgstr "Londi" 4423 4424 #: kdecore/kcalendarsystemgregorian.cpp:339 4425 #: kdecore/kcalendarsystemhebrew.cpp:849 4426 #, kde-format 4427 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4428 msgid "Tuesday" 4429 msgstr "Mårdi" 4430 4431 #: kdecore/kcalendarsystemgregorian.cpp:341 4432 #: kdecore/kcalendarsystemhebrew.cpp:851 4433 #, kde-format 4434 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4435 msgid "Wednesday" 4436 msgstr "Mierkidi" 4437 4438 #: kdecore/kcalendarsystemgregorian.cpp:343 4439 #: kdecore/kcalendarsystemhebrew.cpp:853 4440 #, kde-format 4441 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4442 msgid "Thursday" 4443 msgstr "Djudi" 4444 4445 #: kdecore/kcalendarsystemgregorian.cpp:345 4446 #: kdecore/kcalendarsystemhebrew.cpp:855 4447 #, kde-format 4448 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4449 msgid "Friday" 4450 msgstr "Vénrdi" 4451 4452 #: kdecore/kcalendarsystemgregorian.cpp:347 4453 #: kdecore/kcalendarsystemhebrew.cpp:857 4454 #, kde-format 4455 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4456 msgid "Saturday" 4457 msgstr "Semdi" 4458 4459 #: kdecore/kcalendarsystemgregorian.cpp:349 4460 #: kdecore/kcalendarsystemhebrew.cpp:859 4461 #, kde-format 4462 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4463 msgid "Sunday" 4464 msgstr "Dimegne" 4465 4466 #: kdecore/kcalendarsystemhebrew.cpp:281 4467 #, kde-format 4468 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4469 msgid "Anno Mundi" 4470 msgstr "Anno Mundi" 4471 4472 #: kdecore/kcalendarsystemhebrew.cpp:282 4473 #, kde-format 4474 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4475 msgid "AM" 4476 msgstr "AM" 4477 4478 #: kdecore/kcalendarsystemhebrew.cpp:283 4479 #, kde-format 4480 msgctxt "" 4481 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4482 msgid "%Ey %EC" 4483 msgstr "%Ey %EC" 4484 4485 #: kdecore/kcalendarsystemhebrew.cpp:625 4486 #, kde-format 4487 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4488 msgid "T" 4489 msgstr "T" 4490 4491 #: kdecore/kcalendarsystemhebrew.cpp:627 4492 #, kde-format 4493 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4494 msgid "H" 4495 msgstr "M" 4496 4497 #: kdecore/kcalendarsystemhebrew.cpp:629 4498 #, kde-format 4499 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4500 msgid "K" 4501 msgstr "K" 4502 4503 #: kdecore/kcalendarsystemhebrew.cpp:631 4504 #, kde-format 4505 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4506 msgid "T" 4507 msgstr "T" 4508 4509 #: kdecore/kcalendarsystemhebrew.cpp:633 4510 #, kde-format 4511 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4512 msgid "S" 4513 msgstr "S" 4514 4515 #: kdecore/kcalendarsystemhebrew.cpp:635 4516 #, kde-format 4517 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4518 msgid "A" 4519 msgstr "A" 4520 4521 #: kdecore/kcalendarsystemhebrew.cpp:637 4522 #, kde-format 4523 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4524 msgid "N" 4525 msgstr "N" 4526 4527 #: kdecore/kcalendarsystemhebrew.cpp:639 4528 #, kde-format 4529 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4530 msgid "I" 4531 msgstr "I" 4532 4533 #: kdecore/kcalendarsystemhebrew.cpp:641 4534 #, kde-format 4535 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4536 msgid "S" 4537 msgstr "S" 4538 4539 #: kdecore/kcalendarsystemhebrew.cpp:643 4540 #, kde-format 4541 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4542 msgid "T" 4543 msgstr "T" 4544 4545 #: kdecore/kcalendarsystemhebrew.cpp:645 4546 #, kde-format 4547 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4548 msgid "A" 4549 msgstr "A" 4550 4551 #: kdecore/kcalendarsystemhebrew.cpp:647 4552 #, kde-format 4553 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4554 msgid "E" 4555 msgstr "E" 4556 4557 #: kdecore/kcalendarsystemhebrew.cpp:649 4558 #, kde-format 4559 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4560 msgid "A" 4561 msgstr "A" 4562 4563 #: kdecore/kcalendarsystemhebrew.cpp:651 4564 #, kde-format 4565 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4566 msgid "A" 4567 msgstr "A" 4568 4569 #: kdecore/kcalendarsystemhebrew.cpp:660 4570 #, kde-format 4571 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4572 msgid "of Tis" 4573 msgstr "di Tir" 4574 4575 #: kdecore/kcalendarsystemhebrew.cpp:662 4576 #, kde-format 4577 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4578 msgid "of Hes" 4579 msgstr "di Meh" 4580 4581 #: kdecore/kcalendarsystemhebrew.cpp:664 4582 #, kde-format 4583 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4584 msgid "of Kis" 4585 msgstr "di Kis" 4586 4587 #: kdecore/kcalendarsystemhebrew.cpp:666 4588 #, kde-format 4589 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4590 msgid "of Tev" 4591 msgstr "di Tev" 4592 4593 #: kdecore/kcalendarsystemhebrew.cpp:668 4594 #, kde-format 4595 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4596 msgid "of Shv" 4597 msgstr "di Shv" 4598 4599 #: kdecore/kcalendarsystemhebrew.cpp:670 4600 #, kde-format 4601 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4602 msgid "of Ada" 4603 msgstr "d' Ada" 4604 4605 #: kdecore/kcalendarsystemhebrew.cpp:672 4606 #, kde-format 4607 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4608 msgid "of Nis" 4609 msgstr "di Nis" 4610 4611 #: kdecore/kcalendarsystemhebrew.cpp:674 4612 #, kde-format 4613 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4614 msgid "of Iya" 4615 msgstr "d' Iya" 4616 4617 #: kdecore/kcalendarsystemhebrew.cpp:676 4618 #, kde-format 4619 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4620 msgid "of Siv" 4621 msgstr "di Siv" 4622 4623 #: kdecore/kcalendarsystemhebrew.cpp:678 4624 #, kde-format 4625 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4626 msgid "of Tam" 4627 msgstr "di Tam" 4628 4629 #: kdecore/kcalendarsystemhebrew.cpp:680 4630 #, kde-format 4631 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4632 msgid "of Av" 4633 msgstr "d' Av" 4634 4635 #: kdecore/kcalendarsystemhebrew.cpp:682 4636 #, kde-format 4637 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4638 msgid "of Elu" 4639 msgstr "d' Elu" 4640 4641 #: kdecore/kcalendarsystemhebrew.cpp:684 4642 #, kde-format 4643 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4644 msgid "of Ad1" 4645 msgstr "d' Ad1" 4646 4647 #: kdecore/kcalendarsystemhebrew.cpp:686 4648 #, kde-format 4649 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4650 msgid "of Ad2" 4651 msgstr "d' Ad2" 4652 4653 #: kdecore/kcalendarsystemhebrew.cpp:695 4654 #, kde-format 4655 msgctxt "Hebrew month 1 - KLocale::ShortName" 4656 msgid "Tis" 4657 msgstr "Tir" 4658 4659 #: kdecore/kcalendarsystemhebrew.cpp:697 4660 #, kde-format 4661 msgctxt "Hebrew month 2 - KLocale::ShortName" 4662 msgid "Hes" 4663 msgstr "Meh" 4664 4665 #: kdecore/kcalendarsystemhebrew.cpp:699 4666 #, kde-format 4667 msgctxt "Hebrew month 3 - KLocale::ShortName" 4668 msgid "Kis" 4669 msgstr "Kis" 4670 4671 #: kdecore/kcalendarsystemhebrew.cpp:701 4672 #, kde-format 4673 msgctxt "Hebrew month 4 - KLocale::ShortName" 4674 msgid "Tev" 4675 msgstr "Tev" 4676 4677 #: kdecore/kcalendarsystemhebrew.cpp:703 4678 #, kde-format 4679 msgctxt "Hebrew month 5 - KLocale::ShortName" 4680 msgid "Shv" 4681 msgstr "Shv" 4682 4683 #: kdecore/kcalendarsystemhebrew.cpp:705 4684 #, kde-format 4685 msgctxt "Hebrew month 6 - KLocale::ShortName" 4686 msgid "Ada" 4687 msgstr "Ada" 4688 4689 #: kdecore/kcalendarsystemhebrew.cpp:707 4690 #, kde-format 4691 msgctxt "Hebrew month 7 - KLocale::ShortName" 4692 msgid "Nis" 4693 msgstr "Nis" 4694 4695 #: kdecore/kcalendarsystemhebrew.cpp:709 4696 #, kde-format 4697 msgctxt "Hebrew month 8 - KLocale::ShortName" 4698 msgid "Iya" 4699 msgstr "Iya" 4700 4701 #: kdecore/kcalendarsystemhebrew.cpp:711 4702 #, kde-format 4703 msgctxt "Hebrew month 9 - KLocale::ShortName" 4704 msgid "Siv" 4705 msgstr "Siv" 4706 4707 #: kdecore/kcalendarsystemhebrew.cpp:713 4708 #, kde-format 4709 msgctxt "Hebrew month 10 - KLocale::ShortName" 4710 msgid "Tam" 4711 msgstr "Tam" 4712 4713 #: kdecore/kcalendarsystemhebrew.cpp:715 4714 #, kde-format 4715 msgctxt "Hebrew month 11 - KLocale::ShortName" 4716 msgid "Av" 4717 msgstr "Av" 4718 4719 #: kdecore/kcalendarsystemhebrew.cpp:717 4720 #, kde-format 4721 msgctxt "Hebrew month 12 - KLocale::ShortName" 4722 msgid "Elu" 4723 msgstr "Elu" 4724 4725 #: kdecore/kcalendarsystemhebrew.cpp:719 4726 #, kde-format 4727 msgctxt "Hebrew month 13 - KLocale::ShortName" 4728 msgid "Ad1" 4729 msgstr "Ad1" 4730 4731 #: kdecore/kcalendarsystemhebrew.cpp:721 4732 #, kde-format 4733 msgctxt "Hebrew month 14 - KLocale::ShortName" 4734 msgid "Ad2" 4735 msgstr "Ad2" 4736 4737 #: kdecore/kcalendarsystemhebrew.cpp:730 4738 #, kde-format 4739 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4740 msgid "of Tishrey" 4741 msgstr "di Tishrey" 4742 4743 #: kdecore/kcalendarsystemhebrew.cpp:732 4744 #, kde-format 4745 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4746 msgid "of Heshvan" 4747 msgstr "di Heshvan" 4748 4749 #: kdecore/kcalendarsystemhebrew.cpp:734 4750 #, kde-format 4751 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4752 msgid "of Kislev" 4753 msgstr "di Kislev" 4754 4755 #: kdecore/kcalendarsystemhebrew.cpp:736 4756 #, kde-format 4757 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4758 msgid "of Tevet" 4759 msgstr "di Tevet" 4760 4761 #: kdecore/kcalendarsystemhebrew.cpp:738 4762 #, kde-format 4763 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4764 msgid "of Shvat" 4765 msgstr "di Shvat" 4766 4767 #: kdecore/kcalendarsystemhebrew.cpp:740 4768 #, kde-format 4769 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4770 msgid "of Adar" 4771 msgstr "d' Adar" 4772 4773 #: kdecore/kcalendarsystemhebrew.cpp:742 4774 #, kde-format 4775 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4776 msgid "of Nisan" 4777 msgstr "di Nisan" 4778 4779 #: kdecore/kcalendarsystemhebrew.cpp:744 4780 #, kde-format 4781 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4782 msgid "of Iyar" 4783 msgstr "d' Iyar" 4784 4785 #: kdecore/kcalendarsystemhebrew.cpp:746 4786 #, kde-format 4787 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4788 msgid "of Sivan" 4789 msgstr "di Sivan" 4790 4791 #: kdecore/kcalendarsystemhebrew.cpp:748 4792 #, kde-format 4793 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4794 msgid "of Tamuz" 4795 msgstr "di Tamuz" 4796 4797 #: kdecore/kcalendarsystemhebrew.cpp:750 4798 #, kde-format 4799 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4800 msgid "of Av" 4801 msgstr "d' Av" 4802 4803 #: kdecore/kcalendarsystemhebrew.cpp:752 4804 #, kde-format 4805 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4806 msgid "of Elul" 4807 msgstr "d' Elul" 4808 4809 #: kdecore/kcalendarsystemhebrew.cpp:754 4810 #, kde-format 4811 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4812 msgid "of Adar I" 4813 msgstr "d' Adar I" 4814 4815 #: kdecore/kcalendarsystemhebrew.cpp:756 4816 #, kde-format 4817 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4818 msgid "of Adar II" 4819 msgstr "d' Adar II" 4820 4821 #: kdecore/kcalendarsystemhebrew.cpp:765 4822 #, kde-format 4823 msgctxt "Hebrew month 1 - KLocale::LongName" 4824 msgid "Tishrey" 4825 msgstr "Tishrey" 4826 4827 #: kdecore/kcalendarsystemhebrew.cpp:767 4828 #, kde-format 4829 msgctxt "Hebrew month 2 - KLocale::LongName" 4830 msgid "Heshvan" 4831 msgstr "Heshvan" 4832 4833 #: kdecore/kcalendarsystemhebrew.cpp:769 4834 #, kde-format 4835 msgctxt "Hebrew month 3 - KLocale::LongName" 4836 msgid "Kislev" 4837 msgstr "Kislev" 4838 4839 #: kdecore/kcalendarsystemhebrew.cpp:771 4840 #, kde-format 4841 msgctxt "Hebrew month 4 - KLocale::LongName" 4842 msgid "Tevet" 4843 msgstr "Tevet" 4844 4845 #: kdecore/kcalendarsystemhebrew.cpp:773 4846 #, kde-format 4847 msgctxt "Hebrew month 5 - KLocale::LongName" 4848 msgid "Shvat" 4849 msgstr "Shvat" 4850 4851 #: kdecore/kcalendarsystemhebrew.cpp:775 4852 #, kde-format 4853 msgctxt "Hebrew month 6 - KLocale::LongName" 4854 msgid "Adar" 4855 msgstr "Adar" 4856 4857 #: kdecore/kcalendarsystemhebrew.cpp:777 4858 #, kde-format 4859 msgctxt "Hebrew month 7 - KLocale::LongName" 4860 msgid "Nisan" 4861 msgstr "Nisan" 4862 4863 #: kdecore/kcalendarsystemhebrew.cpp:779 4864 #, kde-format 4865 msgctxt "Hebrew month 8 - KLocale::LongName" 4866 msgid "Iyar" 4867 msgstr "Iyar" 4868 4869 #: kdecore/kcalendarsystemhebrew.cpp:781 4870 #, kde-format 4871 msgctxt "Hebrew month 9 - KLocale::LongName" 4872 msgid "Sivan" 4873 msgstr "Sivan" 4874 4875 #: kdecore/kcalendarsystemhebrew.cpp:783 4876 #, kde-format 4877 msgctxt "Hebrew month 10 - KLocale::LongName" 4878 msgid "Tamuz" 4879 msgstr "Tamuz" 4880 4881 #: kdecore/kcalendarsystemhebrew.cpp:785 4882 #, kde-format 4883 msgctxt "Hebrew month 11 - KLocale::LongName" 4884 msgid "Av" 4885 msgstr "Av" 4886 4887 #: kdecore/kcalendarsystemhebrew.cpp:787 4888 #, kde-format 4889 msgctxt "Hebrew month 12 - KLocale::LongName" 4890 msgid "Elul" 4891 msgstr "Elul" 4892 4893 #: kdecore/kcalendarsystemhebrew.cpp:789 4894 #, kde-format 4895 msgctxt "Hebrew month 13 - KLocale::LongName" 4896 msgid "Adar I" 4897 msgstr "Adar I" 4898 4899 #: kdecore/kcalendarsystemhebrew.cpp:791 4900 #, kde-format 4901 msgctxt "Hebrew month 14 - KLocale::LongName" 4902 msgid "Adar II" 4903 msgstr "Adar II" 4904 4905 #: kdecore/kcalendarsystemindiannational.cpp:66 4906 #, kde-format 4907 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 4908 msgid "Saka Era" 4909 msgstr "Saka Era" 4910 4911 #: kdecore/kcalendarsystemindiannational.cpp:67 4912 #, kde-format 4913 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 4914 msgid "SE" 4915 msgstr "SE" 4916 4917 #: kdecore/kcalendarsystemindiannational.cpp:68 4918 #, kde-format 4919 msgctxt "" 4920 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 4921 "2000 SE" 4922 msgid "%Ey %EC" 4923 msgstr "%Ey %EC" 4924 4925 #: kdecore/kcalendarsystemindiannational.cpp:158 4926 #, kde-format 4927 msgctxt "Indian National month 1 - KLocale::NarrowName" 4928 msgid "C" 4929 msgstr "T" 4930 4931 #: kdecore/kcalendarsystemindiannational.cpp:160 4932 #, kde-format 4933 msgctxt "Indian National month 2 - KLocale::NarrowName" 4934 msgid "V" 4935 msgstr "V" 4936 4937 #: kdecore/kcalendarsystemindiannational.cpp:162 4938 #, kde-format 4939 msgctxt "Indian National month 3 - KLocale::NarrowName" 4940 msgid "J" 4941 msgstr "D" 4942 4943 #: kdecore/kcalendarsystemindiannational.cpp:164 4944 #, kde-format 4945 msgctxt "Indian National month 4 - KLocale::NarrowName" 4946 msgid "Ā" 4947 msgstr "Ā" 4948 4949 #: kdecore/kcalendarsystemindiannational.cpp:166 4950 #, kde-format 4951 msgctxt "Indian National month 5 - KLocale::NarrowName" 4952 msgid "S" 4953 msgstr "S" 4954 4955 #: kdecore/kcalendarsystemindiannational.cpp:168 4956 #, kde-format 4957 msgctxt "Indian National month 6 - KLocale::NarrowName" 4958 msgid "B" 4959 msgstr "B" 4960 4961 #: kdecore/kcalendarsystemindiannational.cpp:170 4962 #, kde-format 4963 msgctxt "Indian National month 7 - KLocale::NarrowName" 4964 msgid "Ā" 4965 msgstr "Ā" 4966 4967 #: kdecore/kcalendarsystemindiannational.cpp:172 4968 #, kde-format 4969 msgctxt "Indian National month 8 - KLocale::NarrowName" 4970 msgid "K" 4971 msgstr "K" 4972 4973 #: kdecore/kcalendarsystemindiannational.cpp:174 4974 #, kde-format 4975 msgctxt "Indian National month 9 - KLocale::NarrowName" 4976 msgid "A" 4977 msgstr "A" 4978 4979 #: kdecore/kcalendarsystemindiannational.cpp:176 4980 #, kde-format 4981 msgctxt "Indian National month 10 - KLocale::NarrowName" 4982 msgid "P" 4983 msgstr "P" 4984 4985 #: kdecore/kcalendarsystemindiannational.cpp:178 4986 #, kde-format 4987 msgctxt "Indian National month 11 - KLocale::NarrowName" 4988 msgid "M" 4989 msgstr "M" 4990 4991 #: kdecore/kcalendarsystemindiannational.cpp:180 4992 #, kde-format 4993 msgctxt "Indian National month 12 - KLocale::NarrowName" 4994 msgid "P" 4995 msgstr "P" 4996 4997 #: kdecore/kcalendarsystemindiannational.cpp:189 4998 #, kde-format 4999 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5000 msgid "of Cha" 5001 msgstr "di Tcha" 5002 5003 #: kdecore/kcalendarsystemindiannational.cpp:191 5004 #, kde-format 5005 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5006 msgid "of Vai" 5007 msgstr "di Vai" 5008 5009 #: kdecore/kcalendarsystemindiannational.cpp:193 5010 #, kde-format 5011 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5012 msgid "of Jya" 5013 msgstr "di Dja" 5014 5015 #: kdecore/kcalendarsystemindiannational.cpp:195 5016 #, kde-format 5017 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5018 msgid "of Āsh" 5019 msgstr "d' Āsh" 5020 5021 #: kdecore/kcalendarsystemindiannational.cpp:197 5022 #, kde-format 5023 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5024 msgid "of Shr" 5025 msgstr "di Shr" 5026 5027 #: kdecore/kcalendarsystemindiannational.cpp:199 5028 #, kde-format 5029 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5030 msgid "of Bhā" 5031 msgstr "di Bhā" 5032 5033 #: kdecore/kcalendarsystemindiannational.cpp:201 5034 #, kde-format 5035 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5036 msgid "of Āsw" 5037 msgstr "d' Āsw" 5038 5039 #: kdecore/kcalendarsystemindiannational.cpp:203 5040 #, kde-format 5041 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5042 msgid "of Kār" 5043 msgstr "di Kār" 5044 5045 #: kdecore/kcalendarsystemindiannational.cpp:205 5046 #, kde-format 5047 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5048 msgid "of Agr" 5049 msgstr "d' Agr" 5050 5051 #: kdecore/kcalendarsystemindiannational.cpp:207 5052 #, kde-format 5053 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5054 msgid "of Pau" 5055 msgstr "di Pau" 5056 5057 #: kdecore/kcalendarsystemindiannational.cpp:209 5058 #, kde-format 5059 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5060 msgid "of Māg" 5061 msgstr "di Māg" 5062 5063 #: kdecore/kcalendarsystemindiannational.cpp:211 5064 #, kde-format 5065 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5066 msgid "of Phā" 5067 msgstr "di Phā" 5068 5069 #: kdecore/kcalendarsystemindiannational.cpp:220 5070 #, kde-format 5071 msgctxt "Indian National month 1 - KLocale::ShortName" 5072 msgid "Cha" 5073 msgstr "Tcha" 5074 5075 #: kdecore/kcalendarsystemindiannational.cpp:222 5076 #, kde-format 5077 msgctxt "Indian National month 2 - KLocale::ShortName" 5078 msgid "Vai" 5079 msgstr "Vai" 5080 5081 #: kdecore/kcalendarsystemindiannational.cpp:224 5082 #, kde-format 5083 msgctxt "Indian National month 3 - KLocale::ShortName" 5084 msgid "Jya" 5085 msgstr "Dja" 5086 5087 #: kdecore/kcalendarsystemindiannational.cpp:226 5088 #, kde-format 5089 msgctxt "Indian National month 4 - KLocale::ShortName" 5090 msgid "Āsh" 5091 msgstr "Āsh" 5092 5093 #: kdecore/kcalendarsystemindiannational.cpp:228 5094 #, kde-format 5095 msgctxt "Indian National month 5 - KLocale::ShortName" 5096 msgid "Shr" 5097 msgstr "Shr" 5098 5099 #: kdecore/kcalendarsystemindiannational.cpp:230 5100 #, kde-format 5101 msgctxt "Indian National month 6 - KLocale::ShortName" 5102 msgid "Bhā" 5103 msgstr "Bhā" 5104 5105 #: kdecore/kcalendarsystemindiannational.cpp:232 5106 #, kde-format 5107 msgctxt "Indian National month 7 - KLocale::ShortName" 5108 msgid "Āsw" 5109 msgstr "Āsw" 5110 5111 #: kdecore/kcalendarsystemindiannational.cpp:234 5112 #, kde-format 5113 msgctxt "Indian National month 8 - KLocale::ShortName" 5114 msgid "Kār" 5115 msgstr "Kār" 5116 5117 #: kdecore/kcalendarsystemindiannational.cpp:236 5118 #, kde-format 5119 msgctxt "Indian National month 9 - KLocale::ShortName" 5120 msgid "Agr" 5121 msgstr "Agr" 5122 5123 #: kdecore/kcalendarsystemindiannational.cpp:238 5124 #, kde-format 5125 msgctxt "Indian National month 10 - KLocale::ShortName" 5126 msgid "Pau" 5127 msgstr "Pau" 5128 5129 #: kdecore/kcalendarsystemindiannational.cpp:240 5130 #, kde-format 5131 msgctxt "Indian National month 11 - KLocale::ShortName" 5132 msgid "Māg" 5133 msgstr "Māg" 5134 5135 #: kdecore/kcalendarsystemindiannational.cpp:242 5136 #, kde-format 5137 msgctxt "Indian National month 12 - KLocale::ShortName" 5138 msgid "Phā" 5139 msgstr "Phā" 5140 5141 #: kdecore/kcalendarsystemindiannational.cpp:251 5142 #, kde-format 5143 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5144 msgid "of Chaitra" 5145 msgstr "di Tchaytra" 5146 5147 #: kdecore/kcalendarsystemindiannational.cpp:253 5148 #, kde-format 5149 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5150 msgid "of Vaishākh" 5151 msgstr "di Vaishākh" 5152 5153 #: kdecore/kcalendarsystemindiannational.cpp:255 5154 #, kde-format 5155 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5156 msgid "of Jyaishtha" 5157 msgstr "di Djayshtha" 5158 5159 #: kdecore/kcalendarsystemindiannational.cpp:257 5160 #, kde-format 5161 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5162 msgid "of Āshādha" 5163 msgstr "d' Āshādha" 5164 5165 #: kdecore/kcalendarsystemindiannational.cpp:259 5166 #, kde-format 5167 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5168 msgid "of Shrāvana" 5169 msgstr "di Shrāvana" 5170 5171 #: kdecore/kcalendarsystemindiannational.cpp:261 5172 #, kde-format 5173 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5174 msgid "of Bhādrapad" 5175 msgstr "di Bhādrapad" 5176 5177 #: kdecore/kcalendarsystemindiannational.cpp:263 5178 #, kde-format 5179 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5180 msgid "of Āshwin" 5181 msgstr "d' Āshwin" 5182 5183 #: kdecore/kcalendarsystemindiannational.cpp:265 5184 #, kde-format 5185 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5186 msgid "of Kārtik" 5187 msgstr "di Kārtik" 5188 5189 #: kdecore/kcalendarsystemindiannational.cpp:267 5190 #, kde-format 5191 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5192 msgid "of Agrahayana" 5193 msgstr "d' Agrahayana" 5194 5195 #: kdecore/kcalendarsystemindiannational.cpp:269 5196 #, kde-format 5197 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5198 msgid "of Paush" 5199 msgstr "di Paush" 5200 5201 #: kdecore/kcalendarsystemindiannational.cpp:271 5202 #, kde-format 5203 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5204 msgid "of Māgh" 5205 msgstr "di Māgh" 5206 5207 #: kdecore/kcalendarsystemindiannational.cpp:273 5208 #, kde-format 5209 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5210 msgid "of Phālgun" 5211 msgstr "di Phālgun" 5212 5213 #: kdecore/kcalendarsystemindiannational.cpp:282 5214 #, kde-format 5215 msgctxt "Indian National month 1 - KLocale::LongName" 5216 msgid "Chaitra" 5217 msgstr "Tchaytra" 5218 5219 #: kdecore/kcalendarsystemindiannational.cpp:284 5220 #, kde-format 5221 msgctxt "Indian National month 2 - KLocale::LongName" 5222 msgid "Vaishākh" 5223 msgstr "Vaishākh" 5224 5225 #: kdecore/kcalendarsystemindiannational.cpp:286 5226 #, kde-format 5227 msgctxt "Indian National month 3 - KLocale::LongName" 5228 msgid "Jyaishtha" 5229 msgstr "Djayshtha" 5230 5231 #: kdecore/kcalendarsystemindiannational.cpp:288 5232 #, kde-format 5233 msgctxt "Indian National month 4 - KLocale::LongName" 5234 msgid "Āshādha" 5235 msgstr "Āshādha" 5236 5237 #: kdecore/kcalendarsystemindiannational.cpp:290 5238 #, kde-format 5239 msgctxt "Indian National month 5 - KLocale::LongName" 5240 msgid "Shrāvana" 5241 msgstr "Shrāvana" 5242 5243 #: kdecore/kcalendarsystemindiannational.cpp:292 5244 #, kde-format 5245 msgctxt "Indian National month 6 - KLocale::LongName" 5246 msgid "Bhādrapad" 5247 msgstr "Bhādrapad" 5248 5249 #: kdecore/kcalendarsystemindiannational.cpp:294 5250 #, kde-format 5251 msgctxt "Indian National month 7 - KLocale::LongName" 5252 msgid "Āshwin" 5253 msgstr "Āshwin" 5254 5255 #: kdecore/kcalendarsystemindiannational.cpp:296 5256 #, kde-format 5257 msgctxt "Indian National month 8 - KLocale::LongName" 5258 msgid "Kārtik" 5259 msgstr "Kārtik" 5260 5261 #: kdecore/kcalendarsystemindiannational.cpp:298 5262 #, kde-format 5263 msgctxt "Indian National month 9 - KLocale::LongName" 5264 msgid "Agrahayana" 5265 msgstr "Agrahayana" 5266 5267 #: kdecore/kcalendarsystemindiannational.cpp:300 5268 #, kde-format 5269 msgctxt "Indian National month 10 - KLocale::LongName" 5270 msgid "Paush" 5271 msgstr "Paush" 5272 5273 #: kdecore/kcalendarsystemindiannational.cpp:302 5274 #, kde-format 5275 msgctxt "Indian National month 11 - KLocale::LongName" 5276 msgid "Māgh" 5277 msgstr "Māgh" 5278 5279 #: kdecore/kcalendarsystemindiannational.cpp:304 5280 #, kde-format 5281 msgctxt "Indian National month 12 - KLocale::LongName" 5282 msgid "Phālgun" 5283 msgstr "Phālgun" 5284 5285 #: kdecore/kcalendarsystemindiannational.cpp:317 5286 #, kde-format 5287 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5288 msgid "S" 5289 msgstr "S" 5290 5291 #: kdecore/kcalendarsystemindiannational.cpp:319 5292 #, kde-format 5293 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5294 msgid "M" 5295 msgstr "M" 5296 5297 #: kdecore/kcalendarsystemindiannational.cpp:321 5298 #, kde-format 5299 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5300 msgid "B" 5301 msgstr "B" 5302 5303 #: kdecore/kcalendarsystemindiannational.cpp:323 5304 #, kde-format 5305 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5306 msgid "G" 5307 msgstr "G" 5308 5309 #: kdecore/kcalendarsystemindiannational.cpp:325 5310 #, kde-format 5311 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5312 msgid "S" 5313 msgstr "S" 5314 5315 #: kdecore/kcalendarsystemindiannational.cpp:327 5316 #, kde-format 5317 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5318 msgid "S" 5319 msgstr "S" 5320 5321 #: kdecore/kcalendarsystemindiannational.cpp:329 5322 #, kde-format 5323 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5324 msgid "R" 5325 msgstr "R" 5326 5327 #: kdecore/kcalendarsystemindiannational.cpp:338 5328 #, kde-format 5329 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5330 msgid "Som" 5331 msgstr "Som" 5332 5333 #: kdecore/kcalendarsystemindiannational.cpp:340 5334 #, kde-format 5335 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5336 msgid "Mañ" 5337 msgstr "Mañ" 5338 5339 #: kdecore/kcalendarsystemindiannational.cpp:342 5340 #, kde-format 5341 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5342 msgid "Bud" 5343 msgstr "Bud" 5344 5345 #: kdecore/kcalendarsystemindiannational.cpp:344 5346 #, kde-format 5347 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5348 msgid "Gur" 5349 msgstr "Gur" 5350 5351 #: kdecore/kcalendarsystemindiannational.cpp:346 5352 #, kde-format 5353 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5354 msgid "Suk" 5355 msgstr "Suk" 5356 5357 #: kdecore/kcalendarsystemindiannational.cpp:348 5358 #, kde-format 5359 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5360 msgid "San" 5361 msgstr "San" 5362 5363 #: kdecore/kcalendarsystemindiannational.cpp:350 5364 #, kde-format 5365 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5366 msgid "Rav" 5367 msgstr "Rav" 5368 5369 #: kdecore/kcalendarsystemindiannational.cpp:357 5370 #, kde-format 5371 msgctxt "Indian National weekday 1 - KLocale::LongName" 5372 msgid "Somavãra" 5373 msgstr "Somavãra" 5374 5375 #: kdecore/kcalendarsystemindiannational.cpp:359 5376 #, kde-format 5377 msgctxt "Indian National weekday 2 - KLocale::LongName" 5378 msgid "Mañgalvã" 5379 msgstr "Mañgalvã" 5380 5381 #: kdecore/kcalendarsystemindiannational.cpp:361 5382 #, kde-format 5383 msgctxt "Indian National weekday 3 - KLocale::LongName" 5384 msgid "Budhavãra" 5385 msgstr "Budhavãra" 5386 5387 #: kdecore/kcalendarsystemindiannational.cpp:363 5388 #, kde-format 5389 msgctxt "Indian National weekday 4 - KLocale::LongName" 5390 msgid "Guruvãra" 5391 msgstr "Guruvãra" 5392 5393 #: kdecore/kcalendarsystemindiannational.cpp:365 5394 #, kde-format 5395 msgctxt "Indian National weekday 5 - KLocale::LongName" 5396 msgid "Sukravãra" 5397 msgstr "Sukravãra" 5398 5399 #: kdecore/kcalendarsystemindiannational.cpp:367 5400 #, kde-format 5401 msgctxt "Indian National weekday 6 - KLocale::LongName" 5402 msgid "Sanivãra" 5403 msgstr "Sanivãra" 5404 5405 #: kdecore/kcalendarsystemindiannational.cpp:369 5406 #, kde-format 5407 msgctxt "Indian National weekday 7 - KLocale::LongName" 5408 msgid "Raviãra" 5409 msgstr "Raviãra" 5410 5411 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5412 #, kde-format 5413 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5414 msgid "Anno Hegirae" 5415 msgstr "Anno Hegirae" 5416 5417 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5418 #, kde-format 5419 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5420 msgid "AH" 5421 msgstr "AH" 5422 5423 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5424 #, kde-format 5425 msgctxt "" 5426 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5427 msgid "%Ey %EC" 5428 msgstr "%Ey %EC" 5429 5430 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5431 #, kde-format 5432 msgctxt "Hijri month 1 - KLocale::NarrowName" 5433 msgid "M" 5434 msgstr "M" 5435 5436 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5437 #, kde-format 5438 msgctxt "Hijri month 2 - KLocale::NarrowName" 5439 msgid "S" 5440 msgstr "S" 5441 5442 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5443 #, kde-format 5444 msgctxt "Hijri month 3 - KLocale::NarrowName" 5445 msgid "A" 5446 msgstr "A" 5447 5448 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5449 #, kde-format 5450 msgctxt "Hijri month 4 - KLocale::NarrowName" 5451 msgid "T" 5452 msgstr "T" 5453 5454 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5455 #, kde-format 5456 msgctxt "Hijri month 5 - KLocale::NarrowName" 5457 msgid "A" 5458 msgstr "A" 5459 5460 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5461 #, kde-format 5462 msgctxt "Hijri month 6 - KLocale::NarrowName" 5463 msgid "T" 5464 msgstr "T" 5465 5466 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5467 #, kde-format 5468 msgctxt "Hijri month 7 - KLocale::NarrowName" 5469 msgid "R" 5470 msgstr "R" 5471 5472 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5473 #, kde-format 5474 msgctxt "Hijri month 8 - KLocale::NarrowName" 5475 msgid "S" 5476 msgstr "S" 5477 5478 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5479 #, kde-format 5480 msgctxt "Hijri month 9 - KLocale::NarrowName" 5481 msgid "R" 5482 msgstr "R" 5483 5484 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5485 #, kde-format 5486 msgctxt "Hijri month 10 - KLocale::NarrowName" 5487 msgid "S" 5488 msgstr "S" 5489 5490 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5491 #, kde-format 5492 msgctxt "Hijri month 11 - KLocale::NarrowName" 5493 msgid "Q" 5494 msgstr "Q" 5495 5496 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5497 #, kde-format 5498 msgctxt "Hijri month 12 - KLocale::NarrowName" 5499 msgid "H" 5500 msgstr "H" 5501 5502 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5503 #, kde-format 5504 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5505 msgid "of Muh" 5506 msgstr "di Muh" 5507 5508 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5509 #, kde-format 5510 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5511 msgid "of Saf" 5512 msgstr "di Saf" 5513 5514 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5515 #, kde-format 5516 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5517 msgid "of R.A" 5518 msgstr "di R.A" 5519 5520 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5521 #, kde-format 5522 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5523 msgid "of R.T" 5524 msgstr "di R.T" 5525 5526 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5527 #, kde-format 5528 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5529 msgid "of J.A" 5530 msgstr "di Dj.A " 5531 5532 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5533 #, kde-format 5534 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5535 msgid "of J.T" 5536 msgstr "di Dj.T" 5537 5538 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5539 #, kde-format 5540 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5541 msgid "of Raj" 5542 msgstr "di Ra" 5543 5544 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5545 #, kde-format 5546 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5547 msgid "of Sha" 5548 msgstr "di Sha" 5549 5550 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5551 #, kde-format 5552 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5553 msgid "of Ram" 5554 msgstr "di Ram" 5555 5556 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5557 #, kde-format 5558 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5559 msgid "of Shw" 5560 msgstr "di Shw" 5561 5562 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5563 #, kde-format 5564 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5565 msgid "of Qid" 5566 msgstr "di Qid" 5567 5568 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5569 #, kde-format 5570 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5571 msgid "of Hij" 5572 msgstr "di Hid" 5573 5574 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5575 #, kde-format 5576 msgctxt "Hijri month 1 - KLocale::ShortName" 5577 msgid "Muh" 5578 msgstr "Muh" 5579 5580 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5581 #, kde-format 5582 msgctxt "Hijri month 2 - KLocale::ShortName" 5583 msgid "Saf" 5584 msgstr "Saf" 5585 5586 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5587 #, kde-format 5588 msgctxt "Hijri month 3 - KLocale::ShortName" 5589 msgid "R.A" 5590 msgstr "R.A" 5591 5592 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5593 #, kde-format 5594 msgctxt "Hijri month 4 - KLocale::ShortName" 5595 msgid "R.T" 5596 msgstr "R.T" 5597 5598 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5599 #, kde-format 5600 msgctxt "Hijri month 5 - KLocale::ShortName" 5601 msgid "J.A" 5602 msgstr "Dj.A" 5603 5604 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5605 #, kde-format 5606 msgctxt "Hijri month 6 - KLocale::ShortName" 5607 msgid "J.T" 5608 msgstr "Dj.T" 5609 5610 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5611 #, kde-format 5612 msgctxt "Hijri month 7 - KLocale::ShortName" 5613 msgid "Raj" 5614 msgstr "Rad" 5615 5616 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5617 #, kde-format 5618 msgctxt "Hijri month 8 - KLocale::ShortName" 5619 msgid "Sha" 5620 msgstr "Sha" 5621 5622 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5623 #, kde-format 5624 msgctxt "Hijri month 9 - KLocale::ShortName" 5625 msgid "Ram" 5626 msgstr "Ram" 5627 5628 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5629 #, kde-format 5630 msgctxt "Hijri month 10 - KLocale::ShortName" 5631 msgid "Shw" 5632 msgstr "Shw" 5633 5634 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5635 #, kde-format 5636 msgctxt "Hijri month 11 - KLocale::ShortName" 5637 msgid "Qid" 5638 msgstr "Qid" 5639 5640 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5641 #, kde-format 5642 msgctxt "Hijri month 12 - KLocale::ShortName" 5643 msgid "Hij" 5644 msgstr "Hid" 5645 5646 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5647 #, kde-format 5648 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5649 msgid "of Muharram" 5650 msgstr "di Muharram" 5651 5652 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5653 #, kde-format 5654 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5655 msgid "of Safar" 5656 msgstr "di Safar" 5657 5658 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5659 #, kde-format 5660 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5661 msgid "of Rabi` al-Awal" 5662 msgstr "di Rabi` al-Awal" 5663 5664 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5665 #, kde-format 5666 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5667 msgid "of Rabi` al-Thaani" 5668 msgstr "di Rabi` al-Thaani" 5669 5670 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5671 #, kde-format 5672 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5673 msgid "of Jumaada al-Awal" 5674 msgstr "di Djumaada al-Awal" 5675 5676 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5677 #, kde-format 5678 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5679 msgid "of Jumaada al-Thaani" 5680 msgstr "di Djumaada al-Thaani" 5681 5682 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5683 #, kde-format 5684 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5685 msgid "of Rajab" 5686 msgstr "di Radjab" 5687 5688 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5689 #, kde-format 5690 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5691 msgid "of Sha`ban" 5692 msgstr "di Sha`ban" 5693 5694 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5695 #, kde-format 5696 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5697 msgid "of Ramadan" 5698 msgstr "di Ramadan" 5699 5700 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5701 #, kde-format 5702 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5703 msgid "of Shawwal" 5704 msgstr "di Shawwal" 5705 5706 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5707 #, kde-format 5708 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5709 msgid "of Thu al-Qi`dah" 5710 msgstr "di Thu al-Qi`dah" 5711 5712 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5713 #, kde-format 5714 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5715 msgid "of Thu al-Hijjah" 5716 msgstr "di Thu al-Hidjdjah" 5717 5718 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5719 #, kde-format 5720 msgctxt "Hijri month 1 - KLocale::LongName" 5721 msgid "Muharram" 5722 msgstr "Muharram" 5723 5724 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5725 #, kde-format 5726 msgctxt "Hijri month 2 - KLocale::LongName" 5727 msgid "Safar" 5728 msgstr "Safar" 5729 5730 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5731 #, kde-format 5732 msgctxt "Hijri month 3 - KLocale::LongName" 5733 msgid "Rabi` al-Awal" 5734 msgstr "Rabi` al-Awal" 5735 5736 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5737 #, kde-format 5738 msgctxt "Hijri month 4 - KLocale::LongName" 5739 msgid "Rabi` al-Thaani" 5740 msgstr "Rabi` al-Thaani" 5741 5742 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5743 #, kde-format 5744 msgctxt "Hijri month 5 - KLocale::LongName" 5745 msgid "Jumaada al-Awal" 5746 msgstr "Djumaada al-Awal" 5747 5748 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5749 #, kde-format 5750 msgctxt "Hijri month 6 - KLocale::LongName" 5751 msgid "Jumaada al-Thaani" 5752 msgstr "Djumaada al-Thaani" 5753 5754 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5755 #, kde-format 5756 msgctxt "Hijri month 7 - KLocale::LongName" 5757 msgid "Rajab" 5758 msgstr "Radjab" 5759 5760 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5761 #, kde-format 5762 msgctxt "Hijri month 8 - KLocale::LongName" 5763 msgid "Sha`ban" 5764 msgstr "Sha`ban" 5765 5766 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5767 #, kde-format 5768 msgctxt "Hijri month 9 - KLocale::LongName" 5769 msgid "Ramadan" 5770 msgstr "Ramadan" 5771 5772 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5773 #, kde-format 5774 msgctxt "Hijri month 10 - KLocale::LongName" 5775 msgid "Shawwal" 5776 msgstr "Shawwal" 5777 5778 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5779 #, kde-format 5780 msgctxt "Hijri month 11 - KLocale::LongName" 5781 msgid "Thu al-Qi`dah" 5782 msgstr "Thu al-Qi`dah" 5783 5784 #: kdecore/kcalendarsystemislamiccivil.cpp:312 5785 #, kde-format 5786 msgctxt "Hijri month 12 - KLocale::LongName" 5787 msgid "Thu al-Hijjah" 5788 msgstr "Thu al-Hijjah" 5789 5790 #: kdecore/kcalendarsystemislamiccivil.cpp:325 5791 #, kde-format 5792 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 5793 msgid "I" 5794 msgstr "" 5795 5796 #: kdecore/kcalendarsystemislamiccivil.cpp:327 5797 #, kde-format 5798 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 5799 msgid "T" 5800 msgstr "" 5801 5802 #: kdecore/kcalendarsystemislamiccivil.cpp:329 5803 #, fuzzy, kde-format 5804 #| msgid "Av" 5805 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 5806 msgid "A" 5807 msgstr "Av" 5808 5809 #: kdecore/kcalendarsystemislamiccivil.cpp:331 5810 #, kde-format 5811 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 5812 msgid "K" 5813 msgstr "" 5814 5815 #: kdecore/kcalendarsystemislamiccivil.cpp:333 5816 #, kde-format 5817 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 5818 msgid "J" 5819 msgstr "" 5820 5821 #: kdecore/kcalendarsystemislamiccivil.cpp:335 5822 #, kde-format 5823 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 5824 msgid "S" 5825 msgstr "" 5826 5827 #: kdecore/kcalendarsystemislamiccivil.cpp:337 5828 #, fuzzy, kde-format 5829 #| msgid "Av" 5830 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 5831 msgid "A" 5832 msgstr "Av" 5833 5834 #: kdecore/kcalendarsystemislamiccivil.cpp:346 5835 #, fuzzy, kde-format 5836 #| msgid "Ith" 5837 msgctxt "Hijri weekday 1 - KLocale::ShortName" 5838 msgid "Ith" 5839 msgstr "Ith" 5840 5841 #: kdecore/kcalendarsystemislamiccivil.cpp:348 5842 #, fuzzy, kde-format 5843 #| msgid "Thl" 5844 msgctxt "Hijri weekday 2 - KLocale::ShortName" 5845 msgid "Thl" 5846 msgstr "Thl" 5847 5848 #: kdecore/kcalendarsystemislamiccivil.cpp:350 5849 #, fuzzy, kde-format 5850 #| msgid "Arb" 5851 msgctxt "Hijri weekday 3 - KLocale::ShortName" 5852 msgid "Arb" 5853 msgstr "Arb" 5854 5855 #: kdecore/kcalendarsystemislamiccivil.cpp:352 5856 #, fuzzy, kde-format 5857 #| msgid "Kha" 5858 msgctxt "Hijri weekday 4 - KLocale::ShortName" 5859 msgid "Kha" 5860 msgstr "Kha" 5861 5862 #: kdecore/kcalendarsystemislamiccivil.cpp:354 5863 #, fuzzy, kde-format 5864 #| msgid "Jum" 5865 msgctxt "Hijri weekday 5 - KLocale::ShortName" 5866 msgid "Jum" 5867 msgstr "Jum" 5868 5869 #: kdecore/kcalendarsystemislamiccivil.cpp:356 5870 #, fuzzy, kde-format 5871 #| msgid "Sab" 5872 msgctxt "Hijri weekday 6 - KLocale::ShortName" 5873 msgid "Sab" 5874 msgstr "Sab" 5875 5876 #: kdecore/kcalendarsystemislamiccivil.cpp:358 5877 #, fuzzy, kde-format 5878 #| msgid "Ahd" 5879 msgctxt "Hijri weekday 7 - KLocale::ShortName" 5880 msgid "Ahd" 5881 msgstr "Ahd" 5882 5883 #: kdecore/kcalendarsystemislamiccivil.cpp:365 5884 #, fuzzy, kde-format 5885 #| msgid "Yaum al-Ithnain" 5886 msgctxt "Hijri weekday 1 - KLocale::LongName" 5887 msgid "Yaum al-Ithnain" 5888 msgstr "Yaum al-Ithnain" 5889 5890 #: kdecore/kcalendarsystemislamiccivil.cpp:367 5891 #, fuzzy, kde-format 5892 #| msgid "Yau al-Thulatha" 5893 msgctxt "Hijri weekday 2 - KLocale::LongName" 5894 msgid "Yau al-Thulatha" 5895 msgstr "Yau al-Thulatha" 5896 5897 #: kdecore/kcalendarsystemislamiccivil.cpp:369 5898 #, fuzzy, kde-format 5899 #| msgid "Yaum al-Arbi'a" 5900 msgctxt "Hijri weekday 3 - KLocale::LongName" 5901 msgid "Yaum al-Arbi'a" 5902 msgstr "Yaum al-Arbi'a" 5903 5904 #: kdecore/kcalendarsystemislamiccivil.cpp:371 5905 #, fuzzy, kde-format 5906 #| msgid "Yaum al-Khamees" 5907 msgctxt "Hijri weekday 4 - KLocale::LongName" 5908 msgid "Yaum al-Khamees" 5909 msgstr "Yaum al-Khamees" 5910 5911 #: kdecore/kcalendarsystemislamiccivil.cpp:373 5912 #, fuzzy, kde-format 5913 #| msgid "Yaum al-Jumma" 5914 msgctxt "Hijri weekday 5 - KLocale::LongName" 5915 msgid "Yaum al-Jumma" 5916 msgstr "Yaum al-Jumma" 5917 5918 #: kdecore/kcalendarsystemislamiccivil.cpp:375 5919 #, fuzzy, kde-format 5920 #| msgid "Yaum al-Sabt" 5921 msgctxt "Hijri weekday 6 - KLocale::LongName" 5922 msgid "Yaum al-Sabt" 5923 msgstr "Yaum al-Sabt" 5924 5925 #: kdecore/kcalendarsystemislamiccivil.cpp:377 5926 #, fuzzy, kde-format 5927 #| msgid "Yaum al-Ahad" 5928 msgctxt "Hijri weekday 7 - KLocale::LongName" 5929 msgid "Yaum al-Ahad" 5930 msgstr "Yaum al-Ahad" 5931 5932 #: kdecore/kcalendarsystemjalali.cpp:74 5933 #, kde-format 5934 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 5935 msgid "Anno Persico" 5936 msgstr "" 5937 5938 #: kdecore/kcalendarsystemjalali.cpp:75 5939 #, kde-format 5940 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 5941 msgid "AP" 5942 msgstr "" 5943 5944 #: kdecore/kcalendarsystemjalali.cpp:76 5945 #, kde-format 5946 msgctxt "" 5947 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 5948 msgid "%Ey %EC" 5949 msgstr "" 5950 5951 #: kdecore/kcalendarsystemjalali.cpp:172 5952 #, kde-format 5953 msgctxt "Jalali month 1 - KLocale::NarrowName" 5954 msgid "F" 5955 msgstr "" 5956 5957 #: kdecore/kcalendarsystemjalali.cpp:174 5958 #, kde-format 5959 msgctxt "Jalali month 2 - KLocale::NarrowName" 5960 msgid "O" 5961 msgstr "" 5962 5963 #: kdecore/kcalendarsystemjalali.cpp:176 5964 #, kde-format 5965 msgctxt "Jalali month 3 - KLocale::NarrowName" 5966 msgid "K" 5967 msgstr "" 5968 5969 #: kdecore/kcalendarsystemjalali.cpp:178 5970 #, kde-format 5971 msgctxt "Jalali month 4 - KLocale::NarrowName" 5972 msgid "T" 5973 msgstr "" 5974 5975 #: kdecore/kcalendarsystemjalali.cpp:180 5976 #, kde-format 5977 msgctxt "Jalali month 5 - KLocale::NarrowName" 5978 msgid "M" 5979 msgstr "" 5980 5981 #: kdecore/kcalendarsystemjalali.cpp:182 5982 #, kde-format 5983 msgctxt "Jalali month 6 - KLocale::NarrowName" 5984 msgid "S" 5985 msgstr "" 5986 5987 #: kdecore/kcalendarsystemjalali.cpp:184 5988 #, kde-format 5989 msgctxt "Jalali month 7 - KLocale::NarrowName" 5990 msgid "M" 5991 msgstr "" 5992 5993 #: kdecore/kcalendarsystemjalali.cpp:186 5994 #, fuzzy, kde-format 5995 #| msgid "Av" 5996 msgctxt "Jalali month 8 - KLocale::NarrowName" 5997 msgid "A" 5998 msgstr "Av" 5999 6000 #: kdecore/kcalendarsystemjalali.cpp:188 6001 #, fuzzy, kde-format 6002 #| msgid "Av" 6003 msgctxt "Jalali month 9 - KLocale::NarrowName" 6004 msgid "A" 6005 msgstr "Av" 6006 6007 #: kdecore/kcalendarsystemjalali.cpp:190 6008 #, kde-format 6009 msgctxt "Jalali month 10 - KLocale::NarrowName" 6010 msgid "D" 6011 msgstr "" 6012 6013 #: kdecore/kcalendarsystemjalali.cpp:192 6014 #, kde-format 6015 msgctxt "Jalali month 11 - KLocale::NarrowName" 6016 msgid "B" 6017 msgstr "" 6018 6019 #: kdecore/kcalendarsystemjalali.cpp:194 6020 #, kde-format 6021 msgctxt "Jalali month 12 - KLocale::NarrowName" 6022 msgid "E" 6023 msgstr "" 6024 6025 #: kdecore/kcalendarsystemjalali.cpp:203 6026 #, kde-format 6027 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6028 msgid "of Far" 6029 msgstr "di Far" 6030 6031 #: kdecore/kcalendarsystemjalali.cpp:205 6032 #, kde-format 6033 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6034 msgid "of Ord" 6035 msgstr "di Ord" 6036 6037 #: kdecore/kcalendarsystemjalali.cpp:207 6038 #, kde-format 6039 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6040 msgid "of Kho" 6041 msgstr "di Kho" 6042 6043 #: kdecore/kcalendarsystemjalali.cpp:209 6044 #, kde-format 6045 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6046 msgid "of Tir" 6047 msgstr "di Tir" 6048 6049 #: kdecore/kcalendarsystemjalali.cpp:211 6050 #, kde-format 6051 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6052 msgid "of Mor" 6053 msgstr "di Mor" 6054 6055 #: kdecore/kcalendarsystemjalali.cpp:213 6056 #, kde-format 6057 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6058 msgid "of Sha" 6059 msgstr "di Sha" 6060 6061 #: kdecore/kcalendarsystemjalali.cpp:215 6062 #, kde-format 6063 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6064 msgid "of Meh" 6065 msgstr "di Meh" 6066 6067 #: kdecore/kcalendarsystemjalali.cpp:217 6068 #, kde-format 6069 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6070 msgid "of Aba" 6071 msgstr "d' Aba" 6072 6073 #: kdecore/kcalendarsystemjalali.cpp:219 6074 #, kde-format 6075 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6076 msgid "of Aza" 6077 msgstr "d' Aza" 6078 6079 #: kdecore/kcalendarsystemjalali.cpp:221 6080 #, kde-format 6081 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6082 msgid "of Dei" 6083 msgstr "di Dei" 6084 6085 #: kdecore/kcalendarsystemjalali.cpp:223 6086 #, kde-format 6087 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6088 msgid "of Bah" 6089 msgstr "di Bah" 6090 6091 #: kdecore/kcalendarsystemjalali.cpp:225 6092 #, kde-format 6093 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6094 msgid "of Esf" 6095 msgstr "d' Esf" 6096 6097 #: kdecore/kcalendarsystemjalali.cpp:234 6098 #, fuzzy, kde-format 6099 #| msgctxt "Farvardin short" 6100 #| msgid "Far" 6101 msgctxt "Jalali month 1 - KLocale::ShortName" 6102 msgid "Far" 6103 msgstr "Far" 6104 6105 #: kdecore/kcalendarsystemjalali.cpp:236 6106 #, fuzzy, kde-format 6107 #| msgctxt "Ordibehesht short" 6108 #| msgid "Ord" 6109 msgctxt "Jalali month 2 - KLocale::ShortName" 6110 msgid "Ord" 6111 msgstr "Ord" 6112 6113 #: kdecore/kcalendarsystemjalali.cpp:238 6114 #, fuzzy, kde-format 6115 #| msgctxt "Khordad short" 6116 #| msgid "Kho" 6117 msgctxt "Jalali month 3 - KLocale::ShortName" 6118 msgid "Kho" 6119 msgstr "Kho" 6120 6121 #: kdecore/kcalendarsystemjalali.cpp:240 6122 #, fuzzy, kde-format 6123 #| msgctxt "Tir short" 6124 #| msgid "Tir" 6125 msgctxt "Jalali month 4 - KLocale::ShortName" 6126 msgid "Tir" 6127 msgstr "Tir" 6128 6129 #: kdecore/kcalendarsystemjalali.cpp:242 6130 #, fuzzy, kde-format 6131 #| msgctxt "Mordad short" 6132 #| msgid "Mor" 6133 msgctxt "Jalali month 5 - KLocale::ShortName" 6134 msgid "Mor" 6135 msgstr "Mor" 6136 6137 #: kdecore/kcalendarsystemjalali.cpp:244 6138 #, fuzzy, kde-format 6139 #| msgctxt "Shahrivar short" 6140 #| msgid "Sha" 6141 msgctxt "Jalali month 6 - KLocale::ShortName" 6142 msgid "Sha" 6143 msgstr "Sha" 6144 6145 #: kdecore/kcalendarsystemjalali.cpp:246 6146 #, fuzzy, kde-format 6147 #| msgctxt "Mehr short" 6148 #| msgid "Meh" 6149 msgctxt "Jalali month 7 - KLocale::ShortName" 6150 msgid "Meh" 6151 msgstr "Meh" 6152 6153 #: kdecore/kcalendarsystemjalali.cpp:248 6154 #, fuzzy, kde-format 6155 #| msgctxt "Aban short" 6156 #| msgid "Aba" 6157 msgctxt "Jalali month 8 - KLocale::ShortName" 6158 msgid "Aba" 6159 msgstr "Aba" 6160 6161 #: kdecore/kcalendarsystemjalali.cpp:250 6162 #, fuzzy, kde-format 6163 #| msgctxt "Azar short" 6164 #| msgid "Aza" 6165 msgctxt "Jalali month 9 - KLocale::ShortName" 6166 msgid "Aza" 6167 msgstr "Aza" 6168 6169 #: kdecore/kcalendarsystemjalali.cpp:252 6170 #, fuzzy, kde-format 6171 #| msgctxt "Dei short" 6172 #| msgid "Dei" 6173 msgctxt "Jalali month 10 - KLocale::ShortName" 6174 msgid "Dei" 6175 msgstr "Dei" 6176 6177 #: kdecore/kcalendarsystemjalali.cpp:254 6178 #, fuzzy, kde-format 6179 #| msgctxt "Bahman short" 6180 #| msgid "Bah" 6181 msgctxt "Jalali month 11 - KLocale::ShortName" 6182 msgid "Bah" 6183 msgstr "Bah" 6184 6185 #: kdecore/kcalendarsystemjalali.cpp:256 6186 #, fuzzy, kde-format 6187 #| msgctxt "Esfand" 6188 #| msgid "Esf" 6189 msgctxt "Jalali month 12 - KLocale::ShortName" 6190 msgid "Esf" 6191 msgstr "Esf" 6192 6193 #: kdecore/kcalendarsystemjalali.cpp:265 6194 #, kde-format 6195 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6196 msgid "of Farvardin" 6197 msgstr "di Farvardin" 6198 6199 #: kdecore/kcalendarsystemjalali.cpp:267 6200 #, kde-format 6201 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6202 msgid "of Ordibehesht" 6203 msgstr "d' Ordibehesht" 6204 6205 #: kdecore/kcalendarsystemjalali.cpp:269 6206 #, kde-format 6207 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6208 msgid "of Khordad" 6209 msgstr "di Khordad" 6210 6211 #: kdecore/kcalendarsystemjalali.cpp:271 6212 #, kde-format 6213 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6214 msgid "of Tir" 6215 msgstr "di Tir" 6216 6217 #: kdecore/kcalendarsystemjalali.cpp:273 6218 #, kde-format 6219 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6220 msgid "of Mordad" 6221 msgstr "di Mordad" 6222 6223 #: kdecore/kcalendarsystemjalali.cpp:275 6224 #, kde-format 6225 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6226 msgid "of Shahrivar" 6227 msgstr "di Shahrivar" 6228 6229 #: kdecore/kcalendarsystemjalali.cpp:277 6230 #, kde-format 6231 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6232 msgid "of Mehr" 6233 msgstr "di Mehr" 6234 6235 #: kdecore/kcalendarsystemjalali.cpp:279 6236 #, kde-format 6237 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6238 msgid "of Aban" 6239 msgstr "d' Aban" 6240 6241 #: kdecore/kcalendarsystemjalali.cpp:281 6242 #, kde-format 6243 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6244 msgid "of Azar" 6245 msgstr "d' Azar" 6246 6247 #: kdecore/kcalendarsystemjalali.cpp:283 6248 #, kde-format 6249 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6250 msgid "of Dei" 6251 msgstr "di Dei" 6252 6253 #: kdecore/kcalendarsystemjalali.cpp:285 6254 #, kde-format 6255 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6256 msgid "of Bahman" 6257 msgstr "di Bahman" 6258 6259 #: kdecore/kcalendarsystemjalali.cpp:287 6260 #, kde-format 6261 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6262 msgid "of Esfand" 6263 msgstr "d' Esfand" 6264 6265 #: kdecore/kcalendarsystemjalali.cpp:296 6266 #, fuzzy, kde-format 6267 #| msgid "Farvardin" 6268 msgctxt "Jalali month 1 - KLocale::LongName" 6269 msgid "Farvardin" 6270 msgstr "Farvardin" 6271 6272 #: kdecore/kcalendarsystemjalali.cpp:298 6273 #, fuzzy, kde-format 6274 #| msgid "Ordibehesht" 6275 msgctxt "Jalali month 2 - KLocale::LongName" 6276 msgid "Ordibehesht" 6277 msgstr "Ordibehesht" 6278 6279 #: kdecore/kcalendarsystemjalali.cpp:300 6280 #, fuzzy, kde-format 6281 #| msgid "Khordad" 6282 msgctxt "Jalali month 3 - KLocale::LongName" 6283 msgid "Khordad" 6284 msgstr "Khordad" 6285 6286 #: kdecore/kcalendarsystemjalali.cpp:302 6287 #, fuzzy, kde-format 6288 #| msgctxt "Tir short" 6289 #| msgid "Tir" 6290 msgctxt "Jalali month 4 - KLocale::LongName" 6291 msgid "Tir" 6292 msgstr "Tir" 6293 6294 #: kdecore/kcalendarsystemjalali.cpp:304 6295 #, fuzzy, kde-format 6296 #| msgid "Mordad" 6297 msgctxt "Jalali month 5 - KLocale::LongName" 6298 msgid "Mordad" 6299 msgstr "Mordad" 6300 6301 #: kdecore/kcalendarsystemjalali.cpp:306 6302 #, fuzzy, kde-format 6303 #| msgid "Shahrivar" 6304 msgctxt "Jalali month 6 - KLocale::LongName" 6305 msgid "Shahrivar" 6306 msgstr "Shahrivar" 6307 6308 #: kdecore/kcalendarsystemjalali.cpp:308 6309 #, fuzzy, kde-format 6310 #| msgid "Mehr" 6311 msgctxt "Jalali month 7 - KLocale::LongName" 6312 msgid "Mehr" 6313 msgstr "Mehr" 6314 6315 #: kdecore/kcalendarsystemjalali.cpp:310 6316 #, fuzzy, kde-format 6317 #| msgid "Aban" 6318 msgctxt "Jalali month 8 - KLocale::LongName" 6319 msgid "Aban" 6320 msgstr "Aban" 6321 6322 #: kdecore/kcalendarsystemjalali.cpp:312 6323 #, fuzzy, kde-format 6324 #| msgid "Azar" 6325 msgctxt "Jalali month 9 - KLocale::LongName" 6326 msgid "Azar" 6327 msgstr "Azar" 6328 6329 #: kdecore/kcalendarsystemjalali.cpp:314 6330 #, fuzzy, kde-format 6331 #| msgctxt "Dei short" 6332 #| msgid "Dei" 6333 msgctxt "Jalali month 10 - KLocale::LongName" 6334 msgid "Dei" 6335 msgstr "Dei" 6336 6337 #: kdecore/kcalendarsystemjalali.cpp:316 6338 #, fuzzy, kde-format 6339 #| msgid "Bahman" 6340 msgctxt "Jalali month 11 - KLocale::LongName" 6341 msgid "Bahman" 6342 msgstr "Bahman" 6343 6344 #: kdecore/kcalendarsystemjalali.cpp:318 6345 #, fuzzy, kde-format 6346 #| msgid "Esfand" 6347 msgctxt "Jalali month 12 - KLocale::LongName" 6348 msgid "Esfand" 6349 msgstr "Esfand" 6350 6351 #: kdecore/kcalendarsystemjalali.cpp:331 6352 #, kde-format 6353 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6354 msgid "2" 6355 msgstr "" 6356 6357 #: kdecore/kcalendarsystemjalali.cpp:333 6358 #, kde-format 6359 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6360 msgid "3" 6361 msgstr "" 6362 6363 #: kdecore/kcalendarsystemjalali.cpp:335 6364 #, kde-format 6365 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6366 msgid "4" 6367 msgstr "" 6368 6369 #: kdecore/kcalendarsystemjalali.cpp:337 6370 #, kde-format 6371 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6372 msgid "5" 6373 msgstr "" 6374 6375 #: kdecore/kcalendarsystemjalali.cpp:339 6376 #, kde-format 6377 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6378 msgid "J" 6379 msgstr "" 6380 6381 #: kdecore/kcalendarsystemjalali.cpp:341 6382 #, kde-format 6383 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6384 msgid "S" 6385 msgstr "" 6386 6387 #: kdecore/kcalendarsystemjalali.cpp:343 6388 #, kde-format 6389 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6390 msgid "1" 6391 msgstr "" 6392 6393 #: kdecore/kcalendarsystemjalali.cpp:352 6394 #, fuzzy, kde-format 6395 #| msgctxt "Do shanbe short" 6396 #| msgid "2sh" 6397 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6398 msgid "2sh" 6399 msgstr "2sh" 6400 6401 #: kdecore/kcalendarsystemjalali.cpp:354 6402 #, fuzzy, kde-format 6403 #| msgctxt "Se shanbe short" 6404 #| msgid "3sh" 6405 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6406 msgid "3sh" 6407 msgstr "3sh" 6408 6409 #: kdecore/kcalendarsystemjalali.cpp:356 6410 #, fuzzy, kde-format 6411 #| msgctxt "Chahar shanbe short" 6412 #| msgid "4sh" 6413 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6414 msgid "4sh" 6415 msgstr "4sh" 6416 6417 #: kdecore/kcalendarsystemjalali.cpp:358 6418 #, fuzzy, kde-format 6419 #| msgctxt "Panj shanbe short" 6420 #| msgid "5sh" 6421 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6422 msgid "5sh" 6423 msgstr "5sh" 6424 6425 #: kdecore/kcalendarsystemjalali.cpp:360 6426 #, fuzzy, kde-format 6427 #| msgctxt "Jumee short" 6428 #| msgid "Jom" 6429 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6430 msgid "Jom" 6431 msgstr "Jom" 6432 6433 #: kdecore/kcalendarsystemjalali.cpp:362 6434 #, fuzzy, kde-format 6435 #| msgid "Shanbe" 6436 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6437 msgid "Shn" 6438 msgstr "Shanbe" 6439 6440 #: kdecore/kcalendarsystemjalali.cpp:364 6441 #, fuzzy, kde-format 6442 #| msgctxt "Yek-shanbe short" 6443 #| msgid "1sh" 6444 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6445 msgid "1sh" 6446 msgstr "1sh" 6447 6448 #: kdecore/kcalendarsystemjalali.cpp:371 6449 #, fuzzy, kde-format 6450 #| msgid "Do shanbe" 6451 msgctxt "Jalali weekday 1 - KLocale::LongName" 6452 msgid "Do shanbe" 6453 msgstr "Do shanbe" 6454 6455 #: kdecore/kcalendarsystemjalali.cpp:373 6456 #, fuzzy, kde-format 6457 #| msgid "Se shanbe" 6458 msgctxt "Jalali weekday 2 - KLocale::LongName" 6459 msgid "Se shanbe" 6460 msgstr "Se shanbe" 6461 6462 #: kdecore/kcalendarsystemjalali.cpp:375 6463 #, fuzzy, kde-format 6464 #| msgid "Chahar shanbe" 6465 msgctxt "Jalali weekday 3 - KLocale::LongName" 6466 msgid "Chahar shanbe" 6467 msgstr "Chahar shanbe" 6468 6469 #: kdecore/kcalendarsystemjalali.cpp:377 6470 #, fuzzy, kde-format 6471 #| msgid "Panj shanbe" 6472 msgctxt "Jalali weekday 4 - KLocale::LongName" 6473 msgid "Panj shanbe" 6474 msgstr "Panj shanbe" 6475 6476 #: kdecore/kcalendarsystemjalali.cpp:379 6477 #, fuzzy, kde-format 6478 #| msgid "Jumee" 6479 msgctxt "Jalali weekday 5 - KLocale::LongName" 6480 msgid "Jumee" 6481 msgstr "Jumee" 6482 6483 #: kdecore/kcalendarsystemjalali.cpp:381 6484 #, fuzzy, kde-format 6485 #| msgid "Shanbe" 6486 msgctxt "Jalali weekday 6 - KLocale::LongName" 6487 msgid "Shanbe" 6488 msgstr "Shanbe" 6489 6490 #: kdecore/kcalendarsystemjalali.cpp:383 6491 #, fuzzy, kde-format 6492 #| msgid "Yek-shanbe" 6493 msgctxt "Jalali weekday 7 - KLocale::LongName" 6494 msgid "Yek-shanbe" 6495 msgstr "Yek-shanbe" 6496 6497 #: kdecore/kcalendarsystemjapanese.cpp:62 6498 #, kde-format 6499 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6500 msgid "Meiji" 6501 msgstr "Meiji" 6502 6503 #: kdecore/kcalendarsystemjapanese.cpp:64 6504 #, kde-format 6505 msgctxt "" 6506 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6507 "e.g. Meiji 1" 6508 msgid "%EC Gannen" 6509 msgstr "" 6510 6511 #: kdecore/kcalendarsystemjapanese.cpp:66 6512 #, kde-format 6513 msgctxt "" 6514 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6515 "e.g. Meiji 22" 6516 msgid "%EC %Ey" 6517 msgstr "" 6518 6519 #: kdecore/kcalendarsystemjapanese.cpp:69 6520 #, kde-format 6521 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6522 msgid "Taishō" 6523 msgstr "" 6524 6525 #: kdecore/kcalendarsystemjapanese.cpp:71 6526 #, kde-format 6527 msgctxt "" 6528 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6529 "1, e.g. Taishō 1" 6530 msgid "%EC Gannen" 6531 msgstr "" 6532 6533 #: kdecore/kcalendarsystemjapanese.cpp:73 6534 #, kde-format 6535 msgctxt "" 6536 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6537 "1, e.g. Taishō 22" 6538 msgid "%EC %Ey" 6539 msgstr "" 6540 6541 #: kdecore/kcalendarsystemjapanese.cpp:76 6542 #, fuzzy, kde-format 6543 #| msgctxt "Shahrivar short" 6544 #| msgid "Sha" 6545 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6546 msgid "Shōwa" 6547 msgstr "Sha" 6548 6549 #: kdecore/kcalendarsystemjapanese.cpp:78 6550 #, kde-format 6551 msgctxt "" 6552 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6553 "e.g. Shōwa 1" 6554 msgid "%EC Gannen" 6555 msgstr "" 6556 6557 #: kdecore/kcalendarsystemjapanese.cpp:80 6558 #, kde-format 6559 msgctxt "" 6560 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6561 "e.g. Shōwa 22" 6562 msgid "%EC %Ey" 6563 msgstr "" 6564 6565 #: kdecore/kcalendarsystemjapanese.cpp:83 6566 #, kde-format 6567 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6568 msgid "Heisei" 6569 msgstr "" 6570 6571 #: kdecore/kcalendarsystemjapanese.cpp:85 6572 #, kde-format 6573 msgctxt "" 6574 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6575 "1, e.g. Heisei 1" 6576 msgid "%EC Gannen" 6577 msgstr "" 6578 6579 #: kdecore/kcalendarsystemjapanese.cpp:87 6580 #, kde-format 6581 msgctxt "" 6582 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6583 "1, e.g. Heisei 22" 6584 msgid "%EC %Ey" 6585 msgstr "" 6586 6587 #: kdecore/kcalendarsystemjapanese.cpp:164 6588 #, fuzzy, kde-format 6589 msgctxt "Japanese year 1 of era" 6590 msgid "Gannen" 6591 msgstr "Vert:" 6592 6593 #: kdecore/kcalendarsystemjulian.cpp:73 6594 #, kde-format 6595 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6596 msgid "Before Common Era" 6597 msgstr "Divant l' Ere comone" 6598 6599 #: kdecore/kcalendarsystemjulian.cpp:74 6600 #, kde-format 6601 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6602 msgid "BCE" 6603 msgstr "DEC" 6604 6605 #: kdecore/kcalendarsystemjulian.cpp:76 6606 #, kde-format 6607 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6608 msgid "Before Christ" 6609 msgstr "Divant Djezus-Crisse" 6610 6611 #: kdecore/kcalendarsystemjulian.cpp:77 6612 #, kde-format 6613 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6614 msgid "BC" 6615 msgstr "div. Dj.-C." 6616 6617 #: kdecore/kcalendarsystemjulian.cpp:79 6618 #, kde-format 6619 msgctxt "" 6620 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6621 msgid "%Ey %EC" 6622 msgstr "%Ey %EC" 6623 6624 #: kdecore/kcalendarsystemjulian.cpp:83 6625 #, kde-format 6626 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6627 msgid "Common Era" 6628 msgstr "Ere comone" 6629 6630 #: kdecore/kcalendarsystemjulian.cpp:84 6631 #, kde-format 6632 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6633 msgid "CE" 6634 msgstr "EC" 6635 6636 #: kdecore/kcalendarsystemjulian.cpp:86 6637 #, kde-format 6638 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6639 msgid "Anno Domini" 6640 msgstr "Anno Domini" 6641 6642 #: kdecore/kcalendarsystemjulian.cpp:87 6643 #, kde-format 6644 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6645 msgid "AD" 6646 msgstr "AD" 6647 6648 #: kdecore/kcalendarsystemjulian.cpp:89 6649 #, kde-format 6650 msgctxt "" 6651 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6652 msgid "%Ey %EC" 6653 msgstr "%Ey %EC" 6654 6655 #: kdecore/kcalendarsystemjulian.cpp:172 6656 #, kde-format 6657 msgctxt "Julian month 1 - KLocale::NarrowName" 6658 msgid "J" 6659 msgstr "D" 6660 6661 #: kdecore/kcalendarsystemjulian.cpp:174 6662 #, kde-format 6663 msgctxt "Julian month 2 - KLocale::NarrowName" 6664 msgid "F" 6665 msgstr "F" 6666 6667 #: kdecore/kcalendarsystemjulian.cpp:176 6668 #, kde-format 6669 msgctxt "Julian month 3 - KLocale::NarrowName" 6670 msgid "M" 6671 msgstr "M" 6672 6673 #: kdecore/kcalendarsystemjulian.cpp:178 6674 #, kde-format 6675 msgctxt "Julian month 4 - KLocale::NarrowName" 6676 msgid "A" 6677 msgstr "A" 6678 6679 #: kdecore/kcalendarsystemjulian.cpp:180 6680 #, kde-format 6681 msgctxt "Julian month 5 - KLocale::NarrowName" 6682 msgid "M" 6683 msgstr "M" 6684 6685 #: kdecore/kcalendarsystemjulian.cpp:182 6686 #, kde-format 6687 msgctxt "Julian month 6 - KLocale::NarrowName" 6688 msgid "J" 6689 msgstr "D" 6690 6691 #: kdecore/kcalendarsystemjulian.cpp:184 6692 #, kde-format 6693 msgctxt "Julian month 7 - KLocale::NarrowName" 6694 msgid "J" 6695 msgstr "D" 6696 6697 #: kdecore/kcalendarsystemjulian.cpp:186 6698 #, kde-format 6699 msgctxt "Julian month 8 - KLocale::NarrowName" 6700 msgid "A" 6701 msgstr "A" 6702 6703 #: kdecore/kcalendarsystemjulian.cpp:188 6704 #, kde-format 6705 msgctxt "Julian month 9 - KLocale::NarrowName" 6706 msgid "S" 6707 msgstr "S" 6708 6709 #: kdecore/kcalendarsystemjulian.cpp:190 6710 #, kde-format 6711 msgctxt "Julian month 10 - KLocale::NarrowName" 6712 msgid "O" 6713 msgstr "O" 6714 6715 #: kdecore/kcalendarsystemjulian.cpp:192 6716 #, kde-format 6717 msgctxt "Julian month 11 - KLocale::NarrowName" 6718 msgid "N" 6719 msgstr "N" 6720 6721 #: kdecore/kcalendarsystemjulian.cpp:194 6722 #, kde-format 6723 msgctxt "Julian month 12 - KLocale::NarrowName" 6724 msgid "D" 6725 msgstr "D" 6726 6727 #: kdecore/kcalendarsystemjulian.cpp:203 6728 #, kde-format 6729 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6730 msgid "of Jan" 6731 msgstr "di dja" 6732 6733 #: kdecore/kcalendarsystemjulian.cpp:205 6734 #, kde-format 6735 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6736 msgid "of Feb" 6737 msgstr "di fev" 6738 6739 #: kdecore/kcalendarsystemjulian.cpp:207 6740 #, kde-format 6741 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6742 msgid "of Mar" 6743 msgstr "di mås" 6744 6745 #: kdecore/kcalendarsystemjulian.cpp:209 6746 #, kde-format 6747 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 6748 msgid "of Apr" 6749 msgstr "d' avr" 6750 6751 #: kdecore/kcalendarsystemjulian.cpp:211 6752 #, kde-format 6753 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 6754 msgid "of May" 6755 msgstr "di may" 6756 6757 #: kdecore/kcalendarsystemjulian.cpp:213 6758 #, kde-format 6759 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 6760 msgid "of Jun" 6761 msgstr "di djn" 6762 6763 #: kdecore/kcalendarsystemjulian.cpp:215 6764 #, kde-format 6765 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 6766 msgid "of Jul" 6767 msgstr "di djl" 6768 6769 #: kdecore/kcalendarsystemjulian.cpp:217 6770 #, kde-format 6771 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 6772 msgid "of Aug" 6773 msgstr "d' awo" 6774 6775 #: kdecore/kcalendarsystemjulian.cpp:219 6776 #, kde-format 6777 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 6778 msgid "of Sep" 6779 msgstr "di set" 6780 6781 #: kdecore/kcalendarsystemjulian.cpp:221 6782 #, kde-format 6783 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 6784 msgid "of Oct" 6785 msgstr "d' oct" 6786 6787 #: kdecore/kcalendarsystemjulian.cpp:223 6788 #, kde-format 6789 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 6790 msgid "of Nov" 6791 msgstr "di nôv" 6792 6793 #: kdecore/kcalendarsystemjulian.cpp:225 6794 #, kde-format 6795 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 6796 msgid "of Dec" 6797 msgstr "di dec" 6798 6799 #: kdecore/kcalendarsystemjulian.cpp:234 6800 #, kde-format 6801 msgctxt "Julian month 1 - KLocale::ShortName" 6802 msgid "Jan" 6803 msgstr "dja" 6804 6805 #: kdecore/kcalendarsystemjulian.cpp:236 6806 #, kde-format 6807 msgctxt "Julian month 2 - KLocale::ShortName" 6808 msgid "Feb" 6809 msgstr "fev" 6810 6811 #: kdecore/kcalendarsystemjulian.cpp:238 6812 #, kde-format 6813 msgctxt "Julian month 3 - KLocale::ShortName" 6814 msgid "Mar" 6815 msgstr "mås" 6816 6817 #: kdecore/kcalendarsystemjulian.cpp:240 6818 #, kde-format 6819 msgctxt "Julian month 4 - KLocale::ShortName" 6820 msgid "Apr" 6821 msgstr "avr" 6822 6823 #: kdecore/kcalendarsystemjulian.cpp:242 6824 #, kde-format 6825 msgctxt "Julian month 5 - KLocale::ShortName" 6826 msgid "May" 6827 msgstr "may" 6828 6829 #: kdecore/kcalendarsystemjulian.cpp:244 6830 #, kde-format 6831 msgctxt "Julian month 6 - KLocale::ShortName" 6832 msgid "Jun" 6833 msgstr "djn" 6834 6835 #: kdecore/kcalendarsystemjulian.cpp:246 6836 #, kde-format 6837 msgctxt "Julian month 7 - KLocale::ShortName" 6838 msgid "Jul" 6839 msgstr "djl" 6840 6841 #: kdecore/kcalendarsystemjulian.cpp:248 6842 #, kde-format 6843 msgctxt "Julian month 8 - KLocale::ShortName" 6844 msgid "Aug" 6845 msgstr "awo" 6846 6847 #: kdecore/kcalendarsystemjulian.cpp:250 6848 #, kde-format 6849 msgctxt "Julian month 9 - KLocale::ShortName" 6850 msgid "Sep" 6851 msgstr "set" 6852 6853 #: kdecore/kcalendarsystemjulian.cpp:252 6854 #, kde-format 6855 msgctxt "Julian month 10 - KLocale::ShortName" 6856 msgid "Oct" 6857 msgstr "oct" 6858 6859 #: kdecore/kcalendarsystemjulian.cpp:254 6860 #, kde-format 6861 msgctxt "Julian month 11 - KLocale::ShortName" 6862 msgid "Nov" 6863 msgstr "nôv" 6864 6865 #: kdecore/kcalendarsystemjulian.cpp:256 6866 #, kde-format 6867 msgctxt "Julian month 12 - KLocale::ShortName" 6868 msgid "Dec" 6869 msgstr "dec" 6870 6871 #: kdecore/kcalendarsystemjulian.cpp:265 6872 #, kde-format 6873 msgctxt "Julian month 1 - KLocale::LongName Possessive" 6874 msgid "of January" 6875 msgstr "di djanvî" 6876 6877 #: kdecore/kcalendarsystemjulian.cpp:267 6878 #, kde-format 6879 msgctxt "Julian month 2 - KLocale::LongName Possessive" 6880 msgid "of February" 6881 msgstr "di fevrî" 6882 6883 #: kdecore/kcalendarsystemjulian.cpp:269 6884 #, kde-format 6885 msgctxt "Julian month 3 - KLocale::LongName Possessive" 6886 msgid "of March" 6887 msgstr "di måss" 6888 6889 #: kdecore/kcalendarsystemjulian.cpp:271 6890 #, kde-format 6891 msgctxt "Julian month 4 - KLocale::LongName Possessive" 6892 msgid "of April" 6893 msgstr "d' avri" 6894 6895 #: kdecore/kcalendarsystemjulian.cpp:273 6896 #, kde-format 6897 msgctxt "Julian month 5 - KLocale::LongName Possessive" 6898 msgid "of May" 6899 msgstr "di may" 6900 6901 #: kdecore/kcalendarsystemjulian.cpp:275 6902 #, kde-format 6903 msgctxt "Julian month 6 - KLocale::LongName Possessive" 6904 msgid "of June" 6905 msgstr "di djun" 6906 6907 #: kdecore/kcalendarsystemjulian.cpp:277 6908 #, kde-format 6909 msgctxt "Julian month 7 - KLocale::LongName Possessive" 6910 msgid "of July" 6911 msgstr "di djulete" 6912 6913 #: kdecore/kcalendarsystemjulian.cpp:279 6914 #, kde-format 6915 msgctxt "Julian month 8 - KLocale::LongName Possessive" 6916 msgid "of August" 6917 msgstr "d' awousse" 6918 6919 #: kdecore/kcalendarsystemjulian.cpp:281 6920 #, kde-format 6921 msgctxt "Julian month 9 - KLocale::LongName Possessive" 6922 msgid "of September" 6923 msgstr "di setimbe" 6924 6925 #: kdecore/kcalendarsystemjulian.cpp:283 6926 #, kde-format 6927 msgctxt "Julian month 10 - KLocale::LongName Possessive" 6928 msgid "of October" 6929 msgstr "d' octôbe" 6930 6931 #: kdecore/kcalendarsystemjulian.cpp:285 6932 #, kde-format 6933 msgctxt "Julian month 11 - KLocale::LongName Possessive" 6934 msgid "of November" 6935 msgstr "di nôvimbe" 6936 6937 #: kdecore/kcalendarsystemjulian.cpp:287 6938 #, kde-format 6939 msgctxt "Julian month 12 - KLocale::LongName Possessive" 6940 msgid "of December" 6941 msgstr "di decimbe" 6942 6943 #: kdecore/kcalendarsystemjulian.cpp:296 6944 #, kde-format 6945 msgctxt "Julian month 1 - KLocale::LongName" 6946 msgid "January" 6947 msgstr "djanvî" 6948 6949 #: kdecore/kcalendarsystemjulian.cpp:298 6950 #, kde-format 6951 msgctxt "Julian month 2 - KLocale::LongName" 6952 msgid "February" 6953 msgstr "fevrî" 6954 6955 #: kdecore/kcalendarsystemjulian.cpp:300 6956 #, kde-format 6957 msgctxt "Julian month 3 - KLocale::LongName" 6958 msgid "March" 6959 msgstr "måss" 6960 6961 #: kdecore/kcalendarsystemjulian.cpp:302 6962 #, kde-format 6963 msgctxt "Julian month 4 - KLocale::LongName" 6964 msgid "April" 6965 msgstr "avri" 6966 6967 #: kdecore/kcalendarsystemjulian.cpp:304 6968 #, kde-format 6969 msgctxt "Julian month 5 - KLocale::LongName" 6970 msgid "May" 6971 msgstr "may" 6972 6973 #: kdecore/kcalendarsystemjulian.cpp:306 6974 #, kde-format 6975 msgctxt "Julian month 6 - KLocale::LongName" 6976 msgid "June" 6977 msgstr "djun" 6978 6979 #: kdecore/kcalendarsystemjulian.cpp:308 6980 #, kde-format 6981 msgctxt "Julian month 7 - KLocale::LongName" 6982 msgid "July" 6983 msgstr "djulete" 6984 6985 #: kdecore/kcalendarsystemjulian.cpp:310 6986 #, kde-format 6987 msgctxt "Julian month 8 - KLocale::LongName" 6988 msgid "August" 6989 msgstr "awousse" 6990 6991 #: kdecore/kcalendarsystemjulian.cpp:312 6992 #, kde-format 6993 msgctxt "Julian month 9 - KLocale::LongName" 6994 msgid "September" 6995 msgstr "setimbe" 6996 6997 #: kdecore/kcalendarsystemjulian.cpp:314 6998 #, kde-format 6999 msgctxt "Julian month 10 - KLocale::LongName" 7000 msgid "October" 7001 msgstr "octôbe" 7002 7003 #: kdecore/kcalendarsystemjulian.cpp:316 7004 #, kde-format 7005 msgctxt "Julian month 11 - KLocale::LongName" 7006 msgid "November" 7007 msgstr "nôvimbe" 7008 7009 #: kdecore/kcalendarsystemjulian.cpp:318 7010 #, kde-format 7011 msgctxt "Julian month 12 - KLocale::LongName" 7012 msgid "December" 7013 msgstr "decimbe" 7014 7015 #: kdecore/kcalendarsystemjulian.cpp:331 7016 #, kde-format 7017 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7018 msgid "M" 7019 msgstr "L" 7020 7021 #: kdecore/kcalendarsystemjulian.cpp:333 7022 #, kde-format 7023 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7024 msgid "T" 7025 msgstr "M" 7026 7027 #: kdecore/kcalendarsystemjulian.cpp:335 7028 #, kde-format 7029 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7030 msgid "W" 7031 msgstr "M" 7032 7033 #: kdecore/kcalendarsystemjulian.cpp:337 7034 #, kde-format 7035 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7036 msgid "T" 7037 msgstr "D" 7038 7039 #: kdecore/kcalendarsystemjulian.cpp:339 7040 #, kde-format 7041 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7042 msgid "F" 7043 msgstr "V" 7044 7045 #: kdecore/kcalendarsystemjulian.cpp:341 7046 #, kde-format 7047 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7048 msgid "S" 7049 msgstr "S" 7050 7051 #: kdecore/kcalendarsystemjulian.cpp:343 7052 #, kde-format 7053 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7054 msgid "S" 7055 msgstr "D" 7056 7057 #: kdecore/kcalendarsystemjulian.cpp:352 7058 #, kde-format 7059 msgctxt "Julian weekday 1 - KLocale::ShortName" 7060 msgid "Mon" 7061 msgstr "lon" 7062 7063 #: kdecore/kcalendarsystemjulian.cpp:354 7064 #, kde-format 7065 msgctxt "Julian weekday 2 - KLocale::ShortName" 7066 msgid "Tue" 7067 msgstr "mår" 7068 7069 #: kdecore/kcalendarsystemjulian.cpp:356 7070 #, kde-format 7071 msgctxt "Julian weekday 3 - KLocale::ShortName" 7072 msgid "Wed" 7073 msgstr "mie" 7074 7075 #: kdecore/kcalendarsystemjulian.cpp:358 7076 #, kde-format 7077 msgctxt "Julian weekday 4 - KLocale::ShortName" 7078 msgid "Thu" 7079 msgstr "dju" 7080 7081 #: kdecore/kcalendarsystemjulian.cpp:360 7082 #, kde-format 7083 msgctxt "Julian weekday 5 - KLocale::ShortName" 7084 msgid "Fri" 7085 msgstr "vén" 7086 7087 #: kdecore/kcalendarsystemjulian.cpp:362 7088 #, kde-format 7089 msgctxt "Julian weekday 6 - KLocale::ShortName" 7090 msgid "Sat" 7091 msgstr "sem" 7092 7093 #: kdecore/kcalendarsystemjulian.cpp:364 7094 #, kde-format 7095 msgctxt "Julian weekday 7 - KLocale::ShortName" 7096 msgid "Sun" 7097 msgstr "dim" 7098 7099 #: kdecore/kcalendarsystemjulian.cpp:371 7100 #, kde-format 7101 msgctxt "Julian weekday 1 - KLocale::LongName" 7102 msgid "Monday" 7103 msgstr "londi" 7104 7105 #: kdecore/kcalendarsystemjulian.cpp:373 7106 #, kde-format 7107 msgctxt "Julian weekday 2 - KLocale::LongName" 7108 msgid "Tuesday" 7109 msgstr "mårdi" 7110 7111 #: kdecore/kcalendarsystemjulian.cpp:375 7112 #, kde-format 7113 msgctxt "Julian weekday 3 - KLocale::LongName" 7114 msgid "Wednesday" 7115 msgstr "mierkidi" 7116 7117 #: kdecore/kcalendarsystemjulian.cpp:377 7118 #, kde-format 7119 msgctxt "Julian weekday 4 - KLocale::LongName" 7120 msgid "Thursday" 7121 msgstr "djudi" 7122 7123 #: kdecore/kcalendarsystemjulian.cpp:379 7124 #, kde-format 7125 msgctxt "Julian weekday 5 - KLocale::LongName" 7126 msgid "Friday" 7127 msgstr "vénrdi" 7128 7129 #: kdecore/kcalendarsystemjulian.cpp:381 7130 #, kde-format 7131 msgctxt "Julian weekday 6 - KLocale::LongName" 7132 msgid "Saturday" 7133 msgstr "semdi" 7134 7135 #: kdecore/kcalendarsystemjulian.cpp:383 7136 #, kde-format 7137 msgctxt "Julian weekday 7 - KLocale::LongName" 7138 msgid "Sunday" 7139 msgstr "dimegne" 7140 7141 #: kdecore/kcalendarsystemminguo.cpp:57 7142 #, kde-format 7143 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7144 msgid "Republic of China Era" 7145 msgstr "Ere del Republike di Chine" 7146 7147 #: kdecore/kcalendarsystemminguo.cpp:58 7148 #, kde-format 7149 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7150 msgid "ROC" 7151 msgstr "RDCh" 7152 7153 #: kdecore/kcalendarsystemminguo.cpp:59 7154 #, kde-format 7155 msgctxt "" 7156 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7157 msgid "%EC %Ey" 7158 msgstr "%EC %Ey" 7159 7160 #: kdecore/kcalendarsystemthai.cpp:58 7161 #, kde-format 7162 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7163 msgid "Buddhist Era" 7164 msgstr "Ere boudisse" 7165 7166 #: kdecore/kcalendarsystemthai.cpp:59 7167 #, kde-format 7168 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7169 msgid "BE" 7170 msgstr "EB" 7171 7172 #: kdecore/kcalendarsystemthai.cpp:60 7173 #, kde-format 7174 msgctxt "" 7175 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7176 msgid "%Ey %EC" 7177 msgstr "%Ey %EC" 7178 7179 #: kdecore/kcmdlineargs.cpp:278 7180 #, kde-format 7181 msgid "Use the X-server display 'displayname'" 7182 msgstr "Eployî li håynaedje di sierveu X «displayname»" 7183 7184 #: kdecore/kcmdlineargs.cpp:281 7185 #, kde-format 7186 msgid "Restore the application for the given 'sessionId'" 7187 msgstr "Rassonrer l' aplicåcion po 'sessionId' di dnêye" 7188 7189 #: kdecore/kcmdlineargs.cpp:282 7190 #, kde-format 7191 msgid "" 7192 "Causes the application to install a private color\n" 7193 "map on an 8-bit display" 7194 msgstr "" 7195 "Fwait k' l' aplicåcion astale ene palete di coleurs\n" 7196 "privêye so on håynaedje so 8 bits" 7197 7198 #: kdecore/kcmdlineargs.cpp:283 7199 #, kde-format 7200 msgid "" 7201 "Limits the number of colors allocated in the color\n" 7202 "cube on an 8-bit display, if the application is\n" 7203 "using the QApplication::ManyColor color\n" 7204 "specification" 7205 msgstr "" 7206 "Rastrind l' nombe di coleurs acoirdêyes å cube\n" 7207 "di coleurs po on håynaedje so 8 bits si l' aplicåcion\n" 7208 "eploye les specifiaedjes di coleurs\n" 7209 "QApplication::ManyColor" 7210 7211 #: kdecore/kcmdlineargs.cpp:284 7212 #, kde-format 7213 msgid "tells Qt to never grab the mouse or the keyboard" 7214 msgstr "dit a Qt di n' måy prinde por lu li sori ou l' taprece" 7215 7216 #: kdecore/kcmdlineargs.cpp:285 7217 #, kde-format 7218 msgid "" 7219 "running under a debugger can cause an implicit\n" 7220 "-nograb, use -dograb to override" 7221 msgstr "" 7222 "enonder dvins on disbugueu pout aminer on '-nograb'\n" 7223 "implicite. Eployîz '-dograb' pol sipotchî" 7224 7225 #: kdecore/kcmdlineargs.cpp:286 7226 #, kde-format 7227 msgid "switches to synchronous mode for debugging" 7228 msgstr "passe e môde sincrône pol disbugaedje" 7229 7230 #: kdecore/kcmdlineargs.cpp:288 7231 #, kde-format 7232 msgid "defines the application font" 7233 msgstr "definixh li fonte do programe" 7234 7235 #: kdecore/kcmdlineargs.cpp:290 7236 #, kde-format 7237 msgid "" 7238 "sets the default background color and an\n" 7239 "application palette (light and dark shades are\n" 7240 "calculated)" 7241 msgstr "" 7242 "definixh ene coleur di fond eyet\n" 7243 "ene palete po l' aplicåcion (des ombreyes,\n" 7244 "claires et spesses, sont carculêyes)" 7245 7246 #: kdecore/kcmdlineargs.cpp:292 7247 #, kde-format 7248 msgid "sets the default foreground color" 7249 msgstr "definixh li prémetowe coleur di dvant" 7250 7251 #: kdecore/kcmdlineargs.cpp:294 7252 #, kde-format 7253 msgid "sets the default button color" 7254 msgstr "definixh li prémetowe coleur po les botons" 7255 7256 #: kdecore/kcmdlineargs.cpp:295 7257 #, kde-format 7258 msgid "sets the application name" 7259 msgstr "definixh li no do programe" 7260 7261 #: kdecore/kcmdlineargs.cpp:296 7262 #, kde-format 7263 msgid "sets the application title (caption)" 7264 msgstr "definixh li tite do programe (el bår di tite)" 7265 7266 #: kdecore/kcmdlineargs.cpp:297 7267 #, kde-format 7268 msgid "load the testability framework" 7269 msgstr "" 7270 7271 #: kdecore/kcmdlineargs.cpp:299 7272 #, kde-format 7273 msgid "" 7274 "forces the application to use a TrueColor visual on\n" 7275 "an 8-bit display" 7276 msgstr "" 7277 "foice l' aplicåcion a eployî des vraiyès coleurs (TrueColor)\n" 7278 "avou on håynaedje so 8 bits" 7279 7280 #: kdecore/kcmdlineargs.cpp:300 7281 #, kde-format 7282 msgid "" 7283 "sets XIM (X Input Method) input style. Possible\n" 7284 "values are onthespot, overthespot, offthespot and\n" 7285 "root" 7286 msgstr "" 7287 "definixh li stîle d' intrêye XIM (X Input Method). Les tchuzes\n" 7288 "possibes sont: «onthespot», «overthespot», «offthespot»\n" 7289 "eyet «root»" 7290 7291 #: kdecore/kcmdlineargs.cpp:301 7292 #, kde-format 7293 msgid "set XIM server" 7294 msgstr "definixh li sierveu XIM" 7295 7296 #: kdecore/kcmdlineargs.cpp:302 7297 #, kde-format 7298 msgid "disable XIM" 7299 msgstr "dismete XIM" 7300 7301 #: kdecore/kcmdlineargs.cpp:304 7302 #, kde-format 7303 msgid "mirrors the whole layout of widgets" 7304 msgstr "riflete tot l' adjinçmint des ahesses" 7305 7306 #: kdecore/kcmdlineargs.cpp:305 7307 #, kde-format 7308 msgid "applies the Qt stylesheet to the application widgets" 7309 msgstr "Met en ouve li foye di stîle Qt ås ahesses des programes" 7310 7311 #: kdecore/kcmdlineargs.cpp:306 7312 #, kde-format 7313 msgid "" 7314 "use a different graphics system instead of the default one, options are " 7315 "raster and opengl (experimental)" 7316 msgstr "" 7317 "eployî èn ôte sistinme grafike al plaece do prémetou, les tchuzes sont " 7318 "raster eyet opengl (esperimintå)" 7319 7320 #: kdecore/kcmdlineargs.cpp:307 7321 #, kde-format 7322 msgid "" 7323 "QML JS debugger information. Application must be\n" 7324 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7325 "enabled" 7326 msgstr "" 7327 7328 #: kdecore/kcmdlineargs.cpp:308 7329 #, kde-format 7330 msgid "The windowing system platform (e.g. xcb or wayland)" 7331 msgstr "" 7332 7333 #: kdecore/kcmdlineargs.cpp:310 7334 #, kde-format 7335 msgid "Use 'caption' as name in the titlebar" 7336 msgstr "Eploye «caption» come tite dins l' bår di tite" 7337 7338 #: kdecore/kcmdlineargs.cpp:311 7339 #, kde-format 7340 msgid "Use 'icon' as the application icon" 7341 msgstr "Eployî «icon» come imådjete po l' programe" 7342 7343 #: kdecore/kcmdlineargs.cpp:312 7344 #, kde-format 7345 msgid "Use alternative configuration file" 7346 msgstr "Eployî èn ôte fitchî d' apontiaedje" 7347 7348 #: kdecore/kcmdlineargs.cpp:313 7349 #, kde-format 7350 msgid "Disable crash handler, to get core dumps" 7351 msgstr "Essocter li manaedjeu d' arokes, po-z aveur des 'core dumps'." 7352 7353 #: kdecore/kcmdlineargs.cpp:315 7354 #, kde-format 7355 msgid "Waits for a WM_NET compatible windowmanager" 7356 msgstr "Ratinde on manaedjeu des fniesses WM_NET compatibe." 7357 7358 #: kdecore/kcmdlineargs.cpp:317 7359 #, kde-format 7360 msgid "sets the application GUI style" 7361 msgstr "Po tchoezi li stîle di l' eterface" 7362 7363 #: kdecore/kcmdlineargs.cpp:318 7364 #, kde-format 7365 msgid "" 7366 "sets the client geometry of the main widget - see man X for the argument " 7367 "format (usually WidthxHeight+XPos+YPos)" 7368 msgstr "" 7369 "definixh les diminsions del mwaisse ahesse - loukîz al pådje di man po X pol " 7370 "cogne di cist årgumint ci (sovin WidthxHeight+XPos+YPos)" 7371 7372 #: kdecore/kcmdlineargs.cpp:436 7373 #, kde-format 7374 msgid "KDE Application" 7375 msgstr "Programe KDE" 7376 7377 #: kdecore/kcmdlineargs.cpp:497 7378 #, fuzzy, kde-format 7379 #| msgctxt "Hijri month 11 - KLocale::NarrowName" 7380 #| msgid "Q" 7381 msgid "Qt" 7382 msgstr "Q" 7383 7384 #: kdecore/kcmdlineargs.cpp:500 7385 #, kde-format 7386 msgid "KDE" 7387 msgstr "KDE" 7388 7389 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7390 #, fuzzy, kde-format 7391 #| msgid "ERROR: Unknown protocol '%1'" 7392 msgid "Unknown option '%1'." 7393 msgstr "Aroke: Protocole nén cnoxhou «%1»." 7394 7395 #: kdecore/kcmdlineargs.cpp:841 7396 #, kde-format 7397 msgctxt "@info:shell %1 is cmdoption name" 7398 msgid "'%1' missing." 7399 msgstr "I manke «%1»." 7400 7401 #: kdecore/kcmdlineargs.cpp:895 7402 #, fuzzy, kde-format 7403 #| msgctxt "" 7404 #| "@info:shell message on appcmd --version; do not translate 'Development " 7405 #| "Platform'%3 application name, other %n version strings" 7406 #| msgid "" 7407 #| "Qt: %1\n" 7408 #| "KDE Development Platform: %2\n" 7409 #| "%3: %4\n" 7410 msgctxt "" 7411 "@info:shell message on appcmd --version; do not translate 'Development " 7412 "Platform'%3 application name, other %n version strings" 7413 msgid "" 7414 "Qt: %1\n" 7415 "KDE Frameworks: %2\n" 7416 "%3: %4\n" 7417 msgstr "" 7418 "Qt: %1\n" 7419 "Platfôme di diswalpaedje di KDE: %2\n" 7420 "%3: %4\n" 7421 7422 #: kdecore/kcmdlineargs.cpp:921 7423 #, kde-format 7424 msgctxt "the 2nd argument is a list of name+address, one on each line" 7425 msgid "" 7426 "%1 was written by\n" 7427 "%2" 7428 msgstr "" 7429 "%1 a stî scrît pa\n" 7430 "%2" 7431 7432 #: kdecore/kcmdlineargs.cpp:924 7433 #, kde-format 7434 msgid "This application was written by somebody who wants to remain anonymous." 7435 msgstr "" 7436 7437 #: kdecore/kcmdlineargs.cpp:929 7438 #, kde-format 7439 msgid "Please use http://bugs.kde.org to report bugs.\n" 7440 msgstr "" 7441 7442 #: kdecore/kcmdlineargs.cpp:931 7443 #, kde-format 7444 msgid "Please report bugs to %1.\n" 7445 msgstr "" 7446 7447 #: kdecore/kcmdlineargs.cpp:961 7448 #, kde-format 7449 msgid "Unexpected argument '%1'." 7450 msgstr "" 7451 7452 #: kdecore/kcmdlineargs.cpp:1074 7453 #, kde-format 7454 msgid "Use --help to get a list of available command line options." 7455 msgstr "" 7456 7457 #: kdecore/kcmdlineargs.cpp:1096 7458 #, kde-format 7459 msgid "[options] " 7460 msgstr "" 7461 7462 #: kdecore/kcmdlineargs.cpp:1101 7463 #, kde-format 7464 msgid "[%1-options]" 7465 msgstr "" 7466 7467 #: kdecore/kcmdlineargs.cpp:1122 7468 #, kde-format 7469 msgid "Usage: %1 %2\n" 7470 msgstr "" 7471 7472 #: kdecore/kcmdlineargs.cpp:1125 7473 #, kde-format 7474 msgid "" 7475 "\n" 7476 "Generic options:\n" 7477 msgstr "" 7478 7479 #: kdecore/kcmdlineargs.cpp:1127 7480 #, kde-format 7481 msgid "Show help about options" 7482 msgstr "" 7483 7484 #: kdecore/kcmdlineargs.cpp:1133 7485 #, kde-format 7486 msgid "Show %1 specific options" 7487 msgstr "" 7488 7489 #: kdecore/kcmdlineargs.cpp:1140 7490 #, kde-format 7491 msgid "Show all options" 7492 msgstr "" 7493 7494 #: kdecore/kcmdlineargs.cpp:1141 7495 #, kde-format 7496 msgid "Show author information" 7497 msgstr "" 7498 7499 #: kdecore/kcmdlineargs.cpp:1142 7500 #, kde-format 7501 msgid "Show version information" 7502 msgstr "" 7503 7504 #: kdecore/kcmdlineargs.cpp:1143 7505 #, kde-format 7506 msgid "Show license information" 7507 msgstr "" 7508 7509 #: kdecore/kcmdlineargs.cpp:1144 7510 #, kde-format 7511 msgid "End of options" 7512 msgstr "" 7513 7514 #: kdecore/kcmdlineargs.cpp:1164 7515 #, kde-format 7516 msgid "" 7517 "\n" 7518 "%1 options:\n" 7519 msgstr "" 7520 7521 #: kdecore/kcmdlineargs.cpp:1166 7522 #, kde-format 7523 msgid "" 7524 "\n" 7525 "Options:\n" 7526 msgstr "" 7527 7528 #: kdecore/kcmdlineargs.cpp:1219 7529 #, kde-format 7530 msgid "" 7531 "\n" 7532 "Arguments:\n" 7533 msgstr "" 7534 7535 #: kdecore/kcmdlineargs.cpp:1580 7536 #, kde-format 7537 msgid "The files/URLs opened by the application will be deleted after use" 7538 msgstr "Les fitchîs/URL drovîs pal programe seront disfacés après eployaedje" 7539 7540 #: kdecore/kcmdlineargs.cpp:1581 7541 #, kde-format 7542 msgid "KDE-tempfile" 7543 msgstr "Fitchî temp di KDE" 7544 7545 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7546 #: kdecore/kdatetime.cpp:2985 7547 #, fuzzy, kde-format 7548 msgid "am" 7549 msgstr "am" 7550 7551 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7552 #: kdecore/kdatetime.cpp:2990 7553 #, kde-format 7554 msgid "pm" 7555 msgstr "pm" 7556 7557 #: kdecore/klibloader.cpp:100 7558 #, kde-format 7559 msgid "Library \"%1\" not found" 7560 msgstr "Livreye « %1 » nén trovêye" 7561 7562 #: kdecore/klocale_kde.cpp:785 7563 #, kde-format 7564 msgctxt "digit set" 7565 msgid "Arabic-Indic" 7566 msgstr "Arabe-Indyin" 7567 7568 #: kdecore/klocale_kde.cpp:788 7569 #, kde-format 7570 msgctxt "digit set" 7571 msgid "Bengali" 7572 msgstr "Bengali" 7573 7574 #: kdecore/klocale_kde.cpp:791 7575 #, kde-format 7576 msgctxt "digit set" 7577 msgid "Devanagari" 7578 msgstr "Devanagari" 7579 7580 #: kdecore/klocale_kde.cpp:794 7581 #, kde-format 7582 msgctxt "digit set" 7583 msgid "Eastern Arabic-Indic" 7584 msgstr "Arabe-Indyin do Levant" 7585 7586 #: kdecore/klocale_kde.cpp:797 7587 #, kde-format 7588 msgctxt "digit set" 7589 msgid "Gujarati" 7590 msgstr "Goudjarati" 7591 7592 #: kdecore/klocale_kde.cpp:800 7593 #, kde-format 7594 msgctxt "digit set" 7595 msgid "Gurmukhi" 7596 msgstr "Gourmouxhi" 7597 7598 #: kdecore/klocale_kde.cpp:803 7599 #, kde-format 7600 msgctxt "digit set" 7601 msgid "Kannada" 7602 msgstr "Kannada" 7603 7604 #: kdecore/klocale_kde.cpp:806 7605 #, kde-format 7606 msgctxt "digit set" 7607 msgid "Khmer" 7608 msgstr "Xhmer" 7609 7610 #: kdecore/klocale_kde.cpp:809 7611 #, kde-format 7612 msgctxt "digit set" 7613 msgid "Malayalam" 7614 msgstr "Malayalam" 7615 7616 #: kdecore/klocale_kde.cpp:812 7617 #, kde-format 7618 msgctxt "digit set" 7619 msgid "Oriya" 7620 msgstr "Oriya" 7621 7622 #: kdecore/klocale_kde.cpp:815 7623 #, kde-format 7624 msgctxt "digit set" 7625 msgid "Tamil" 7626 msgstr "Tamoul" 7627 7628 #: kdecore/klocale_kde.cpp:818 7629 #, kde-format 7630 msgctxt "digit set" 7631 msgid "Telugu" 7632 msgstr "Telougou" 7633 7634 #: kdecore/klocale_kde.cpp:821 7635 #, fuzzy, kde-format 7636 #| msgctxt "@item Calendar system" 7637 #| msgid "Thai" 7638 msgctxt "digit set" 7639 msgid "Thai" 7640 msgstr "Taylandès" 7641 7642 #: kdecore/klocale_kde.cpp:824 7643 #, kde-format 7644 msgctxt "digit set" 7645 msgid "Arabic" 7646 msgstr "Arabe" 7647 7648 #: kdecore/klocale_kde.cpp:829 7649 #, kde-format 7650 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 7651 msgid "%1 (%2)" 7652 msgstr "%1 (%2)" 7653 7654 #. i18n: comments below, they are used by the 7655 #. translators. 7656 #. This prefix is shared by all current dialects. 7657 #. i18n: Dumb message, avoid any markup or scripting. 7658 #: kdecore/klocale_kde.cpp:1327 7659 #, kde-format 7660 msgctxt "size in bytes" 7661 msgid "%1 B" 7662 msgstr "%1 o" 7663 7664 #. i18n: Dumb message, avoid any markup or scripting. 7665 #: kdecore/klocale_kde.cpp:1332 7666 #, kde-format 7667 msgctxt "size in 1000 bytes" 7668 msgid "%1 kB" 7669 msgstr "%1 ko" 7670 7671 #. i18n: Dumb message, avoid any markup or scripting. 7672 #: kdecore/klocale_kde.cpp:1334 7673 #, kde-format 7674 msgctxt "size in 10^6 bytes" 7675 msgid "%1 MB" 7676 msgstr "%1 Mo" 7677 7678 #. i18n: Dumb message, avoid any markup or scripting. 7679 #: kdecore/klocale_kde.cpp:1336 7680 #, kde-format 7681 msgctxt "size in 10^9 bytes" 7682 msgid "%1 GB" 7683 msgstr "%1 Go" 7684 7685 #. i18n: Dumb message, avoid any markup or scripting. 7686 #: kdecore/klocale_kde.cpp:1338 7687 #, kde-format 7688 msgctxt "size in 10^12 bytes" 7689 msgid "%1 TB" 7690 msgstr "%1 To" 7691 7692 #. i18n: Dumb message, avoid any markup or scripting. 7693 #: kdecore/klocale_kde.cpp:1340 7694 #, kde-format 7695 msgctxt "size in 10^15 bytes" 7696 msgid "%1 PB" 7697 msgstr "%1 Po" 7698 7699 #. i18n: Dumb message, avoid any markup or scripting. 7700 #: kdecore/klocale_kde.cpp:1342 7701 #, kde-format 7702 msgctxt "size in 10^18 bytes" 7703 msgid "%1 EB" 7704 msgstr "%1 Eo" 7705 7706 #. i18n: Dumb message, avoid any markup or scripting. 7707 #: kdecore/klocale_kde.cpp:1344 7708 #, kde-format 7709 msgctxt "size in 10^21 bytes" 7710 msgid "%1 ZB" 7711 msgstr "%1 Zo" 7712 7713 #. i18n: Dumb message, avoid any markup or scripting. 7714 #: kdecore/klocale_kde.cpp:1346 7715 #, kde-format 7716 msgctxt "size in 10^24 bytes" 7717 msgid "%1 YB" 7718 msgstr "%1 Yo" 7719 7720 #. i18n: Dumb message, avoid any markup or scripting. 7721 #: kdecore/klocale_kde.cpp:1351 7722 #, kde-format 7723 msgctxt "memory size in 1024 bytes" 7724 msgid "%1 KB" 7725 msgstr "%1 Ko" 7726 7727 #. i18n: Dumb message, avoid any markup or scripting. 7728 #: kdecore/klocale_kde.cpp:1353 7729 #, kde-format 7730 msgctxt "memory size in 2^20 bytes" 7731 msgid "%1 MB" 7732 msgstr "%1 Mo" 7733 7734 #. i18n: Dumb message, avoid any markup or scripting. 7735 #: kdecore/klocale_kde.cpp:1355 7736 #, kde-format 7737 msgctxt "memory size in 2^30 bytes" 7738 msgid "%1 GB" 7739 msgstr "%1 Go" 7740 7741 #. i18n: Dumb message, avoid any markup or scripting. 7742 #: kdecore/klocale_kde.cpp:1357 7743 #, kde-format 7744 msgctxt "memory size in 2^40 bytes" 7745 msgid "%1 TB" 7746 msgstr "%1 To" 7747 7748 #. i18n: Dumb message, avoid any markup or scripting. 7749 #: kdecore/klocale_kde.cpp:1359 7750 #, kde-format 7751 msgctxt "memory size in 2^50 bytes" 7752 msgid "%1 PB" 7753 msgstr "%1 Po" 7754 7755 #. i18n: Dumb message, avoid any markup or scripting. 7756 #: kdecore/klocale_kde.cpp:1361 7757 #, kde-format 7758 msgctxt "memory size in 2^60 bytes" 7759 msgid "%1 EB" 7760 msgstr "%1 Eo" 7761 7762 #. i18n: Dumb message, avoid any markup or scripting. 7763 #: kdecore/klocale_kde.cpp:1363 7764 #, kde-format 7765 msgctxt "memory size in 2^70 bytes" 7766 msgid "%1 ZB" 7767 msgstr "%1 Zo" 7768 7769 #. i18n: Dumb message, avoid any markup or scripting. 7770 #: kdecore/klocale_kde.cpp:1365 7771 #, kde-format 7772 msgctxt "memory size in 2^80 bytes" 7773 msgid "%1 YB" 7774 msgstr "%1 Yo" 7775 7776 #. i18n: Dumb message, avoid any markup or scripting. 7777 #: kdecore/klocale_kde.cpp:1371 7778 #, kde-format 7779 msgctxt "size in 1024 bytes" 7780 msgid "%1 KiB" 7781 msgstr "%1 Kio" 7782 7783 #. i18n: Dumb message, avoid any markup or scripting. 7784 #: kdecore/klocale_kde.cpp:1373 7785 #, kde-format 7786 msgctxt "size in 2^20 bytes" 7787 msgid "%1 MiB" 7788 msgstr "%1 Mio" 7789 7790 #. i18n: Dumb message, avoid any markup or scripting. 7791 #: kdecore/klocale_kde.cpp:1375 7792 #, kde-format 7793 msgctxt "size in 2^30 bytes" 7794 msgid "%1 GiB" 7795 msgstr "%1 Gio" 7796 7797 #. i18n: Dumb message, avoid any markup or scripting. 7798 #: kdecore/klocale_kde.cpp:1377 7799 #, kde-format 7800 msgctxt "size in 2^40 bytes" 7801 msgid "%1 TiB" 7802 msgstr "%1 Tio" 7803 7804 #. i18n: Dumb message, avoid any markup or scripting. 7805 #: kdecore/klocale_kde.cpp:1379 7806 #, kde-format 7807 msgctxt "size in 2^50 bytes" 7808 msgid "%1 PiB" 7809 msgstr "%1 Pio" 7810 7811 #. i18n: Dumb message, avoid any markup or scripting. 7812 #: kdecore/klocale_kde.cpp:1381 7813 #, kde-format 7814 msgctxt "size in 2^60 bytes" 7815 msgid "%1 EiB" 7816 msgstr "%1 Eio" 7817 7818 #. i18n: Dumb message, avoid any markup or scripting. 7819 #: kdecore/klocale_kde.cpp:1383 7820 #, kde-format 7821 msgctxt "size in 2^70 bytes" 7822 msgid "%1 ZiB" 7823 msgstr "%1 Zio" 7824 7825 #. i18n: Dumb message, avoid any markup or scripting. 7826 #: kdecore/klocale_kde.cpp:1385 7827 #, kde-format 7828 msgctxt "size in 2^80 bytes" 7829 msgid "%1 YiB" 7830 msgstr "%1 Yio" 7831 7832 #: kdecore/klocale_kde.cpp:1472 7833 #, kde-format 7834 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 7835 msgid "%1 days" 7836 msgstr "%1 djoûs" 7837 7838 #: kdecore/klocale_kde.cpp:1475 7839 #, kde-format 7840 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 7841 msgid "%1 hours" 7842 msgstr "%1 eures" 7843 7844 #: kdecore/klocale_kde.cpp:1478 7845 #, kde-format 7846 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 7847 msgid "%1 minutes" 7848 msgstr "%1 munutes" 7849 7850 #: kdecore/klocale_kde.cpp:1481 7851 #, kde-format 7852 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 7853 msgid "%1 seconds" 7854 msgstr "%1 segondes" 7855 7856 #: kdecore/klocale_kde.cpp:1484 7857 #, kde-format 7858 msgctxt "@item:intext" 7859 msgid "%1 millisecond" 7860 msgid_plural "%1 milliseconds" 7861 msgstr[0] "" 7862 msgstr[1] "" 7863 7864 #: kdecore/klocale_kde.cpp:1491 7865 #, kde-format 7866 msgctxt "@item:intext" 7867 msgid "1 day" 7868 msgid_plural "%1 days" 7869 msgstr[0] "" 7870 msgstr[1] "" 7871 7872 #: kdecore/klocale_kde.cpp:1493 7873 #, kde-format 7874 msgctxt "@item:intext" 7875 msgid "1 hour" 7876 msgid_plural "%1 hours" 7877 msgstr[0] "" 7878 msgstr[1] "" 7879 7880 #: kdecore/klocale_kde.cpp:1495 7881 #, kde-format 7882 msgctxt "@item:intext" 7883 msgid "1 minute" 7884 msgid_plural "%1 minutes" 7885 msgstr[0] "" 7886 msgstr[1] "" 7887 7888 #: kdecore/klocale_kde.cpp:1497 7889 #, kde-format 7890 msgctxt "@item:intext" 7891 msgid "1 second" 7892 msgid_plural "%1 seconds" 7893 msgstr[0] "" 7894 msgstr[1] "" 7895 7896 #: kdecore/klocale_kde.cpp:1521 7897 #, kde-format 7898 msgctxt "" 7899 "@item:intext days and hours. This uses the previous item:intext messages. If " 7900 "this does not fit the grammar of your language please contact the i18n team " 7901 "to solve the problem" 7902 msgid "%1 and %2" 7903 msgstr "%1 eyet %2" 7904 7905 #: kdecore/klocale_kde.cpp:1527 7906 #, kde-format 7907 msgctxt "" 7908 "@item:intext hours and minutes. This uses the previous item:intext messages. " 7909 "If this does not fit the grammar of your language please contact the i18n " 7910 "team to solve the problem" 7911 msgid "%1 and %2" 7912 msgstr "%1 eyet %2" 7913 7914 #: kdecore/klocale_kde.cpp:1534 7915 #, kde-format 7916 msgctxt "" 7917 "@item:intext minutes and seconds. This uses the previous item:intext " 7918 "messages. If this does not fit the grammar of your language please contact " 7919 "the i18n team to solve the problem" 7920 msgid "%1 and %2" 7921 msgstr "%1 eyet %2" 7922 7923 #: kdecore/klocale_kde.cpp:2153 7924 #, kde-format 7925 msgctxt "Before Noon KLocale::LongName" 7926 msgid "Ante Meridiem" 7927 msgstr "Ante Meridiem" 7928 7929 #: kdecore/klocale_kde.cpp:2154 7930 #, fuzzy, kde-format 7931 #| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 7932 #| msgid "AM" 7933 msgctxt "Before Noon KLocale::ShortName" 7934 msgid "AM" 7935 msgstr "AM" 7936 7937 #: kdecore/klocale_kde.cpp:2155 7938 #, fuzzy, kde-format 7939 #| msgid "Av" 7940 msgctxt "Before Noon KLocale::NarrowName" 7941 msgid "A" 7942 msgstr "Av" 7943 7944 #: kdecore/klocale_kde.cpp:2158 7945 #, kde-format 7946 msgctxt "After Noon KLocale::LongName" 7947 msgid "Post Meridiem" 7948 msgstr "Post Meridiem" 7949 7950 #: kdecore/klocale_kde.cpp:2159 7951 #, fuzzy, kde-format 7952 #| msgctxt "Gregorian month 3 - KLocale::NarrowName" 7953 #| msgid "M" 7954 msgctxt "After Noon KLocale::ShortName" 7955 msgid "PM" 7956 msgstr "M" 7957 7958 #: kdecore/klocale_kde.cpp:2160 7959 #, fuzzy, kde-format 7960 #| msgctxt "Indian National month 10 - KLocale::NarrowName" 7961 #| msgid "P" 7962 msgctxt "After Noon KLocale::NarrowName" 7963 msgid "P" 7964 msgstr "P" 7965 7966 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 7967 #, kde-format 7968 msgctxt "concatenation of dates and time" 7969 msgid "%1 %2" 7970 msgstr "%1 %2" 7971 7972 #: kdecore/klocale_kde.cpp:2267 7973 #, kde-format 7974 msgctxt "concatenation of date/time and time zone" 7975 msgid "%1 %2" 7976 msgstr "%1 %2" 7977 7978 #: kdecore/ksavefile.cpp:99 7979 #, kde-format 7980 msgid "No target filename has been given." 7981 msgstr "" 7982 7983 #: kdecore/ksavefile.cpp:106 7984 #, kde-format 7985 msgid "Already opened." 7986 msgstr "" 7987 7988 #: kdecore/ksavefile.cpp:135 7989 #, kde-format 7990 msgid "Insufficient permissions in target directory." 7991 msgstr "" 7992 7993 #: kdecore/ksavefile.cpp:139 7994 #, kde-format 7995 msgid "Unable to open temporary file." 7996 msgstr "" 7997 7998 #: kdecore/ksavefile.cpp:249 7999 #, kde-format 8000 msgid "Synchronization to disk failed" 8001 msgstr "" 8002 8003 #: kdecore/ksavefile.cpp:280 8004 #, kde-format 8005 msgid "Error during rename." 8006 msgstr "" 8007 8008 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8009 #, kde-format 8010 msgid "Timed out trying to connect to remote host" 8011 msgstr "Tins dispassé po sayî d' raloyî l' lodjoe å lon" 8012 8013 #: kdecore/netsupp.cpp:866 8014 #, kde-format 8015 msgid "address family for nodename not supported" 8016 msgstr "ciste adresse di famile la n' va nén po « nodename »" 8017 8018 #: kdecore/netsupp.cpp:868 8019 #, kde-format 8020 msgid "invalid value for 'ai_flags'" 8021 msgstr "mwaijhe valixhance po 'ai_flags'" 8022 8023 #: kdecore/netsupp.cpp:870 8024 #, kde-format 8025 msgid "'ai_family' not supported" 8026 msgstr "'ai_family' nén sopoirtêye" 8027 8028 #: kdecore/netsupp.cpp:872 8029 #, kde-format 8030 msgid "no address associated with nodename" 8031 msgstr "gn a nole adresse ki va avou « nodename »" 8032 8033 #: kdecore/netsupp.cpp:874 8034 #, kde-format 8035 msgid "servname not supported for ai_socktype" 8036 msgstr "no di sierveu nén sopoirté po « ai_socktype »" 8037 8038 #: kdecore/netsupp.cpp:875 8039 #, kde-format 8040 msgid "'ai_socktype' not supported" 8041 msgstr "« ai_socktype » nén sopoirté" 8042 8043 #: kdecore/netsupp.cpp:876 8044 #, kde-format 8045 msgid "system error" 8046 msgstr "aroke sistinme" 8047 8048 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8049 #, kde-format 8050 msgid "KDE Test Program" 8051 msgstr "Programe di saye di KDE" 8052 8053 #: kdecore/TIMEZONES:1 8054 #, kde-format 8055 msgid "Africa/Abidjan" 8056 msgstr "Afrike/Abidjan" 8057 8058 #: kdecore/TIMEZONES:2 8059 #, kde-format 8060 msgid "Africa/Accra" 8061 msgstr "Afrike/Accra" 8062 8063 #: kdecore/TIMEZONES:3 8064 #, kde-format 8065 msgid "Africa/Addis_Ababa" 8066 msgstr "Afrike/Addis_Ababa" 8067 8068 #: kdecore/TIMEZONES:4 8069 #, kde-format 8070 msgid "Africa/Algiers" 8071 msgstr "Afrike/Aldjî" 8072 8073 #: kdecore/TIMEZONES:5 8074 #, fuzzy, kde-format 8075 #| msgid "Africa/Asmera" 8076 msgid "Africa/Asmara" 8077 msgstr "Afrike/Asmera" 8078 8079 #: kdecore/TIMEZONES:6 8080 #, kde-format 8081 msgid "Africa/Asmera" 8082 msgstr "Afrike/Asmera" 8083 8084 #: kdecore/TIMEZONES:7 8085 #, kde-format 8086 msgid "Africa/Bamako" 8087 msgstr "Afrike/Bamako" 8088 8089 #: kdecore/TIMEZONES:8 8090 #, kde-format 8091 msgid "Africa/Bangui" 8092 msgstr "Afrike/Bangui" 8093 8094 #: kdecore/TIMEZONES:9 8095 #, kde-format 8096 msgid "Africa/Banjul" 8097 msgstr "Afrike/Banjul" 8098 8099 #: kdecore/TIMEZONES:10 8100 #, kde-format 8101 msgid "Africa/Bissau" 8102 msgstr "Afrike/Bissau" 8103 8104 #: kdecore/TIMEZONES:11 8105 #, kde-format 8106 msgid "Africa/Blantyre" 8107 msgstr "Afrike/Blantyre" 8108 8109 #: kdecore/TIMEZONES:12 8110 #, kde-format 8111 msgid "Africa/Brazzaville" 8112 msgstr "Afrike/Brazzaville" 8113 8114 #: kdecore/TIMEZONES:13 8115 #, kde-format 8116 msgid "Africa/Bujumbura" 8117 msgstr "Afrike/Bujumbura" 8118 8119 #: kdecore/TIMEZONES:14 8120 #, kde-format 8121 msgid "Africa/Cairo" 8122 msgstr "Afrike/Li Caire" 8123 8124 #: kdecore/TIMEZONES:15 8125 #, kde-format 8126 msgid "Africa/Casablanca" 8127 msgstr "Afrike/Cazablanca" 8128 8129 #: kdecore/TIMEZONES:16 8130 #, kde-format 8131 msgid "Africa/Ceuta" 8132 msgstr "Afrike/Ceuta" 8133 8134 #. i18n: comment to the previous timezone 8135 #: kdecore/TIMEZONES:18 8136 #, kde-format 8137 msgid "Ceuta & Melilla" 8138 msgstr "" 8139 8140 #. i18n: comment to the previous timezone 8141 #: kdecore/TIMEZONES:20 8142 #, kde-format 8143 msgid "Ceuta, Melilla" 8144 msgstr "" 8145 8146 #: kdecore/TIMEZONES:21 8147 #, kde-format 8148 msgid "Africa/Conakry" 8149 msgstr "Afrike/Conakry" 8150 8151 #: kdecore/TIMEZONES:22 8152 #, kde-format 8153 msgid "Africa/Dakar" 8154 msgstr "Afrike/Dakar" 8155 8156 #: kdecore/TIMEZONES:23 8157 #, kde-format 8158 msgid "Africa/Dar_es_Salaam" 8159 msgstr "Afrike/Dar_es_Salaam" 8160 8161 #: kdecore/TIMEZONES:24 8162 #, kde-format 8163 msgid "Africa/Djibouti" 8164 msgstr "Afrike/Djibouti" 8165 8166 #: kdecore/TIMEZONES:25 8167 #, kde-format 8168 msgid "Africa/Douala" 8169 msgstr "Afrike/Douala" 8170 8171 #: kdecore/TIMEZONES:26 8172 #, kde-format 8173 msgid "Africa/El_Aaiun" 8174 msgstr "Afrike/El_Aaiun" 8175 8176 #: kdecore/TIMEZONES:27 8177 #, kde-format 8178 msgid "Africa/Freetown" 8179 msgstr "Afrike/Freetown" 8180 8181 #: kdecore/TIMEZONES:28 8182 #, kde-format 8183 msgid "Africa/Gaborone" 8184 msgstr "Afrike/Gaborone" 8185 8186 #: kdecore/TIMEZONES:29 8187 #, kde-format 8188 msgid "Africa/Harare" 8189 msgstr "Afrike/Harare" 8190 8191 #: kdecore/TIMEZONES:30 8192 #, kde-format 8193 msgid "Africa/Johannesburg" 8194 msgstr "Afrike/Johannesburg" 8195 8196 #: kdecore/TIMEZONES:31 8197 #, fuzzy, kde-format 8198 #| msgid "Africa/Ceuta" 8199 msgid "Africa/Juba" 8200 msgstr "Afrike/Ceuta" 8201 8202 #: kdecore/TIMEZONES:32 8203 #, kde-format 8204 msgid "Africa/Kampala" 8205 msgstr "Afrike/Kampala" 8206 8207 #: kdecore/TIMEZONES:33 8208 #, kde-format 8209 msgid "Africa/Khartoum" 8210 msgstr "Afrike/Khartoum" 8211 8212 #: kdecore/TIMEZONES:34 8213 #, kde-format 8214 msgid "Africa/Kigali" 8215 msgstr "Afrike/Kigali" 8216 8217 #: kdecore/TIMEZONES:35 8218 #, kde-format 8219 msgid "Africa/Kinshasa" 8220 msgstr "Afrike/Kinshasa" 8221 8222 #. i18n: comment to the previous timezone 8223 #: kdecore/TIMEZONES:37 8224 #, kde-format 8225 msgid "west Dem. Rep. of Congo" 8226 msgstr "" 8227 8228 #. i18n: comment to the previous timezone 8229 #: kdecore/TIMEZONES:39 8230 #, kde-format 8231 msgid "Dem. Rep. of Congo (west)" 8232 msgstr "" 8233 8234 #: kdecore/TIMEZONES:40 8235 #, kde-format 8236 msgid "Africa/Lagos" 8237 msgstr "Afrike/Lagos" 8238 8239 #: kdecore/TIMEZONES:41 8240 #, kde-format 8241 msgid "Africa/Libreville" 8242 msgstr "Afrike/Libreville" 8243 8244 #: kdecore/TIMEZONES:42 8245 #, kde-format 8246 msgid "Africa/Lome" 8247 msgstr "Afrike/Lome" 8248 8249 #: kdecore/TIMEZONES:43 8250 #, kde-format 8251 msgid "Africa/Luanda" 8252 msgstr "Afrike/Luanda" 8253 8254 #: kdecore/TIMEZONES:44 8255 #, kde-format 8256 msgid "Africa/Lubumbashi" 8257 msgstr "Afrike/Lubumbashi" 8258 8259 #. i18n: comment to the previous timezone 8260 #: kdecore/TIMEZONES:46 8261 #, kde-format 8262 msgid "east Dem. Rep. of Congo" 8263 msgstr "" 8264 8265 #. i18n: comment to the previous timezone 8266 #: kdecore/TIMEZONES:48 8267 #, kde-format 8268 msgid "Dem. Rep. of Congo (east)" 8269 msgstr "" 8270 8271 #: kdecore/TIMEZONES:49 8272 #, kde-format 8273 msgid "Africa/Lusaka" 8274 msgstr "Afrike/Lusaka" 8275 8276 #: kdecore/TIMEZONES:50 8277 #, kde-format 8278 msgid "Africa/Malabo" 8279 msgstr "Afrike/Malabo" 8280 8281 #: kdecore/TIMEZONES:51 8282 #, kde-format 8283 msgid "Africa/Maputo" 8284 msgstr "Afrike/Maputo" 8285 8286 #: kdecore/TIMEZONES:52 8287 #, kde-format 8288 msgid "Africa/Maseru" 8289 msgstr "Afrike/Maseru" 8290 8291 #: kdecore/TIMEZONES:53 8292 #, kde-format 8293 msgid "Africa/Mbabane" 8294 msgstr "Afrike/Mbabane" 8295 8296 #: kdecore/TIMEZONES:54 8297 #, kde-format 8298 msgid "Africa/Mogadishu" 8299 msgstr "Afrike/Mogadishu" 8300 8301 #: kdecore/TIMEZONES:55 8302 #, kde-format 8303 msgid "Africa/Monrovia" 8304 msgstr "Afrike/Monrovia" 8305 8306 #: kdecore/TIMEZONES:56 8307 #, kde-format 8308 msgid "Africa/Nairobi" 8309 msgstr "Afrike/Nairobi" 8310 8311 #: kdecore/TIMEZONES:57 8312 #, kde-format 8313 msgid "Africa/Ndjamena" 8314 msgstr "Afrike/Ndjamena" 8315 8316 #: kdecore/TIMEZONES:58 8317 #, kde-format 8318 msgid "Africa/Niamey" 8319 msgstr "Afrike/Niamey" 8320 8321 #: kdecore/TIMEZONES:59 8322 #, kde-format 8323 msgid "Africa/Nouakchott" 8324 msgstr "Afrike/Nouakchott" 8325 8326 #: kdecore/TIMEZONES:60 8327 #, kde-format 8328 msgid "Africa/Ouagadougou" 8329 msgstr "Afrike/Ouagadougou" 8330 8331 #: kdecore/TIMEZONES:61 8332 #, kde-format 8333 msgid "Africa/Porto-Novo" 8334 msgstr "Afrike/Porto-Novo" 8335 8336 #: kdecore/TIMEZONES:62 8337 #, fuzzy, kde-format 8338 #| msgid "Africa/Ceuta" 8339 msgid "Africa/Pretoria" 8340 msgstr "Afrike/Ceuta" 8341 8342 #: kdecore/TIMEZONES:63 8343 #, kde-format 8344 msgid "Africa/Sao_Tome" 8345 msgstr "Afrike/Sao_Tome" 8346 8347 #: kdecore/TIMEZONES:64 8348 #, kde-format 8349 msgid "Africa/Timbuktu" 8350 msgstr "Afrike/Timbuktu" 8351 8352 #: kdecore/TIMEZONES:65 8353 #, kde-format 8354 msgid "Africa/Tripoli" 8355 msgstr "Afrike/Tripoli" 8356 8357 #: kdecore/TIMEZONES:66 8358 #, kde-format 8359 msgid "Africa/Tunis" 8360 msgstr "Afrike/Tunis" 8361 8362 #: kdecore/TIMEZONES:67 8363 #, kde-format 8364 msgid "Africa/Windhoek" 8365 msgstr "Afrike/Windhoek" 8366 8367 #: kdecore/TIMEZONES:68 8368 #, kde-format 8369 msgid "America/Adak" 8370 msgstr "Amerike/Adak" 8371 8372 #. i18n: comment to the previous timezone 8373 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8374 #, kde-format 8375 msgid "Aleutian Islands" 8376 msgstr "" 8377 8378 #: kdecore/TIMEZONES:71 8379 #, kde-format 8380 msgid "America/Anchorage" 8381 msgstr "Amerike/Anchorage" 8382 8383 #. i18n: comment to the previous timezone 8384 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8385 #, kde-format 8386 msgid "Alaska Time" 8387 msgstr "" 8388 8389 #. i18n: comment to the previous timezone 8390 #: kdecore/TIMEZONES:75 8391 #, kde-format 8392 msgid "Alaska (most areas)" 8393 msgstr "" 8394 8395 #: kdecore/TIMEZONES:76 8396 #, kde-format 8397 msgid "America/Anguilla" 8398 msgstr "Amerike/Anguilla" 8399 8400 #: kdecore/TIMEZONES:77 8401 #, kde-format 8402 msgid "America/Antigua" 8403 msgstr "Amerike/Antigua" 8404 8405 #: kdecore/TIMEZONES:78 8406 #, kde-format 8407 msgid "America/Araguaina" 8408 msgstr "Amerike/Araguaina" 8409 8410 #. i18n: comment to the previous timezone 8411 #: kdecore/TIMEZONES:80 8412 #, kde-format 8413 msgid "Tocantins" 8414 msgstr "" 8415 8416 #: kdecore/TIMEZONES:81 8417 #, kde-format 8418 msgid "America/Argentina/Buenos_Aires" 8419 msgstr "Amerike/Årdjintene/Buenos_Aires" 8420 8421 #. i18n: comment to the previous timezone 8422 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8423 #, kde-format 8424 msgid "Buenos Aires (BA, CF)" 8425 msgstr "" 8426 8427 #: kdecore/TIMEZONES:84 8428 #, kde-format 8429 msgid "America/Argentina/Catamarca" 8430 msgstr "Amerike/Årdjintene/Catamarca" 8431 8432 #. i18n: comment to the previous timezone 8433 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8434 #, kde-format 8435 msgid "Catamarca (CT), Chubut (CH)" 8436 msgstr "" 8437 8438 #. i18n: comment to the previous timezone 8439 #: kdecore/TIMEZONES:88 8440 #, kde-format 8441 msgid "Catamarca (CT); Chubut (CH)" 8442 msgstr "" 8443 8444 #: kdecore/TIMEZONES:89 8445 #, kde-format 8446 msgid "America/Argentina/ComodRivadavia" 8447 msgstr "Amerike/Årdjintene/ComodRivadavia" 8448 8449 #: kdecore/TIMEZONES:92 8450 #, kde-format 8451 msgid "America/Argentina/Cordoba" 8452 msgstr "Amerike/Årdjintene/Córdoba" 8453 8454 #. i18n: comment to the previous timezone 8455 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8456 #, kde-format 8457 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8458 msgstr "" 8459 8460 #. i18n: comment to the previous timezone 8461 #: kdecore/TIMEZONES:96 8462 #, kde-format 8463 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8464 msgstr "" 8465 8466 #. i18n: comment to the previous timezone 8467 #: kdecore/TIMEZONES:98 8468 #, kde-format 8469 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8470 msgstr "" 8471 8472 #: kdecore/TIMEZONES:99 8473 #, kde-format 8474 msgid "America/Argentina/Jujuy" 8475 msgstr "Amerike/Årdjintene/Jujuy" 8476 8477 #. i18n: comment to the previous timezone 8478 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8479 #, kde-format 8480 msgid "Jujuy (JY)" 8481 msgstr "" 8482 8483 #: kdecore/TIMEZONES:102 8484 #, kde-format 8485 msgid "America/Argentina/La_Rioja" 8486 msgstr "Amerike/Årdjintene/La_Rioja" 8487 8488 #. i18n: comment to the previous timezone 8489 #: kdecore/TIMEZONES:104 8490 #, kde-format 8491 msgid "La Rioja (LR)" 8492 msgstr "" 8493 8494 #: kdecore/TIMEZONES:105 8495 #, kde-format 8496 msgid "America/Argentina/Mendoza" 8497 msgstr "Amerike/Årdjintene/Mendoza" 8498 8499 #. i18n: comment to the previous timezone 8500 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8501 #, kde-format 8502 msgid "Mendoza (MZ)" 8503 msgstr "" 8504 8505 #: kdecore/TIMEZONES:108 8506 #, kde-format 8507 msgid "America/Argentina/Rio_Gallegos" 8508 msgstr "Amerike/Årdjintene/Rio_Gallegos" 8509 8510 #. i18n: comment to the previous timezone 8511 #: kdecore/TIMEZONES:110 8512 #, kde-format 8513 msgid "Santa Cruz (SC)" 8514 msgstr "" 8515 8516 #: kdecore/TIMEZONES:111 8517 #, fuzzy, kde-format 8518 #| msgid "America/Argentina/San_Juan" 8519 msgid "America/Argentina/Salta" 8520 msgstr "Amerike/Årdjintene/San_Juan" 8521 8522 #. i18n: comment to the previous timezone 8523 #: kdecore/TIMEZONES:113 8524 #, kde-format 8525 msgid "(SA, LP, NQ, RN)" 8526 msgstr "" 8527 8528 #. i18n: comment to the previous timezone 8529 #: kdecore/TIMEZONES:115 8530 #, kde-format 8531 msgid "Salta (SA, LP, NQ, RN)" 8532 msgstr "" 8533 8534 #: kdecore/TIMEZONES:116 8535 #, kde-format 8536 msgid "America/Argentina/San_Juan" 8537 msgstr "Amerike/Årdjintene/San_Juan" 8538 8539 #. i18n: comment to the previous timezone 8540 #: kdecore/TIMEZONES:118 8541 #, kde-format 8542 msgid "San Juan (SJ)" 8543 msgstr "" 8544 8545 #: kdecore/TIMEZONES:119 8546 #, fuzzy, kde-format 8547 #| msgid "America/Argentina/San_Juan" 8548 msgid "America/Argentina/San_Luis" 8549 msgstr "Amerike/Årdjintene/San_Juan" 8550 8551 #. i18n: comment to the previous timezone 8552 #: kdecore/TIMEZONES:121 8553 #, kde-format 8554 msgid "San Luis (SL)" 8555 msgstr "" 8556 8557 #: kdecore/TIMEZONES:122 8558 #, kde-format 8559 msgid "America/Argentina/Tucuman" 8560 msgstr "Amerike/Årdjintene/Tucumán" 8561 8562 #. i18n: comment to the previous timezone 8563 #: kdecore/TIMEZONES:124 8564 #, kde-format 8565 msgid "Tucuman (TM)" 8566 msgstr "" 8567 8568 #: kdecore/TIMEZONES:125 8569 #, kde-format 8570 msgid "America/Argentina/Ushuaia" 8571 msgstr "Amerike/Årdjintene/Ushuaia" 8572 8573 #. i18n: comment to the previous timezone 8574 #: kdecore/TIMEZONES:127 8575 #, kde-format 8576 msgid "Tierra del Fuego (TF)" 8577 msgstr "" 8578 8579 #: kdecore/TIMEZONES:128 8580 #, kde-format 8581 msgid "America/Aruba" 8582 msgstr "Amerike/Aruba" 8583 8584 #: kdecore/TIMEZONES:129 8585 #, kde-format 8586 msgid "America/Asuncion" 8587 msgstr "Amerike/Asunción" 8588 8589 #: kdecore/TIMEZONES:130 8590 #, fuzzy, kde-format 8591 #| msgid "America/Antigua" 8592 msgid "America/Atikokan" 8593 msgstr "Amerike/Antigua" 8594 8595 #. i18n: comment to the previous timezone 8596 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8597 #, kde-format 8598 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8599 msgstr "" 8600 8601 #. i18n: comment to the previous timezone 8602 #: kdecore/TIMEZONES:134 8603 #, kde-format 8604 msgid "EST - ON (Atikokan); NU (Coral H)" 8605 msgstr "" 8606 8607 #: kdecore/TIMEZONES:135 8608 #, fuzzy, kde-format 8609 #| msgid "America/Antigua" 8610 msgid "America/Atka" 8611 msgstr "Amerike/Antigua" 8612 8613 #: kdecore/TIMEZONES:138 8614 #, kde-format 8615 msgid "America/Bahia" 8616 msgstr "Amerike/Bahía" 8617 8618 #. i18n: comment to the previous timezone 8619 #: kdecore/TIMEZONES:140 8620 #, kde-format 8621 msgid "Bahia" 8622 msgstr "" 8623 8624 #: kdecore/TIMEZONES:141 8625 #, fuzzy, kde-format 8626 #| msgid "America/Bahia" 8627 msgid "America/Bahia_Banderas" 8628 msgstr "Amerike/Bahía" 8629 8630 #. i18n: comment to the previous timezone 8631 #: kdecore/TIMEZONES:143 8632 #, kde-format 8633 msgid "Mexican Central Time - Bahia de Banderas" 8634 msgstr "" 8635 8636 #. i18n: comment to the previous timezone 8637 #: kdecore/TIMEZONES:145 8638 #, kde-format 8639 msgid "Central Time - Bahia de Banderas" 8640 msgstr "" 8641 8642 #: kdecore/TIMEZONES:146 8643 #, kde-format 8644 msgid "America/Barbados" 8645 msgstr "Amerike/Barbados" 8646 8647 #: kdecore/TIMEZONES:147 8648 #, kde-format 8649 msgid "America/Belem" 8650 msgstr "Amerike/Belem" 8651 8652 #. i18n: comment to the previous timezone 8653 #: kdecore/TIMEZONES:149 8654 #, kde-format 8655 msgid "Amapa, E Para" 8656 msgstr "" 8657 8658 #. i18n: comment to the previous timezone 8659 #: kdecore/TIMEZONES:151 8660 #, kde-format 8661 msgid "Para (east); Amapa" 8662 msgstr "" 8663 8664 #: kdecore/TIMEZONES:152 8665 #, kde-format 8666 msgid "America/Belize" 8667 msgstr "Amerike/Belize" 8668 8669 #: kdecore/TIMEZONES:153 8670 #, fuzzy, kde-format 8671 #| msgid "America/Cancun" 8672 msgid "America/Blanc-Sablon" 8673 msgstr "Amerike/Cancún" 8674 8675 #. i18n: comment to the previous timezone 8676 #: kdecore/TIMEZONES:155 8677 #, kde-format 8678 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 8679 msgstr "" 8680 8681 #. i18n: comment to the previous timezone 8682 #: kdecore/TIMEZONES:157 8683 #, kde-format 8684 msgid "AST - QC (Lower North Shore)" 8685 msgstr "" 8686 8687 #: kdecore/TIMEZONES:158 8688 #, kde-format 8689 msgid "America/Boa_Vista" 8690 msgstr "Amerike/Boa_Vista" 8691 8692 #. i18n: comment to the previous timezone 8693 #: kdecore/TIMEZONES:160 8694 #, kde-format 8695 msgid "Roraima" 8696 msgstr "" 8697 8698 #: kdecore/TIMEZONES:161 8699 #, kde-format 8700 msgid "America/Bogota" 8701 msgstr "Amerike/Bogotá" 8702 8703 #: kdecore/TIMEZONES:162 8704 #, kde-format 8705 msgid "America/Boise" 8706 msgstr "Amerike/Boise" 8707 8708 #. i18n: comment to the previous timezone 8709 #: kdecore/TIMEZONES:164 8710 #, kde-format 8711 msgid "Mountain Time - south Idaho & east Oregon" 8712 msgstr "" 8713 8714 #. i18n: comment to the previous timezone 8715 #: kdecore/TIMEZONES:166 8716 #, kde-format 8717 msgid "Mountain - ID (south); OR (east)" 8718 msgstr "" 8719 8720 #: kdecore/TIMEZONES:167 8721 #, kde-format 8722 msgid "America/Buenos_Aires" 8723 msgstr "Amerike/Buenos_Aires" 8724 8725 #: kdecore/TIMEZONES:170 8726 #, fuzzy, kde-format 8727 #| msgid "America/Cayman" 8728 msgid "America/Calgary" 8729 msgstr "Amerike/Caimán" 8730 8731 #. i18n: comment to the previous timezone 8732 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 8733 #, kde-format 8734 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 8735 msgstr "" 8736 8737 #: kdecore/TIMEZONES:173 8738 #, kde-format 8739 msgid "America/Cambridge_Bay" 8740 msgstr "Amerike/Cambridge_Bay" 8741 8742 #. i18n: comment to the previous timezone 8743 #: kdecore/TIMEZONES:175 8744 #, kde-format 8745 msgid "Mountain Time - west Nunavut" 8746 msgstr "" 8747 8748 #. i18n: comment to the previous timezone 8749 #: kdecore/TIMEZONES:177 8750 #, kde-format 8751 msgid "Mountain - NU (west)" 8752 msgstr "" 8753 8754 #: kdecore/TIMEZONES:178 8755 #, kde-format 8756 msgid "America/Campo_Grande" 8757 msgstr "Amerike/Campo_Grande" 8758 8759 #. i18n: comment to the previous timezone 8760 #: kdecore/TIMEZONES:180 8761 #, kde-format 8762 msgid "Mato Grosso do Sul" 8763 msgstr "" 8764 8765 #: kdecore/TIMEZONES:181 8766 #, kde-format 8767 msgid "America/Cancun" 8768 msgstr "Amerike/Cancún" 8769 8770 #. i18n: comment to the previous timezone 8771 #: kdecore/TIMEZONES:183 8772 #, kde-format 8773 msgid "Central Time - Quintana Roo" 8774 msgstr "" 8775 8776 #. i18n: comment to the previous timezone 8777 #: kdecore/TIMEZONES:185 8778 #, kde-format 8779 msgid "Eastern Standard Time - Quintana Roo" 8780 msgstr "" 8781 8782 #: kdecore/TIMEZONES:186 8783 #, kde-format 8784 msgid "America/Caracas" 8785 msgstr "Amerike/Caracas" 8786 8787 #: kdecore/TIMEZONES:187 8788 #, kde-format 8789 msgid "America/Catamarca" 8790 msgstr "Amerike/Catamarca" 8791 8792 #: kdecore/TIMEZONES:190 8793 #, kde-format 8794 msgid "America/Cayenne" 8795 msgstr "Amerike/Cayenne" 8796 8797 #: kdecore/TIMEZONES:191 8798 #, kde-format 8799 msgid "America/Cayman" 8800 msgstr "Amerike/Caimán" 8801 8802 #: kdecore/TIMEZONES:192 8803 #, kde-format 8804 msgid "America/Chicago" 8805 msgstr "Amerike/Chicago" 8806 8807 #. i18n: comment to the previous timezone 8808 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 8809 #, kde-format 8810 msgid "Central Time" 8811 msgstr "" 8812 8813 #. i18n: comment to the previous timezone 8814 #: kdecore/TIMEZONES:196 8815 #, kde-format 8816 msgid "Central (most areas)" 8817 msgstr "" 8818 8819 #: kdecore/TIMEZONES:197 8820 #, kde-format 8821 msgid "America/Chihuahua" 8822 msgstr "Amerike/Chihuahua" 8823 8824 #. i18n: comment to the previous timezone 8825 #: kdecore/TIMEZONES:199 8826 #, kde-format 8827 msgid "Mountain Time - Chihuahua" 8828 msgstr "" 8829 8830 #. i18n: comment to the previous timezone 8831 #: kdecore/TIMEZONES:201 8832 #, kde-format 8833 msgid "Mexican Mountain Time - Chihuahua away from US border" 8834 msgstr "" 8835 8836 #. i18n: comment to the previous timezone 8837 #: kdecore/TIMEZONES:203 8838 #, kde-format 8839 msgid "Mountain Time - Chihuahua (most areas)" 8840 msgstr "" 8841 8842 #: kdecore/TIMEZONES:204 8843 #, fuzzy, kde-format 8844 #| msgid "America/Curacao" 8845 msgid "America/Coral_Harbour" 8846 msgstr "Amerike/Curaçao" 8847 8848 #: kdecore/TIMEZONES:207 8849 #, kde-format 8850 msgid "America/Cordoba" 8851 msgstr "Amerike/Córdoba" 8852 8853 #: kdecore/TIMEZONES:210 8854 #, kde-format 8855 msgid "America/Costa_Rica" 8856 msgstr "Amerike/Costa_Rica" 8857 8858 #: kdecore/TIMEZONES:211 8859 #, fuzzy, kde-format 8860 #| msgid "Africa/Freetown" 8861 msgid "America/Creston" 8862 msgstr "Afrike/Freetown" 8863 8864 #. i18n: comment to the previous timezone 8865 #: kdecore/TIMEZONES:213 8866 #, kde-format 8867 msgid "Mountain Standard Time - Creston, British Columbia" 8868 msgstr "" 8869 8870 #. i18n: comment to the previous timezone 8871 #: kdecore/TIMEZONES:215 8872 #, kde-format 8873 msgid "MST - BC (Creston)" 8874 msgstr "" 8875 8876 #: kdecore/TIMEZONES:216 8877 #, kde-format 8878 msgid "America/Cuiaba" 8879 msgstr "Amerike/Cuiaba" 8880 8881 #. i18n: comment to the previous timezone 8882 #: kdecore/TIMEZONES:218 8883 #, kde-format 8884 msgid "Mato Grosso" 8885 msgstr "" 8886 8887 #: kdecore/TIMEZONES:219 8888 #, kde-format 8889 msgid "America/Curacao" 8890 msgstr "Amerike/Curaçao" 8891 8892 #: kdecore/TIMEZONES:220 8893 #, kde-format 8894 msgid "America/Danmarkshavn" 8895 msgstr "Amerike/Danmarkshavn" 8896 8897 #. i18n: comment to the previous timezone 8898 #: kdecore/TIMEZONES:222 8899 #, kde-format 8900 msgid "east coast, north of Scoresbysund" 8901 msgstr "" 8902 8903 #. i18n: comment to the previous timezone 8904 #: kdecore/TIMEZONES:224 8905 #, kde-format 8906 msgid "National Park (east coast)" 8907 msgstr "" 8908 8909 #: kdecore/TIMEZONES:225 8910 #, kde-format 8911 msgid "America/Dawson" 8912 msgstr "Amerike/Dawson" 8913 8914 #. i18n: comment to the previous timezone 8915 #: kdecore/TIMEZONES:227 8916 #, kde-format 8917 msgid "Pacific Time - north Yukon" 8918 msgstr "" 8919 8920 #. i18n: comment to the previous timezone 8921 #: kdecore/TIMEZONES:229 8922 #, kde-format 8923 msgid "MST - Yukon (west)" 8924 msgstr "" 8925 8926 #: kdecore/TIMEZONES:230 8927 #, kde-format 8928 msgid "America/Dawson_Creek" 8929 msgstr "Amerike/Dawson_Creek" 8930 8931 #. i18n: comment to the previous timezone 8932 #: kdecore/TIMEZONES:232 8933 #, kde-format 8934 msgid "" 8935 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 8936 msgstr "" 8937 8938 #. i18n: comment to the previous timezone 8939 #: kdecore/TIMEZONES:234 8940 #, kde-format 8941 msgid "MST - BC (Dawson Cr, Ft St John)" 8942 msgstr "" 8943 8944 #: kdecore/TIMEZONES:235 8945 #, kde-format 8946 msgid "America/Denver" 8947 msgstr "Amerike/Denver" 8948 8949 #. i18n: comment to the previous timezone 8950 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 8951 #, kde-format 8952 msgid "Mountain Time" 8953 msgstr "" 8954 8955 #. i18n: comment to the previous timezone 8956 #: kdecore/TIMEZONES:239 8957 #, kde-format 8958 msgid "Mountain (most areas)" 8959 msgstr "" 8960 8961 #: kdecore/TIMEZONES:240 8962 #, kde-format 8963 msgid "America/Detroit" 8964 msgstr "Amerike/Detroit" 8965 8966 #. i18n: comment to the previous timezone 8967 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 8968 #, kde-format 8969 msgid "Eastern Time - Michigan - most locations" 8970 msgstr "" 8971 8972 #. i18n: comment to the previous timezone 8973 #: kdecore/TIMEZONES:244 8974 #, kde-format 8975 msgid "Eastern - MI (most areas)" 8976 msgstr "" 8977 8978 #: kdecore/TIMEZONES:245 8979 #, kde-format 8980 msgid "America/Dominica" 8981 msgstr "Amerike/Dominica" 8982 8983 #: kdecore/TIMEZONES:246 8984 #, kde-format 8985 msgid "America/Edmonton" 8986 msgstr "Amerike/Edmonton" 8987 8988 #. i18n: comment to the previous timezone 8989 #: kdecore/TIMEZONES:250 8990 #, kde-format 8991 msgid "Mountain - AB; BC (E); SK (W)" 8992 msgstr "" 8993 8994 #: kdecore/TIMEZONES:251 8995 #, kde-format 8996 msgid "America/Eirunepe" 8997 msgstr "Amerike/Eirunepe" 8998 8999 #. i18n: comment to the previous timezone 9000 #: kdecore/TIMEZONES:253 9001 #, kde-format 9002 msgid "W Amazonas" 9003 msgstr "" 9004 9005 #. i18n: comment to the previous timezone 9006 #: kdecore/TIMEZONES:255 9007 #, kde-format 9008 msgid "Amazonas (west)" 9009 msgstr "" 9010 9011 #: kdecore/TIMEZONES:256 9012 #, kde-format 9013 msgid "America/El_Salvador" 9014 msgstr "Amerike/El_Salvador" 9015 9016 #: kdecore/TIMEZONES:257 9017 #, fuzzy, kde-format 9018 #| msgid "America/Grenada" 9019 msgid "America/Ensenada" 9020 msgstr "Amerike/Granada" 9021 9022 #. i18n: comment to the previous timezone 9023 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9024 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9025 #, fuzzy, kde-format 9026 #| msgid "Pacific/Niue" 9027 msgid "Pacific Time" 9028 msgstr "Oceyan Pacifike/Niue" 9029 9030 #: kdecore/TIMEZONES:260 9031 #, fuzzy, kde-format 9032 #| msgid "America/Porto_Velho" 9033 msgid "America/Fort_Nelson" 9034 msgstr "Amerike/Porto_Velho" 9035 9036 #. i18n: comment to the previous timezone 9037 #: kdecore/TIMEZONES:262 9038 #, kde-format 9039 msgid "MST - BC (Ft Nelson)" 9040 msgstr "" 9041 9042 #: kdecore/TIMEZONES:263 9043 #, fuzzy, kde-format 9044 #| msgid "America/Fortaleza" 9045 msgid "America/Fort_Wayne" 9046 msgstr "Amerike/Fortaleza" 9047 9048 #. i18n: comment to the previous timezone 9049 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9050 #: kdecore/TIMEZONES:1419 9051 #, kde-format 9052 msgid "Eastern Time - Indiana - most locations" 9053 msgstr "" 9054 9055 #: kdecore/TIMEZONES:266 9056 #, kde-format 9057 msgid "America/Fortaleza" 9058 msgstr "Amerike/Fortaleza" 9059 9060 #. i18n: comment to the previous timezone 9061 #: kdecore/TIMEZONES:268 9062 #, kde-format 9063 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9064 msgstr "" 9065 9066 #. i18n: comment to the previous timezone 9067 #: kdecore/TIMEZONES:270 9068 #, kde-format 9069 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9070 msgstr "" 9071 9072 #: kdecore/TIMEZONES:271 9073 #, fuzzy, kde-format 9074 #| msgid "Africa/Freetown" 9075 msgid "America/Fredericton" 9076 msgstr "Afrike/Freetown" 9077 9078 #. i18n: comment to the previous timezone 9079 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9080 #, kde-format 9081 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9082 msgstr "" 9083 9084 #: kdecore/TIMEZONES:274 9085 #, kde-format 9086 msgid "America/Glace_Bay" 9087 msgstr "Amerike/Glace_Bay" 9088 9089 #. i18n: comment to the previous timezone 9090 #: kdecore/TIMEZONES:276 9091 #, kde-format 9092 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9093 msgstr "" 9094 9095 #. i18n: comment to the previous timezone 9096 #: kdecore/TIMEZONES:278 9097 #, fuzzy, kde-format 9098 #| msgid "Atlantic/Cape_Verde" 9099 msgid "Atlantic - NS (Cape Breton)" 9100 msgstr "Oceyan Atlantike/Cape_Verde" 9101 9102 #: kdecore/TIMEZONES:279 9103 #, kde-format 9104 msgid "America/Godthab" 9105 msgstr "Amerike/Godthab" 9106 9107 #. i18n: comment to the previous timezone 9108 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9109 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9110 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9111 #: kdecore/TIMEZONES:1350 9112 #, kde-format 9113 msgid "most locations" 9114 msgstr "" 9115 9116 #: kdecore/TIMEZONES:282 9117 #, kde-format 9118 msgid "America/Goose_Bay" 9119 msgstr "Amerike/Goose_Bay" 9120 9121 #. i18n: comment to the previous timezone 9122 #: kdecore/TIMEZONES:284 9123 #, kde-format 9124 msgid "Atlantic Time - Labrador - most locations" 9125 msgstr "" 9126 9127 #. i18n: comment to the previous timezone 9128 #: kdecore/TIMEZONES:286 9129 #, kde-format 9130 msgid "Atlantic - Labrador (most areas)" 9131 msgstr "" 9132 9133 #: kdecore/TIMEZONES:287 9134 #, kde-format 9135 msgid "America/Grand_Turk" 9136 msgstr "Amerike/Grand_Turk" 9137 9138 #: kdecore/TIMEZONES:288 9139 #, kde-format 9140 msgid "America/Grenada" 9141 msgstr "Amerike/Granada" 9142 9143 #: kdecore/TIMEZONES:289 9144 #, kde-format 9145 msgid "America/Guadeloupe" 9146 msgstr "Amerike/Guadeloupe" 9147 9148 #: kdecore/TIMEZONES:290 9149 #, kde-format 9150 msgid "America/Guatemala" 9151 msgstr "Amerike/Guatemala" 9152 9153 #: kdecore/TIMEZONES:291 9154 #, kde-format 9155 msgid "America/Guayaquil" 9156 msgstr "Amerike/Guayaquil" 9157 9158 #. i18n: comment to the previous timezone 9159 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9160 #: kdecore/TIMEZONES:1400 9161 #, kde-format 9162 msgid "mainland" 9163 msgstr "" 9164 9165 #. i18n: comment to the previous timezone 9166 #: kdecore/TIMEZONES:295 9167 #, kde-format 9168 msgid "Ecuador (mainland)" 9169 msgstr "" 9170 9171 #: kdecore/TIMEZONES:296 9172 #, kde-format 9173 msgid "America/Guyana" 9174 msgstr "Amerike/Guayana" 9175 9176 #: kdecore/TIMEZONES:297 9177 #, kde-format 9178 msgid "America/Halifax" 9179 msgstr "Amerike/Halifax" 9180 9181 #. i18n: comment to the previous timezone 9182 #: kdecore/TIMEZONES:301 9183 #, kde-format 9184 msgid "Atlantic - NS (most areas); PE" 9185 msgstr "" 9186 9187 #: kdecore/TIMEZONES:302 9188 #, kde-format 9189 msgid "America/Havana" 9190 msgstr "Amerike/La_Habana" 9191 9192 #: kdecore/TIMEZONES:303 9193 #, kde-format 9194 msgid "America/Hermosillo" 9195 msgstr "Amerike/Hermosillo" 9196 9197 #. i18n: comment to the previous timezone 9198 #: kdecore/TIMEZONES:305 9199 #, kde-format 9200 msgid "Mountain Standard Time - Sonora" 9201 msgstr "" 9202 9203 #: kdecore/TIMEZONES:306 9204 #, fuzzy, kde-format 9205 #| msgid "America/Indianapolis" 9206 msgid "America/Indiana/Indianapolis" 9207 msgstr "Amerike/Indianapolis" 9208 9209 #. i18n: comment to the previous timezone 9210 #: kdecore/TIMEZONES:310 9211 #, kde-format 9212 msgid "Eastern - IN (most areas)" 9213 msgstr "" 9214 9215 #: kdecore/TIMEZONES:311 9216 #, kde-format 9217 msgid "America/Indiana/Knox" 9218 msgstr "Amerike/Indiana/Knox" 9219 9220 #. i18n: comment to the previous timezone 9221 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9222 #, kde-format 9223 msgid "Eastern Time - Indiana - Starke County" 9224 msgstr "" 9225 9226 #. i18n: comment to the previous timezone 9227 #: kdecore/TIMEZONES:315 9228 #, kde-format 9229 msgid "Central Time - Indiana - Starke County" 9230 msgstr "" 9231 9232 #. i18n: comment to the previous timezone 9233 #: kdecore/TIMEZONES:317 9234 #, kde-format 9235 msgid "Central - IN (Starke)" 9236 msgstr "" 9237 9238 #: kdecore/TIMEZONES:318 9239 #, kde-format 9240 msgid "America/Indiana/Marengo" 9241 msgstr "Amerike/Indiana/Marengo" 9242 9243 #. i18n: comment to the previous timezone 9244 #: kdecore/TIMEZONES:320 9245 #, kde-format 9246 msgid "Eastern Time - Indiana - Crawford County" 9247 msgstr "" 9248 9249 #. i18n: comment to the previous timezone 9250 #: kdecore/TIMEZONES:322 9251 #, kde-format 9252 msgid "Eastern - IN (Crawford)" 9253 msgstr "" 9254 9255 #: kdecore/TIMEZONES:323 9256 #, fuzzy, kde-format 9257 #| msgid "America/Indiana/Marengo" 9258 msgid "America/Indiana/Petersburg" 9259 msgstr "Amerike/Indiana/Marengo" 9260 9261 #. i18n: comment to the previous timezone 9262 #: kdecore/TIMEZONES:325 9263 #, kde-format 9264 msgid "Central Time - Indiana - Pike County" 9265 msgstr "" 9266 9267 #. i18n: comment to the previous timezone 9268 #: kdecore/TIMEZONES:327 9269 #, kde-format 9270 msgid "Eastern Time - Indiana - Pike County" 9271 msgstr "" 9272 9273 #. i18n: comment to the previous timezone 9274 #: kdecore/TIMEZONES:329 9275 #, kde-format 9276 msgid "Eastern - IN (Pike)" 9277 msgstr "" 9278 9279 #: kdecore/TIMEZONES:330 9280 #, fuzzy, kde-format 9281 #| msgid "America/Indiana/Vevay" 9282 msgid "America/Indiana/Tell_City" 9283 msgstr "Amerike/Indiana/Vevay" 9284 9285 #. i18n: comment to the previous timezone 9286 #: kdecore/TIMEZONES:332 9287 #, kde-format 9288 msgid "Central Time - Indiana - Perry County" 9289 msgstr "" 9290 9291 #. i18n: comment to the previous timezone 9292 #: kdecore/TIMEZONES:334 9293 #, kde-format 9294 msgid "Central - IN (Perry)" 9295 msgstr "" 9296 9297 #: kdecore/TIMEZONES:335 9298 #, kde-format 9299 msgid "America/Indiana/Vevay" 9300 msgstr "Amerike/Indiana/Vevay" 9301 9302 #. i18n: comment to the previous timezone 9303 #: kdecore/TIMEZONES:337 9304 #, kde-format 9305 msgid "Eastern Time - Indiana - Switzerland County" 9306 msgstr "" 9307 9308 #. i18n: comment to the previous timezone 9309 #: kdecore/TIMEZONES:339 9310 #, kde-format 9311 msgid "Eastern - IN (Switzerland)" 9312 msgstr "" 9313 9314 #: kdecore/TIMEZONES:340 9315 #, fuzzy, kde-format 9316 #| msgid "America/Indiana/Vevay" 9317 msgid "America/Indiana/Vincennes" 9318 msgstr "Amerike/Indiana/Vevay" 9319 9320 #. i18n: comment to the previous timezone 9321 #: kdecore/TIMEZONES:342 9322 #, kde-format 9323 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9324 msgstr "" 9325 9326 #. i18n: comment to the previous timezone 9327 #: kdecore/TIMEZONES:344 9328 #, kde-format 9329 msgid "Eastern - IN (Da, Du, K, Mn)" 9330 msgstr "" 9331 9332 #: kdecore/TIMEZONES:345 9333 #, fuzzy, kde-format 9334 #| msgid "America/Indiana/Knox" 9335 msgid "America/Indiana/Winamac" 9336 msgstr "Amerike/Indiana/Knox" 9337 9338 #. i18n: comment to the previous timezone 9339 #: kdecore/TIMEZONES:347 9340 #, kde-format 9341 msgid "Eastern Time - Indiana - Pulaski County" 9342 msgstr "" 9343 9344 #. i18n: comment to the previous timezone 9345 #: kdecore/TIMEZONES:349 9346 #, kde-format 9347 msgid "Eastern - IN (Pulaski)" 9348 msgstr "" 9349 9350 #: kdecore/TIMEZONES:350 9351 #, kde-format 9352 msgid "America/Indianapolis" 9353 msgstr "Amerike/Indianapolis" 9354 9355 #: kdecore/TIMEZONES:353 9356 #, kde-format 9357 msgid "America/Inuvik" 9358 msgstr "Amerike/Inuvik" 9359 9360 #. i18n: comment to the previous timezone 9361 #: kdecore/TIMEZONES:355 9362 #, kde-format 9363 msgid "Mountain Time - west Northwest Territories" 9364 msgstr "" 9365 9366 #. i18n: comment to the previous timezone 9367 #: kdecore/TIMEZONES:357 9368 #, kde-format 9369 msgid "Mountain - NT (west)" 9370 msgstr "" 9371 9372 #: kdecore/TIMEZONES:358 9373 #, kde-format 9374 msgid "America/Iqaluit" 9375 msgstr "Amerike/Iqaluit" 9376 9377 #. i18n: comment to the previous timezone 9378 #: kdecore/TIMEZONES:360 9379 #, kde-format 9380 msgid "Eastern Time - east Nunavut - most locations" 9381 msgstr "" 9382 9383 #. i18n: comment to the previous timezone 9384 #: kdecore/TIMEZONES:362 9385 #, kde-format 9386 msgid "Eastern - NU (most east areas)" 9387 msgstr "" 9388 9389 #: kdecore/TIMEZONES:363 9390 #, kde-format 9391 msgid "America/Jamaica" 9392 msgstr "Amerike/Jamaica" 9393 9394 #: kdecore/TIMEZONES:364 9395 #, kde-format 9396 msgid "America/Jujuy" 9397 msgstr "Amerike/Jujuy" 9398 9399 #: kdecore/TIMEZONES:367 9400 #, kde-format 9401 msgid "America/Juneau" 9402 msgstr "Amerike/Juneau" 9403 9404 #. i18n: comment to the previous timezone 9405 #: kdecore/TIMEZONES:369 9406 #, kde-format 9407 msgid "Alaska Time - Alaska panhandle" 9408 msgstr "" 9409 9410 #. i18n: comment to the previous timezone 9411 #: kdecore/TIMEZONES:371 9412 #, kde-format 9413 msgid "Alaska - Juneau area" 9414 msgstr "" 9415 9416 #: kdecore/TIMEZONES:372 9417 #, fuzzy, kde-format 9418 #| msgid "America/Louisville" 9419 msgid "America/Kentucky/Louisville" 9420 msgstr "Amerike/Louisville" 9421 9422 #. i18n: comment to the previous timezone 9423 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9424 #, fuzzy, kde-format 9425 #| msgid "America/Louisville" 9426 msgid "Eastern Time - Kentucky - Louisville area" 9427 msgstr "Amerike/Louisville" 9428 9429 #. i18n: comment to the previous timezone 9430 #: kdecore/TIMEZONES:376 9431 #, fuzzy, kde-format 9432 #| msgid "America/Louisville" 9433 msgid "Eastern - KY (Louisville area)" 9434 msgstr "Amerike/Louisville" 9435 9436 #: kdecore/TIMEZONES:377 9437 #, kde-format 9438 msgid "America/Kentucky/Monticello" 9439 msgstr "Amerike/Kentucky/Monticello" 9440 9441 #. i18n: comment to the previous timezone 9442 #: kdecore/TIMEZONES:379 9443 #, kde-format 9444 msgid "Eastern Time - Kentucky - Wayne County" 9445 msgstr "" 9446 9447 #. i18n: comment to the previous timezone 9448 #: kdecore/TIMEZONES:381 9449 #, kde-format 9450 msgid "Eastern - KY (Wayne)" 9451 msgstr "" 9452 9453 #: kdecore/TIMEZONES:382 9454 #, fuzzy, kde-format 9455 #| msgid "America/Indiana/Knox" 9456 msgid "America/Knox_IN" 9457 msgstr "Amerike/Indiana/Knox" 9458 9459 #: kdecore/TIMEZONES:385 9460 #, fuzzy, kde-format 9461 #| msgid "America/Grenada" 9462 msgid "America/Kralendijk" 9463 msgstr "Amerike/Granada" 9464 9465 #: kdecore/TIMEZONES:386 9466 #, kde-format 9467 msgid "America/La_Paz" 9468 msgstr "Amerike/La_Paz" 9469 9470 #: kdecore/TIMEZONES:387 9471 #, kde-format 9472 msgid "America/Lima" 9473 msgstr "Amerike/Lima" 9474 9475 #: kdecore/TIMEZONES:388 9476 #, kde-format 9477 msgid "America/Los_Angeles" 9478 msgstr "Amerike/Los_Angeles" 9479 9480 #. i18n: comment to the previous timezone 9481 #: kdecore/TIMEZONES:392 9482 #, fuzzy, kde-format 9483 #| msgid "Pacific/Yap" 9484 msgid "Pacific" 9485 msgstr "Oceyan Pacifike/Yap" 9486 9487 #: kdecore/TIMEZONES:393 9488 #, kde-format 9489 msgid "America/Louisville" 9490 msgstr "Amerike/Louisville" 9491 9492 #: kdecore/TIMEZONES:396 9493 #, fuzzy, kde-format 9494 #| msgid "America/Port-au-Prince" 9495 msgid "America/Lower_Princes" 9496 msgstr "Amerike/Port-au-Prince" 9497 9498 #: kdecore/TIMEZONES:397 9499 #, kde-format 9500 msgid "America/Maceio" 9501 msgstr "Amerike/Maceio" 9502 9503 #. i18n: comment to the previous timezone 9504 #: kdecore/TIMEZONES:399 9505 #, kde-format 9506 msgid "Alagoas, Sergipe" 9507 msgstr "" 9508 9509 #: kdecore/TIMEZONES:400 9510 #, kde-format 9511 msgid "America/Managua" 9512 msgstr "Amerike/Managua" 9513 9514 #: kdecore/TIMEZONES:401 9515 #, kde-format 9516 msgid "America/Manaus" 9517 msgstr "Amerike/Manaus" 9518 9519 #. i18n: comment to the previous timezone 9520 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9521 #, kde-format 9522 msgid "E Amazonas" 9523 msgstr "" 9524 9525 #. i18n: comment to the previous timezone 9526 #: kdecore/TIMEZONES:405 9527 #, kde-format 9528 msgid "Amazonas (east)" 9529 msgstr "" 9530 9531 #: kdecore/TIMEZONES:406 9532 #, fuzzy, kde-format 9533 #| msgid "America/Maceio" 9534 msgid "America/Marigot" 9535 msgstr "Amerike/Maceio" 9536 9537 #: kdecore/TIMEZONES:407 9538 #, kde-format 9539 msgid "America/Martinique" 9540 msgstr "Amerike/Martinica" 9541 9542 #: kdecore/TIMEZONES:408 9543 #, fuzzy, kde-format 9544 #| msgid "America/Manaus" 9545 msgid "America/Matamoros" 9546 msgstr "Amerike/Manaus" 9547 9548 #. i18n: comment to the previous timezone 9549 #: kdecore/TIMEZONES:410 9550 #, kde-format 9551 msgid "" 9552 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9553 msgstr "" 9554 9555 #. i18n: comment to the previous timezone 9556 #: kdecore/TIMEZONES:412 9557 #, kde-format 9558 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9559 msgstr "" 9560 9561 #: kdecore/TIMEZONES:413 9562 #, kde-format 9563 msgid "America/Mazatlan" 9564 msgstr "Amerike/Mazatlán" 9565 9566 #. i18n: comment to the previous timezone 9567 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9568 #, kde-format 9569 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9570 msgstr "" 9571 9572 #. i18n: comment to the previous timezone 9573 #: kdecore/TIMEZONES:417 9574 #, kde-format 9575 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9576 msgstr "" 9577 9578 #: kdecore/TIMEZONES:418 9579 #, kde-format 9580 msgid "America/Mendoza" 9581 msgstr "Amerike/Mendoza" 9582 9583 #: kdecore/TIMEZONES:421 9584 #, kde-format 9585 msgid "America/Menominee" 9586 msgstr "Amerike/Menominee" 9587 9588 #. i18n: comment to the previous timezone 9589 #: kdecore/TIMEZONES:423 9590 #, kde-format 9591 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9592 msgstr "" 9593 9594 #. i18n: comment to the previous timezone 9595 #: kdecore/TIMEZONES:425 9596 #, kde-format 9597 msgid "Central - MI (Wisconsin border)" 9598 msgstr "" 9599 9600 #: kdecore/TIMEZONES:426 9601 #, kde-format 9602 msgid "America/Merida" 9603 msgstr "Amerike/Mérida" 9604 9605 #. i18n: comment to the previous timezone 9606 #: kdecore/TIMEZONES:428 9607 #, kde-format 9608 msgid "Central Time - Campeche, Yucatan" 9609 msgstr "" 9610 9611 #: kdecore/TIMEZONES:429 9612 #, fuzzy, kde-format 9613 #| msgid "America/Mazatlan" 9614 msgid "America/Metlakatla" 9615 msgstr "Amerike/Mazatlán" 9616 9617 #. i18n: comment to the previous timezone 9618 #: kdecore/TIMEZONES:431 9619 #, kde-format 9620 msgid "Metlakatla Time - Annette Island" 9621 msgstr "" 9622 9623 #. i18n: comment to the previous timezone 9624 #: kdecore/TIMEZONES:433 9625 #, kde-format 9626 msgid "Alaska - Annette Island" 9627 msgstr "" 9628 9629 #: kdecore/TIMEZONES:434 9630 #, kde-format 9631 msgid "America/Mexico_City" 9632 msgstr "Amerike/Ciudad_de_México" 9633 9634 #. i18n: comment to the previous timezone 9635 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9636 #, kde-format 9637 msgid "Central Time - most locations" 9638 msgstr "" 9639 9640 #: kdecore/TIMEZONES:439 9641 #, kde-format 9642 msgid "America/Miquelon" 9643 msgstr "Amerike/Miquelon" 9644 9645 #: kdecore/TIMEZONES:440 9646 #, fuzzy, kde-format 9647 #| msgid "America/Edmonton" 9648 msgid "America/Moncton" 9649 msgstr "Amerike/Edmonton" 9650 9651 #. i18n: comment to the previous timezone 9652 #: kdecore/TIMEZONES:442 9653 #, kde-format 9654 msgid "Atlantic Time - New Brunswick" 9655 msgstr "" 9656 9657 #. i18n: comment to the previous timezone 9658 #: kdecore/TIMEZONES:444 9659 #, kde-format 9660 msgid "Atlantic - New Brunswick" 9661 msgstr "" 9662 9663 #: kdecore/TIMEZONES:445 9664 #, kde-format 9665 msgid "America/Monterrey" 9666 msgstr "Amerike/Monterrey" 9667 9668 #. i18n: comment to the previous timezone 9669 #: kdecore/TIMEZONES:447 9670 #, kde-format 9671 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 9672 msgstr "" 9673 9674 #. i18n: comment to the previous timezone 9675 #: kdecore/TIMEZONES:449 9676 #, kde-format 9677 msgid "" 9678 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 9679 "US border" 9680 msgstr "" 9681 9682 #. i18n: comment to the previous timezone 9683 #: kdecore/TIMEZONES:451 9684 #, kde-format 9685 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 9686 msgstr "" 9687 9688 #: kdecore/TIMEZONES:452 9689 #, kde-format 9690 msgid "America/Montevideo" 9691 msgstr "Amerike/Montevideo" 9692 9693 #: kdecore/TIMEZONES:453 9694 #, kde-format 9695 msgid "America/Montreal" 9696 msgstr "Amerike/Montreal" 9697 9698 #. i18n: comment to the previous timezone 9699 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 9700 #, kde-format 9701 msgid "Eastern Time - Quebec - most locations" 9702 msgstr "" 9703 9704 #: kdecore/TIMEZONES:456 9705 #, kde-format 9706 msgid "America/Montserrat" 9707 msgstr "Amerike/Montserrat" 9708 9709 #: kdecore/TIMEZONES:457 9710 #, kde-format 9711 msgid "America/Nassau" 9712 msgstr "Amerike/Nassau" 9713 9714 #: kdecore/TIMEZONES:458 9715 #, kde-format 9716 msgid "America/New_York" 9717 msgstr "Amerike/Noû_York" 9718 9719 #. i18n: comment to the previous timezone 9720 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 9721 #, kde-format 9722 msgid "Eastern Time" 9723 msgstr "" 9724 9725 #. i18n: comment to the previous timezone 9726 #: kdecore/TIMEZONES:462 9727 #, kde-format 9728 msgid "Eastern (most areas)" 9729 msgstr "" 9730 9731 #: kdecore/TIMEZONES:463 9732 #, kde-format 9733 msgid "America/Nipigon" 9734 msgstr "Amerike/Nipigon" 9735 9736 #. i18n: comment to the previous timezone 9737 #: kdecore/TIMEZONES:465 9738 #, kde-format 9739 msgid "" 9740 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 9741 msgstr "" 9742 9743 #. i18n: comment to the previous timezone 9744 #: kdecore/TIMEZONES:467 9745 #, kde-format 9746 msgid "Eastern - ON, QC (no DST 1967-73)" 9747 msgstr "" 9748 9749 #: kdecore/TIMEZONES:468 9750 #, kde-format 9751 msgid "America/Nome" 9752 msgstr "Amerike/Nome" 9753 9754 #. i18n: comment to the previous timezone 9755 #: kdecore/TIMEZONES:470 9756 #, kde-format 9757 msgid "Alaska Time - west Alaska" 9758 msgstr "" 9759 9760 #. i18n: comment to the previous timezone 9761 #: kdecore/TIMEZONES:472 9762 #, kde-format 9763 msgid "Alaska (west)" 9764 msgstr "" 9765 9766 #: kdecore/TIMEZONES:473 9767 #, kde-format 9768 msgid "America/Noronha" 9769 msgstr "Amerike/Noronha" 9770 9771 #. i18n: comment to the previous timezone 9772 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 9773 #, fuzzy, kde-format 9774 #| msgid "Atlantic/Canary" 9775 msgid "Atlantic islands" 9776 msgstr "Oceyan Atlantike/Canary" 9777 9778 #: kdecore/TIMEZONES:476 9779 #, fuzzy, kde-format 9780 #| msgid "America/North_Dakota/Center" 9781 msgid "America/North_Dakota/Beulah" 9782 msgstr "Amerike/Dakota_bijhrece/Center" 9783 9784 #. i18n: comment to the previous timezone 9785 #: kdecore/TIMEZONES:478 9786 #, kde-format 9787 msgid "Central Time - North Dakota - Mercer County" 9788 msgstr "" 9789 9790 #. i18n: comment to the previous timezone 9791 #: kdecore/TIMEZONES:480 9792 #, kde-format 9793 msgid "Central - ND (Mercer)" 9794 msgstr "" 9795 9796 #: kdecore/TIMEZONES:481 9797 #, kde-format 9798 msgid "America/North_Dakota/Center" 9799 msgstr "Amerike/Dakota_bijhrece/Center" 9800 9801 #. i18n: comment to the previous timezone 9802 #: kdecore/TIMEZONES:483 9803 #, kde-format 9804 msgid "Central Time - North Dakota - Oliver County" 9805 msgstr "" 9806 9807 #. i18n: comment to the previous timezone 9808 #: kdecore/TIMEZONES:485 9809 #, kde-format 9810 msgid "Central - ND (Oliver)" 9811 msgstr "" 9812 9813 #: kdecore/TIMEZONES:486 9814 #, fuzzy, kde-format 9815 #| msgid "America/North_Dakota/Center" 9816 msgid "America/North_Dakota/New_Salem" 9817 msgstr "Amerike/Dakota_bijhrece/Center" 9818 9819 #. i18n: comment to the previous timezone 9820 #: kdecore/TIMEZONES:488 9821 #, kde-format 9822 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 9823 msgstr "" 9824 9825 #. i18n: comment to the previous timezone 9826 #: kdecore/TIMEZONES:490 9827 #, kde-format 9828 msgid "Central - ND (Morton rural)" 9829 msgstr "" 9830 9831 #: kdecore/TIMEZONES:491 9832 #, fuzzy, kde-format 9833 #| msgid "America/Jujuy" 9834 msgid "America/Nuuk" 9835 msgstr "Amerike/Jujuy" 9836 9837 #. i18n: comment to the previous timezone 9838 #: kdecore/TIMEZONES:493 9839 #, kde-format 9840 msgid "Greenland (most areas)" 9841 msgstr "" 9842 9843 #: kdecore/TIMEZONES:494 9844 #, fuzzy, kde-format 9845 #| msgid "America/Managua" 9846 msgid "America/Ojinaga" 9847 msgstr "Amerike/Managua" 9848 9849 #. i18n: comment to the previous timezone 9850 #: kdecore/TIMEZONES:496 9851 #, kde-format 9852 msgid "US Mountain Time - Chihuahua near US border" 9853 msgstr "" 9854 9855 #. i18n: comment to the previous timezone 9856 #: kdecore/TIMEZONES:498 9857 #, kde-format 9858 msgid "Mountain Time US - Chihuahua (US border)" 9859 msgstr "" 9860 9861 #: kdecore/TIMEZONES:499 9862 #, fuzzy, kde-format 9863 #| msgid "America/Maceio" 9864 msgid "America/Ontario" 9865 msgstr "Amerike/Maceio" 9866 9867 #: kdecore/TIMEZONES:502 9868 #, kde-format 9869 msgid "America/Panama" 9870 msgstr "Amerike/Panamá" 9871 9872 #: kdecore/TIMEZONES:503 9873 #, kde-format 9874 msgid "America/Pangnirtung" 9875 msgstr "Amerike/Pangnirtung" 9876 9877 #. i18n: comment to the previous timezone 9878 #: kdecore/TIMEZONES:505 9879 #, kde-format 9880 msgid "Eastern Time - Pangnirtung, Nunavut" 9881 msgstr "" 9882 9883 #. i18n: comment to the previous timezone 9884 #: kdecore/TIMEZONES:507 9885 #, kde-format 9886 msgid "Eastern - NU (Pangnirtung)" 9887 msgstr "" 9888 9889 #: kdecore/TIMEZONES:508 9890 #, kde-format 9891 msgid "America/Paramaribo" 9892 msgstr "Amerike/Paramaribo" 9893 9894 #: kdecore/TIMEZONES:509 9895 #, kde-format 9896 msgid "America/Phoenix" 9897 msgstr "Amerike/Phoenix" 9898 9899 #. i18n: comment to the previous timezone 9900 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 9901 #, kde-format 9902 msgid "Mountain Standard Time - Arizona" 9903 msgstr "" 9904 9905 #. i18n: comment to the previous timezone 9906 #: kdecore/TIMEZONES:513 9907 #, kde-format 9908 msgid "MST - Arizona (except Navajo)" 9909 msgstr "" 9910 9911 #: kdecore/TIMEZONES:514 9912 #, kde-format 9913 msgid "America/Port-au-Prince" 9914 msgstr "Amerike/Port-au-Prince" 9915 9916 #: kdecore/TIMEZONES:515 9917 #, kde-format 9918 msgid "America/Port_of_Spain" 9919 msgstr "Amerike/Port_of_Spain" 9920 9921 #: kdecore/TIMEZONES:516 9922 #, fuzzy, kde-format 9923 #| msgid "America/Porto_Velho" 9924 msgid "America/Porto_Acre" 9925 msgstr "Amerike/Porto_Velho" 9926 9927 #. i18n: comment to the previous timezone 9928 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 9929 #, kde-format 9930 msgid "Acre" 9931 msgstr "" 9932 9933 #: kdecore/TIMEZONES:519 9934 #, kde-format 9935 msgid "America/Porto_Velho" 9936 msgstr "Amerike/Porto_Velho" 9937 9938 #. i18n: comment to the previous timezone 9939 #: kdecore/TIMEZONES:521 9940 #, kde-format 9941 msgid "Rondonia" 9942 msgstr "" 9943 9944 #: kdecore/TIMEZONES:522 9945 #, kde-format 9946 msgid "America/Puerto_Rico" 9947 msgstr "Amerike/Puerto_Rico" 9948 9949 #: kdecore/TIMEZONES:523 9950 #, fuzzy, kde-format 9951 #| msgid "America/Buenos_Aires" 9952 msgid "America/Punta_Arenas" 9953 msgstr "Amerike/Buenos_Aires" 9954 9955 #. i18n: comment to the previous timezone 9956 #: kdecore/TIMEZONES:525 9957 #, kde-format 9958 msgid "Region of Magallanes" 9959 msgstr "" 9960 9961 #: kdecore/TIMEZONES:526 9962 #, kde-format 9963 msgid "America/Rainy_River" 9964 msgstr "Amerike/Rainy_River" 9965 9966 #. i18n: comment to the previous timezone 9967 #: kdecore/TIMEZONES:528 9968 #, kde-format 9969 msgid "Central Time - Rainy River & Fort Frances, Ontario" 9970 msgstr "" 9971 9972 #. i18n: comment to the previous timezone 9973 #: kdecore/TIMEZONES:530 9974 #, kde-format 9975 msgid "Central - ON (Rainy R, Ft Frances)" 9976 msgstr "" 9977 9978 #: kdecore/TIMEZONES:531 9979 #, kde-format 9980 msgid "America/Rankin_Inlet" 9981 msgstr "Amerike/Rankin_Inlet" 9982 9983 #. i18n: comment to the previous timezone 9984 #: kdecore/TIMEZONES:533 9985 #, kde-format 9986 msgid "Central Time - central Nunavut" 9987 msgstr "" 9988 9989 #. i18n: comment to the previous timezone 9990 #: kdecore/TIMEZONES:535 9991 #, kde-format 9992 msgid "Central - NU (central)" 9993 msgstr "" 9994 9995 #: kdecore/TIMEZONES:536 9996 #, kde-format 9997 msgid "America/Recife" 9998 msgstr "Amerike/Recife" 9999 10000 #. i18n: comment to the previous timezone 10001 #: kdecore/TIMEZONES:538 10002 #, kde-format 10003 msgid "Pernambuco" 10004 msgstr "" 10005 10006 #: kdecore/TIMEZONES:539 10007 #, kde-format 10008 msgid "America/Regina" 10009 msgstr "Amerike/Regina" 10010 10011 #. i18n: comment to the previous timezone 10012 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10013 #: kdecore/TIMEZONES:1123 10014 #, kde-format 10015 msgid "Central Standard Time - Saskatchewan - most locations" 10016 msgstr "" 10017 10018 #. i18n: comment to the previous timezone 10019 #: kdecore/TIMEZONES:543 10020 #, kde-format 10021 msgid "CST - SK (most areas)" 10022 msgstr "" 10023 10024 #: kdecore/TIMEZONES:544 10025 #, fuzzy, kde-format 10026 #| msgid "America/Belem" 10027 msgid "America/Resolute" 10028 msgstr "Amerike/Belem" 10029 10030 #. i18n: comment to the previous timezone 10031 #: kdecore/TIMEZONES:546 10032 #, kde-format 10033 msgid "Eastern Time - Resolute, Nunavut" 10034 msgstr "" 10035 10036 #. i18n: comment to the previous timezone 10037 #: kdecore/TIMEZONES:548 10038 #, kde-format 10039 msgid "Central Standard Time - Resolute, Nunavut" 10040 msgstr "" 10041 10042 #. i18n: comment to the previous timezone 10043 #: kdecore/TIMEZONES:550 10044 #, kde-format 10045 msgid "Central - NU (Resolute)" 10046 msgstr "" 10047 10048 #: kdecore/TIMEZONES:551 10049 #, kde-format 10050 msgid "America/Rio_Branco" 10051 msgstr "Amerike/Rio_Branco" 10052 10053 #: kdecore/TIMEZONES:554 10054 #, kde-format 10055 msgid "America/Rosario" 10056 msgstr "Amerike/Rosario" 10057 10058 #: kdecore/TIMEZONES:557 10059 #, fuzzy, kde-format 10060 #| msgid "America/Santiago" 10061 msgid "America/Santa_Isabel" 10062 msgstr "Amerike/Santiago" 10063 10064 #. i18n: comment to the previous timezone 10065 #: kdecore/TIMEZONES:559 10066 #, kde-format 10067 msgid "Mexican Pacific Time - Baja California away from US border" 10068 msgstr "" 10069 10070 #: kdecore/TIMEZONES:560 10071 #, fuzzy, kde-format 10072 #| msgid "America/Santiago" 10073 msgid "America/Santarem" 10074 msgstr "Amerike/Santiago" 10075 10076 #. i18n: comment to the previous timezone 10077 #: kdecore/TIMEZONES:562 10078 #, fuzzy, kde-format 10079 msgid "W Para" 10080 msgstr "di Mås" 10081 10082 #. i18n: comment to the previous timezone 10083 #: kdecore/TIMEZONES:564 10084 #, kde-format 10085 msgid "Para (west)" 10086 msgstr "" 10087 10088 #: kdecore/TIMEZONES:565 10089 #, kde-format 10090 msgid "America/Santiago" 10091 msgstr "Amerike/Santiago" 10092 10093 #. i18n: comment to the previous timezone 10094 #: kdecore/TIMEZONES:569 10095 #, kde-format 10096 msgid "Chile (most areas)" 10097 msgstr "" 10098 10099 #: kdecore/TIMEZONES:570 10100 #, kde-format 10101 msgid "America/Santo_Domingo" 10102 msgstr "Amerike/Santo_Domingo" 10103 10104 #: kdecore/TIMEZONES:571 10105 #, kde-format 10106 msgid "America/Sao_Paulo" 10107 msgstr "Amerike/Sao_Paulo" 10108 10109 #. i18n: comment to the previous timezone 10110 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10111 #, kde-format 10112 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10113 msgstr "" 10114 10115 #. i18n: comment to the previous timezone 10116 #: kdecore/TIMEZONES:575 10117 #, kde-format 10118 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10119 msgstr "" 10120 10121 #: kdecore/TIMEZONES:576 10122 #, fuzzy, kde-format 10123 #| msgid "America/Dawson" 10124 msgid "America/Saskatoon" 10125 msgstr "Amerike/Dawson" 10126 10127 #: kdecore/TIMEZONES:579 10128 #, kde-format 10129 msgid "America/Scoresbysund" 10130 msgstr "Amerike/Scoresbysund" 10131 10132 #. i18n: comment to the previous timezone 10133 #: kdecore/TIMEZONES:581 10134 #, kde-format 10135 msgid "Scoresbysund / Ittoqqortoormiit" 10136 msgstr "" 10137 10138 #. i18n: comment to the previous timezone 10139 #: kdecore/TIMEZONES:583 10140 #, kde-format 10141 msgid "Scoresbysund/Ittoqqortoormiit" 10142 msgstr "" 10143 10144 #: kdecore/TIMEZONES:584 10145 #, kde-format 10146 msgid "America/Shiprock" 10147 msgstr "Amerike/Shiprock" 10148 10149 #. i18n: comment to the previous timezone 10150 #: kdecore/TIMEZONES:586 10151 #, kde-format 10152 msgid "Mountain Time - Navajo" 10153 msgstr "" 10154 10155 #: kdecore/TIMEZONES:587 10156 #, fuzzy, kde-format 10157 #| msgid "America/Antigua" 10158 msgid "America/Sitka" 10159 msgstr "Amerike/Antigua" 10160 10161 #. i18n: comment to the previous timezone 10162 #: kdecore/TIMEZONES:589 10163 #, kde-format 10164 msgid "Alaska Time - southeast Alaska panhandle" 10165 msgstr "" 10166 10167 #. i18n: comment to the previous timezone 10168 #: kdecore/TIMEZONES:591 10169 #, kde-format 10170 msgid "Alaska - Sitka area" 10171 msgstr "" 10172 10173 #: kdecore/TIMEZONES:592 10174 #, fuzzy, kde-format 10175 #| msgid "America/Belem" 10176 msgid "America/St_Barthelemy" 10177 msgstr "Amerike/Belem" 10178 10179 #: kdecore/TIMEZONES:593 10180 #, kde-format 10181 msgid "America/St_Johns" 10182 msgstr "Amerike/St_Johns" 10183 10184 #. i18n: comment to the previous timezone 10185 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10186 #, kde-format 10187 msgid "Newfoundland Time, including SE Labrador" 10188 msgstr "" 10189 10190 #. i18n: comment to the previous timezone 10191 #: kdecore/TIMEZONES:597 10192 #, kde-format 10193 msgid "Newfoundland; Labrador (southeast)" 10194 msgstr "" 10195 10196 #: kdecore/TIMEZONES:598 10197 #, kde-format 10198 msgid "America/St_Kitts" 10199 msgstr "Amerike/St_Kitts" 10200 10201 #: kdecore/TIMEZONES:599 10202 #, kde-format 10203 msgid "America/St_Lucia" 10204 msgstr "Amerike/St_Lucia" 10205 10206 #: kdecore/TIMEZONES:600 10207 #, kde-format 10208 msgid "America/St_Thomas" 10209 msgstr "Amerike/St_Thomas" 10210 10211 #: kdecore/TIMEZONES:601 10212 #, kde-format 10213 msgid "America/St_Vincent" 10214 msgstr "Amerike/St_Vincent" 10215 10216 #: kdecore/TIMEZONES:602 10217 #, kde-format 10218 msgid "America/Swift_Current" 10219 msgstr "Amerike/Swift_Current" 10220 10221 #. i18n: comment to the previous timezone 10222 #: kdecore/TIMEZONES:604 10223 #, kde-format 10224 msgid "Central Standard Time - Saskatchewan - midwest" 10225 msgstr "" 10226 10227 #. i18n: comment to the previous timezone 10228 #: kdecore/TIMEZONES:606 10229 #, kde-format 10230 msgid "CST - SK (midwest)" 10231 msgstr "" 10232 10233 #: kdecore/TIMEZONES:607 10234 #, kde-format 10235 msgid "America/Tegucigalpa" 10236 msgstr "Amerike/Tegucigalpa" 10237 10238 #: kdecore/TIMEZONES:608 10239 #, kde-format 10240 msgid "America/Thule" 10241 msgstr "Amerike/Thule" 10242 10243 #. i18n: comment to the previous timezone 10244 #: kdecore/TIMEZONES:610 10245 #, kde-format 10246 msgid "Thule / Pituffik" 10247 msgstr "" 10248 10249 #. i18n: comment to the previous timezone 10250 #: kdecore/TIMEZONES:612 10251 #, kde-format 10252 msgid "Thule/Pituffik" 10253 msgstr "" 10254 10255 #: kdecore/TIMEZONES:613 10256 #, kde-format 10257 msgid "America/Thunder_Bay" 10258 msgstr "Amerike/Thunder_Bay" 10259 10260 #. i18n: comment to the previous timezone 10261 #: kdecore/TIMEZONES:615 10262 #, kde-format 10263 msgid "Eastern Time - Thunder Bay, Ontario" 10264 msgstr "" 10265 10266 #. i18n: comment to the previous timezone 10267 #: kdecore/TIMEZONES:617 10268 #, kde-format 10269 msgid "Eastern - ON (Thunder Bay)" 10270 msgstr "" 10271 10272 #: kdecore/TIMEZONES:618 10273 #, kde-format 10274 msgid "America/Tijuana" 10275 msgstr "Amerike/Tijuana" 10276 10277 #. i18n: comment to the previous timezone 10278 #: kdecore/TIMEZONES:622 10279 #, kde-format 10280 msgid "US Pacific Time - Baja California near US border" 10281 msgstr "" 10282 10283 #. i18n: comment to the previous timezone 10284 #: kdecore/TIMEZONES:624 10285 #, kde-format 10286 msgid "Pacific Time US - Baja California" 10287 msgstr "" 10288 10289 #: kdecore/TIMEZONES:625 10290 #, kde-format 10291 msgid "America/Toronto" 10292 msgstr "Amerike/Toronto" 10293 10294 #. i18n: comment to the previous timezone 10295 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10296 #, kde-format 10297 msgid "Eastern Time - Ontario - most locations" 10298 msgstr "" 10299 10300 #. i18n: comment to the previous timezone 10301 #: kdecore/TIMEZONES:629 10302 #, kde-format 10303 msgid "Eastern - ON, QC (most areas)" 10304 msgstr "" 10305 10306 #: kdecore/TIMEZONES:630 10307 #, kde-format 10308 msgid "America/Tortola" 10309 msgstr "Amerike/Tórtola" 10310 10311 #: kdecore/TIMEZONES:631 10312 #, kde-format 10313 msgid "America/Vancouver" 10314 msgstr "Amerike/Vancouver" 10315 10316 #. i18n: comment to the previous timezone 10317 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10318 #, kde-format 10319 msgid "Pacific Time - west British Columbia" 10320 msgstr "" 10321 10322 #. i18n: comment to the previous timezone 10323 #: kdecore/TIMEZONES:635 10324 #, kde-format 10325 msgid "Pacific - BC (most areas)" 10326 msgstr "" 10327 10328 #: kdecore/TIMEZONES:636 10329 #, fuzzy, kde-format 10330 #| msgid "America/Regina" 10331 msgid "America/Virgin" 10332 msgstr "Amerike/Regina" 10333 10334 #: kdecore/TIMEZONES:637 10335 #, kde-format 10336 msgid "America/Whitehorse" 10337 msgstr "Amerike/Whitehorse" 10338 10339 #. i18n: comment to the previous timezone 10340 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10341 #, kde-format 10342 msgid "Pacific Time - south Yukon" 10343 msgstr "" 10344 10345 #. i18n: comment to the previous timezone 10346 #: kdecore/TIMEZONES:641 10347 #, kde-format 10348 msgid "MST - Yukon (east)" 10349 msgstr "" 10350 10351 #: kdecore/TIMEZONES:642 10352 #, kde-format 10353 msgid "America/Winnipeg" 10354 msgstr "Amerike/Winnipeg" 10355 10356 #. i18n: comment to the previous timezone 10357 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10358 #, kde-format 10359 msgid "Central Time - Manitoba & west Ontario" 10360 msgstr "" 10361 10362 #. i18n: comment to the previous timezone 10363 #: kdecore/TIMEZONES:646 10364 #, kde-format 10365 msgid "Central - ON (west); Manitoba" 10366 msgstr "" 10367 10368 #: kdecore/TIMEZONES:647 10369 #, kde-format 10370 msgid "America/Yakutat" 10371 msgstr "Amerike/Yakutat" 10372 10373 #. i18n: comment to the previous timezone 10374 #: kdecore/TIMEZONES:649 10375 #, kde-format 10376 msgid "Alaska Time - Alaska panhandle neck" 10377 msgstr "" 10378 10379 #. i18n: comment to the previous timezone 10380 #: kdecore/TIMEZONES:651 10381 #, kde-format 10382 msgid "Alaska - Yakutat" 10383 msgstr "" 10384 10385 #: kdecore/TIMEZONES:652 10386 #, kde-format 10387 msgid "America/Yellowknife" 10388 msgstr "Amerike/Yellowknife" 10389 10390 #. i18n: comment to the previous timezone 10391 #: kdecore/TIMEZONES:654 10392 #, kde-format 10393 msgid "Mountain Time - central Northwest Territories" 10394 msgstr "" 10395 10396 #. i18n: comment to the previous timezone 10397 #: kdecore/TIMEZONES:656 10398 #, kde-format 10399 msgid "Mountain - NT (central)" 10400 msgstr "" 10401 10402 #: kdecore/TIMEZONES:657 10403 #, kde-format 10404 msgid "Antarctica/Casey" 10405 msgstr "Antartike/Casey" 10406 10407 #. i18n: comment to the previous timezone 10408 #: kdecore/TIMEZONES:659 10409 #, kde-format 10410 msgid "Casey Station, Bailey Peninsula" 10411 msgstr "" 10412 10413 #. i18n: comment to the previous timezone 10414 #: kdecore/TIMEZONES:661 10415 #, kde-format 10416 msgid "Casey" 10417 msgstr "" 10418 10419 #: kdecore/TIMEZONES:662 10420 #, kde-format 10421 msgid "Antarctica/Davis" 10422 msgstr "Antartike/Davis" 10423 10424 #. i18n: comment to the previous timezone 10425 #: kdecore/TIMEZONES:664 10426 #, kde-format 10427 msgid "Davis Station, Vestfold Hills" 10428 msgstr "" 10429 10430 #. i18n: comment to the previous timezone 10431 #: kdecore/TIMEZONES:666 10432 #, kde-format 10433 msgid "Davis" 10434 msgstr "" 10435 10436 #: kdecore/TIMEZONES:667 10437 #, kde-format 10438 msgid "Antarctica/DumontDUrville" 10439 msgstr "Antartike/DumontDUrville" 10440 10441 #. i18n: comment to the previous timezone 10442 #: kdecore/TIMEZONES:669 10443 #, kde-format 10444 msgid "Dumont-d'Urville Station, Terre Adelie" 10445 msgstr "" 10446 10447 #. i18n: comment to the previous timezone 10448 #: kdecore/TIMEZONES:671 10449 #, fuzzy, kde-format 10450 #| msgid "Antarctica/DumontDUrville" 10451 msgid "Dumont-d'Urville" 10452 msgstr "Antartike/DumontDUrville" 10453 10454 #: kdecore/TIMEZONES:672 10455 #, fuzzy, kde-format 10456 #| msgid "Antarctica/McMurdo" 10457 msgid "Antarctica/Macquarie" 10458 msgstr "Antartike/McMurdo" 10459 10460 #. i18n: comment to the previous timezone 10461 #: kdecore/TIMEZONES:674 10462 #, kde-format 10463 msgid "Macquarie Island Station, Macquarie Island" 10464 msgstr "" 10465 10466 #. i18n: comment to the previous timezone 10467 #: kdecore/TIMEZONES:676 10468 #, kde-format 10469 msgid "Macquarie Island" 10470 msgstr "" 10471 10472 #: kdecore/TIMEZONES:677 10473 #, kde-format 10474 msgid "Antarctica/Mawson" 10475 msgstr "Antartike/Mawson" 10476 10477 #. i18n: comment to the previous timezone 10478 #: kdecore/TIMEZONES:679 10479 #, kde-format 10480 msgid "Mawson Station, Holme Bay" 10481 msgstr "" 10482 10483 #. i18n: comment to the previous timezone 10484 #: kdecore/TIMEZONES:681 10485 #, kde-format 10486 msgid "Mawson" 10487 msgstr "" 10488 10489 #: kdecore/TIMEZONES:682 10490 #, kde-format 10491 msgid "Antarctica/McMurdo" 10492 msgstr "Antartike/McMurdo" 10493 10494 #. i18n: comment to the previous timezone 10495 #: kdecore/TIMEZONES:684 10496 #, kde-format 10497 msgid "McMurdo Station, Ross Island" 10498 msgstr "" 10499 10500 #. i18n: comment to the previous timezone 10501 #: kdecore/TIMEZONES:686 10502 #, kde-format 10503 msgid "New Zealand time - McMurdo, South Pole" 10504 msgstr "" 10505 10506 #: kdecore/TIMEZONES:687 10507 #, kde-format 10508 msgid "Antarctica/Palmer" 10509 msgstr "Antartike/Palmer" 10510 10511 #. i18n: comment to the previous timezone 10512 #: kdecore/TIMEZONES:689 10513 #, kde-format 10514 msgid "Palmer Station, Anvers Island" 10515 msgstr "" 10516 10517 #. i18n: comment to the previous timezone 10518 #: kdecore/TIMEZONES:691 10519 #, kde-format 10520 msgid "Palmer" 10521 msgstr "" 10522 10523 #: kdecore/TIMEZONES:692 10524 #, kde-format 10525 msgid "Antarctica/Rothera" 10526 msgstr "Antartike/Rothera" 10527 10528 #. i18n: comment to the previous timezone 10529 #: kdecore/TIMEZONES:694 10530 #, kde-format 10531 msgid "Rothera Station, Adelaide Island" 10532 msgstr "" 10533 10534 #. i18n: comment to the previous timezone 10535 #: kdecore/TIMEZONES:696 10536 #, kde-format 10537 msgid "Rothera" 10538 msgstr "" 10539 10540 #: kdecore/TIMEZONES:697 10541 #, kde-format 10542 msgid "Antarctica/South_Pole" 10543 msgstr "Antartike/Pole Sud" 10544 10545 #. i18n: comment to the previous timezone 10546 #: kdecore/TIMEZONES:699 10547 #, kde-format 10548 msgid "Amundsen-Scott Station, South Pole" 10549 msgstr "" 10550 10551 #: kdecore/TIMEZONES:700 10552 #, kde-format 10553 msgid "Antarctica/Syowa" 10554 msgstr "Antartike/Syowa" 10555 10556 #. i18n: comment to the previous timezone 10557 #: kdecore/TIMEZONES:702 10558 #, kde-format 10559 msgid "Syowa Station, E Ongul I" 10560 msgstr "" 10561 10562 #. i18n: comment to the previous timezone 10563 #: kdecore/TIMEZONES:704 10564 #, kde-format 10565 msgid "Syowa" 10566 msgstr "" 10567 10568 #: kdecore/TIMEZONES:705 10569 #, fuzzy, kde-format 10570 #| msgid "Antarctica/McMurdo" 10571 msgid "Antarctica/Troll" 10572 msgstr "Antartike/McMurdo" 10573 10574 #. i18n: comment to the previous timezone 10575 #: kdecore/TIMEZONES:707 10576 #, kde-format 10577 msgid "Troll" 10578 msgstr "" 10579 10580 #: kdecore/TIMEZONES:708 10581 #, kde-format 10582 msgid "Antarctica/Vostok" 10583 msgstr "Antartike/Vostok" 10584 10585 #. i18n: comment to the previous timezone 10586 #: kdecore/TIMEZONES:710 10587 #, kde-format 10588 msgid "Vostok Station, S Magnetic Pole" 10589 msgstr "" 10590 10591 #. i18n: comment to the previous timezone 10592 #: kdecore/TIMEZONES:712 10593 #, kde-format 10594 msgid "Vostok Station, Lake Vostok" 10595 msgstr "" 10596 10597 #. i18n: comment to the previous timezone 10598 #: kdecore/TIMEZONES:714 10599 #, kde-format 10600 msgid "Vostok" 10601 msgstr "" 10602 10603 #: kdecore/TIMEZONES:715 10604 #, kde-format 10605 msgid "Arctic/Longyearbyen" 10606 msgstr "Artike/Longyearbyen" 10607 10608 #: kdecore/TIMEZONES:716 10609 #, kde-format 10610 msgid "Asia/Aden" 10611 msgstr "Azeye/Aden" 10612 10613 #: kdecore/TIMEZONES:717 10614 #, kde-format 10615 msgid "Asia/Almaty" 10616 msgstr "Azeye/Almaty" 10617 10618 #. i18n: comment to the previous timezone 10619 #: kdecore/TIMEZONES:721 10620 #, kde-format 10621 msgid "Kazakhstan (most areas)" 10622 msgstr "" 10623 10624 #: kdecore/TIMEZONES:722 10625 #, kde-format 10626 msgid "Asia/Amman" 10627 msgstr "Azeye/Amman" 10628 10629 #: kdecore/TIMEZONES:723 10630 #, kde-format 10631 msgid "Asia/Anadyr" 10632 msgstr "Azeye/Anadyr" 10633 10634 #. i18n: comment to the previous timezone 10635 #: kdecore/TIMEZONES:725 10636 #, kde-format 10637 msgid "Moscow+10 - Bering Sea" 10638 msgstr "" 10639 10640 #. i18n: comment to the previous timezone 10641 #: kdecore/TIMEZONES:727 10642 #, kde-format 10643 msgid "Moscow+08 - Bering Sea" 10644 msgstr "" 10645 10646 #. i18n: comment to the previous timezone 10647 #: kdecore/TIMEZONES:729 10648 #, kde-format 10649 msgid "MSK+09 - Bering Sea" 10650 msgstr "" 10651 10652 #: kdecore/TIMEZONES:730 10653 #, kde-format 10654 msgid "Asia/Aqtau" 10655 msgstr "Azeye/Aqtau" 10656 10657 #. i18n: comment to the previous timezone 10658 #: kdecore/TIMEZONES:732 10659 #, kde-format 10660 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 10661 msgstr "" 10662 10663 #. i18n: comment to the previous timezone 10664 #: kdecore/TIMEZONES:734 10665 #, kde-format 10666 msgid "Mangghystau/Mankistau" 10667 msgstr "" 10668 10669 #: kdecore/TIMEZONES:735 10670 #, kde-format 10671 msgid "Asia/Aqtobe" 10672 msgstr "Azeye/Aqtobe" 10673 10674 #. i18n: comment to the previous timezone 10675 #: kdecore/TIMEZONES:737 10676 #, kde-format 10677 msgid "Aqtobe (Aktobe)" 10678 msgstr "" 10679 10680 #. i18n: comment to the previous timezone 10681 #: kdecore/TIMEZONES:739 10682 #, kde-format 10683 msgid "Aqtobe/Aktobe" 10684 msgstr "" 10685 10686 #: kdecore/TIMEZONES:740 10687 #, kde-format 10688 msgid "Asia/Ashgabat" 10689 msgstr "Azeye/Ashgabat" 10690 10691 #: kdecore/TIMEZONES:741 10692 #, fuzzy, kde-format 10693 #| msgid "Asia/Ashgabat" 10694 msgid "Asia/Ashkhabad" 10695 msgstr "Azeye/Ashgabat" 10696 10697 #: kdecore/TIMEZONES:742 10698 #, fuzzy, kde-format 10699 #| msgid "Asia/Aqtau" 10700 msgid "Asia/Atyrau" 10701 msgstr "Azeye/Aqtau" 10702 10703 #. i18n: comment to the previous timezone 10704 #: kdecore/TIMEZONES:744 10705 #, kde-format 10706 msgid "Atyrau/Atirau/Gur'yev" 10707 msgstr "" 10708 10709 #: kdecore/TIMEZONES:745 10710 #, kde-format 10711 msgid "Asia/Baghdad" 10712 msgstr "Azeye/Baghdad" 10713 10714 #: kdecore/TIMEZONES:746 10715 #, kde-format 10716 msgid "Asia/Bahrain" 10717 msgstr "Azeye/Bahrain" 10718 10719 #: kdecore/TIMEZONES:747 10720 #, kde-format 10721 msgid "Asia/Baku" 10722 msgstr "Azeye/Baku" 10723 10724 #: kdecore/TIMEZONES:748 10725 #, kde-format 10726 msgid "Asia/Bangkok" 10727 msgstr "Azeye/Bangkok" 10728 10729 #: kdecore/TIMEZONES:749 10730 #, fuzzy, kde-format 10731 #| msgid "Asia/Baku" 10732 msgid "Asia/Barnaul" 10733 msgstr "Azeye/Baku" 10734 10735 #. i18n: comment to the previous timezone 10736 #: kdecore/TIMEZONES:751 10737 #, kde-format 10738 msgid "MSK+04 - Altai" 10739 msgstr "" 10740 10741 #: kdecore/TIMEZONES:752 10742 #, fuzzy, kde-format 10743 #| msgid "Asia/Beirut" 10744 msgid "Asia/Beijing" 10745 msgstr "Azeye/Beirut" 10746 10747 #. i18n: comment to the previous timezone 10748 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 10749 #, kde-format 10750 msgid "east China - Beijing, Guangdong, Shanghai, etc." 10751 msgstr "" 10752 10753 #. i18n: comment to the previous timezone 10754 #: kdecore/TIMEZONES:756 10755 #, kde-format 10756 msgid "China Standard Time" 10757 msgstr "" 10758 10759 #: kdecore/TIMEZONES:757 10760 #, kde-format 10761 msgid "Asia/Beirut" 10762 msgstr "Azeye/Beirut" 10763 10764 #: kdecore/TIMEZONES:758 10765 #, kde-format 10766 msgid "Asia/Bishkek" 10767 msgstr "Azeye/Bishkek" 10768 10769 #: kdecore/TIMEZONES:759 10770 #, kde-format 10771 msgid "Asia/Brunei" 10772 msgstr "Azeye/Brunei" 10773 10774 #: kdecore/TIMEZONES:760 10775 #, kde-format 10776 msgid "Asia/Calcutta" 10777 msgstr "Azeye/Calcutta" 10778 10779 #: kdecore/TIMEZONES:761 10780 #, fuzzy, kde-format 10781 #| msgid "Asia/Choibalsan" 10782 msgid "Asia/Chita" 10783 msgstr "Azeye/Choibalsan" 10784 10785 #. i18n: comment to the previous timezone 10786 #: kdecore/TIMEZONES:763 10787 #, kde-format 10788 msgid "MSK+06 - Zabaykalsky" 10789 msgstr "" 10790 10791 #: kdecore/TIMEZONES:764 10792 #, kde-format 10793 msgid "Asia/Choibalsan" 10794 msgstr "Azeye/Choibalsan" 10795 10796 #. i18n: comment to the previous timezone 10797 #: kdecore/TIMEZONES:766 10798 #, kde-format 10799 msgid "Dornod, Sukhbaatar" 10800 msgstr "" 10801 10802 #: kdecore/TIMEZONES:767 10803 #, kde-format 10804 msgid "Asia/Chongqing" 10805 msgstr "Azeye/Chongqing" 10806 10807 #. i18n: comment to the previous timezone 10808 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 10809 #, kde-format 10810 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 10811 msgstr "" 10812 10813 #. i18n: comment to the previous timezone 10814 #: kdecore/TIMEZONES:771 10815 #, kde-format 10816 msgid "China mountains" 10817 msgstr "" 10818 10819 #: kdecore/TIMEZONES:772 10820 #, fuzzy, kde-format 10821 #| msgid "Asia/Chongqing" 10822 msgid "Asia/Chungking" 10823 msgstr "Azeye/Chongqing" 10824 10825 #: kdecore/TIMEZONES:775 10826 #, kde-format 10827 msgid "Asia/Colombo" 10828 msgstr "Azeye/Colombo" 10829 10830 #: kdecore/TIMEZONES:776 10831 #, fuzzy, kde-format 10832 #| msgid "Asia/Dhaka" 10833 msgid "Asia/Dacca" 10834 msgstr "Azeye/Dhaka" 10835 10836 #: kdecore/TIMEZONES:777 10837 #, kde-format 10838 msgid "Asia/Damascus" 10839 msgstr "Azeye/Damascus" 10840 10841 #: kdecore/TIMEZONES:778 10842 #, kde-format 10843 msgid "Asia/Dhaka" 10844 msgstr "Azeye/Dhaka" 10845 10846 #: kdecore/TIMEZONES:779 10847 #, kde-format 10848 msgid "Asia/Dili" 10849 msgstr "Azeye/Dili" 10850 10851 #: kdecore/TIMEZONES:780 10852 #, kde-format 10853 msgid "Asia/Dubai" 10854 msgstr "Azeye/Dubai" 10855 10856 #: kdecore/TIMEZONES:781 10857 #, fuzzy, kde-format 10858 #| msgid "Do shanbe" 10859 msgid "Asia/Dushanbe" 10860 msgstr "Do shanbe" 10861 10862 #: kdecore/TIMEZONES:782 10863 #, fuzzy, kde-format 10864 #| msgid "Asia/Damascus" 10865 msgid "Asia/Famagusta" 10866 msgstr "Azeye/Damascus" 10867 10868 #. i18n: comment to the previous timezone 10869 #: kdecore/TIMEZONES:784 10870 #, kde-format 10871 msgid "Northern Cyprus" 10872 msgstr "" 10873 10874 #: kdecore/TIMEZONES:785 10875 #, kde-format 10876 msgid "Asia/Gaza" 10877 msgstr "Azeye/Gaza" 10878 10879 #. i18n: comment to the previous timezone 10880 #: kdecore/TIMEZONES:787 10881 #, kde-format 10882 msgid "Gaza Strip" 10883 msgstr "" 10884 10885 #: kdecore/TIMEZONES:788 10886 #, kde-format 10887 msgid "Asia/Harbin" 10888 msgstr "Azeye/Harbin" 10889 10890 #. i18n: comment to the previous timezone 10891 #: kdecore/TIMEZONES:790 10892 #, kde-format 10893 msgid "Heilongjiang (except Mohe), Jilin" 10894 msgstr "" 10895 10896 #. i18n: comment to the previous timezone 10897 #: kdecore/TIMEZONES:792 10898 #, kde-format 10899 msgid "China north" 10900 msgstr "" 10901 10902 #: kdecore/TIMEZONES:793 10903 #, fuzzy, kde-format 10904 #| msgid "Asia/Harbin" 10905 msgid "Asia/Hebron" 10906 msgstr "Azeye/Harbin" 10907 10908 #. i18n: comment to the previous timezone 10909 #: kdecore/TIMEZONES:795 10910 #, kde-format 10911 msgid "West Bank" 10912 msgstr "" 10913 10914 #: kdecore/TIMEZONES:796 10915 #, fuzzy, kde-format 10916 #| msgid "Asia/Chongqing" 10917 msgid "Asia/Ho_Chi_Minh" 10918 msgstr "Azeye/Chongqing" 10919 10920 #: kdecore/TIMEZONES:797 10921 #, kde-format 10922 msgid "Asia/Hong_Kong" 10923 msgstr "Azeye/Hong_Kong" 10924 10925 #: kdecore/TIMEZONES:798 10926 #, kde-format 10927 msgid "Asia/Hovd" 10928 msgstr "Azeye/Hovd" 10929 10930 #. i18n: comment to the previous timezone 10931 #: kdecore/TIMEZONES:800 10932 #, kde-format 10933 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 10934 msgstr "" 10935 10936 #: kdecore/TIMEZONES:801 10937 #, kde-format 10938 msgid "Asia/Irkutsk" 10939 msgstr "Azeye/Irkutsk" 10940 10941 #. i18n: comment to the previous timezone 10942 #: kdecore/TIMEZONES:803 10943 #, kde-format 10944 msgid "Moscow+05 - Lake Baikal" 10945 msgstr "" 10946 10947 #. i18n: comment to the previous timezone 10948 #: kdecore/TIMEZONES:805 10949 #, kde-format 10950 msgid "MSK+05 - Irkutsk, Buryatia" 10951 msgstr "" 10952 10953 #: kdecore/TIMEZONES:806 10954 #, kde-format 10955 msgid "Asia/Jakarta" 10956 msgstr "Azeye/Jakarta" 10957 10958 #. i18n: comment to the previous timezone 10959 #: kdecore/TIMEZONES:808 10960 #, kde-format 10961 msgid "Java & Sumatra" 10962 msgstr "" 10963 10964 #. i18n: comment to the previous timezone 10965 #: kdecore/TIMEZONES:810 10966 #, kde-format 10967 msgid "Java, Sumatra" 10968 msgstr "" 10969 10970 #: kdecore/TIMEZONES:811 10971 #, kde-format 10972 msgid "Asia/Jayapura" 10973 msgstr "Azeye/Jayapura" 10974 10975 #. i18n: comment to the previous timezone 10976 #: kdecore/TIMEZONES:813 10977 #, kde-format 10978 msgid "Irian Jaya & the Moluccas" 10979 msgstr "" 10980 10981 #. i18n: comment to the previous timezone 10982 #: kdecore/TIMEZONES:815 10983 #, kde-format 10984 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 10985 msgstr "" 10986 10987 #. i18n: comment to the previous timezone 10988 #: kdecore/TIMEZONES:817 10989 #, kde-format 10990 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 10991 msgstr "" 10992 10993 #: kdecore/TIMEZONES:818 10994 #, kde-format 10995 msgid "Asia/Jerusalem" 10996 msgstr "Azeye/Jerusalem" 10997 10998 #: kdecore/TIMEZONES:819 10999 #, kde-format 11000 msgid "Asia/Kabul" 11001 msgstr "Azeye/Kabul" 11002 11003 #: kdecore/TIMEZONES:820 11004 #, kde-format 11005 msgid "Asia/Kamchatka" 11006 msgstr "Azeye/Kamchatka" 11007 11008 #. i18n: comment to the previous timezone 11009 #: kdecore/TIMEZONES:822 11010 #, kde-format 11011 msgid "Moscow+09 - Kamchatka" 11012 msgstr "" 11013 11014 #. i18n: comment to the previous timezone 11015 #: kdecore/TIMEZONES:824 11016 #, kde-format 11017 msgid "Moscow+08 - Kamchatka" 11018 msgstr "" 11019 11020 #. i18n: comment to the previous timezone 11021 #: kdecore/TIMEZONES:826 11022 #, kde-format 11023 msgid "MSK+09 - Kamchatka" 11024 msgstr "" 11025 11026 #: kdecore/TIMEZONES:827 11027 #, kde-format 11028 msgid "Asia/Karachi" 11029 msgstr "Azeye/Karachi" 11030 11031 #: kdecore/TIMEZONES:828 11032 #, kde-format 11033 msgid "Asia/Kashgar" 11034 msgstr "Azeye/Kashgar" 11035 11036 #. i18n: comment to the previous timezone 11037 #: kdecore/TIMEZONES:830 11038 #, kde-format 11039 msgid "west Tibet & Xinjiang" 11040 msgstr "" 11041 11042 #. i18n: comment to the previous timezone 11043 #: kdecore/TIMEZONES:832 11044 #, kde-format 11045 msgid "China west Xinjiang" 11046 msgstr "" 11047 11048 #: kdecore/TIMEZONES:833 11049 #, fuzzy, kde-format 11050 #| msgid "Asia/Katmandu" 11051 msgid "Asia/Kathmandu" 11052 msgstr "Azeye/Katmandu" 11053 11054 #: kdecore/TIMEZONES:834 11055 #, kde-format 11056 msgid "Asia/Katmandu" 11057 msgstr "Azeye/Katmandu" 11058 11059 #: kdecore/TIMEZONES:835 11060 #, fuzzy, kde-format 11061 #| msgid "Asia/Shanghai" 11062 msgid "Asia/Khandyga" 11063 msgstr "Azeye/Shanghai" 11064 11065 #. i18n: comment to the previous timezone 11066 #: kdecore/TIMEZONES:837 11067 #, kde-format 11068 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11069 msgstr "" 11070 11071 #: kdecore/TIMEZONES:838 11072 #, fuzzy, kde-format 11073 #| msgid "Asia/Jakarta" 11074 msgid "Asia/Kolkata" 11075 msgstr "Azeye/Jakarta" 11076 11077 #: kdecore/TIMEZONES:839 11078 #, kde-format 11079 msgid "Asia/Krasnoyarsk" 11080 msgstr "Azeye/Krasnoyarsk" 11081 11082 #. i18n: comment to the previous timezone 11083 #: kdecore/TIMEZONES:841 11084 #, kde-format 11085 msgid "Moscow+04 - Yenisei River" 11086 msgstr "" 11087 11088 #. i18n: comment to the previous timezone 11089 #: kdecore/TIMEZONES:843 11090 #, kde-format 11091 msgid "MSK+04 - Krasnoyarsk area" 11092 msgstr "" 11093 11094 #: kdecore/TIMEZONES:844 11095 #, kde-format 11096 msgid "Asia/Kuala_Lumpur" 11097 msgstr "Azeye/Kuala_Lumpur" 11098 11099 #. i18n: comment to the previous timezone 11100 #: kdecore/TIMEZONES:846 11101 #, kde-format 11102 msgid "peninsular Malaysia" 11103 msgstr "" 11104 11105 #. i18n: comment to the previous timezone 11106 #: kdecore/TIMEZONES:848 11107 #, kde-format 11108 msgid "Malaysia (peninsula)" 11109 msgstr "" 11110 11111 #: kdecore/TIMEZONES:849 11112 #, kde-format 11113 msgid "Asia/Kuching" 11114 msgstr "Azeye/Kuching" 11115 11116 #. i18n: comment to the previous timezone 11117 #: kdecore/TIMEZONES:851 11118 #, kde-format 11119 msgid "Sabah & Sarawak" 11120 msgstr "" 11121 11122 #. i18n: comment to the previous timezone 11123 #: kdecore/TIMEZONES:853 11124 #, kde-format 11125 msgid "Sabah, Sarawak" 11126 msgstr "" 11127 11128 #: kdecore/TIMEZONES:854 11129 #, kde-format 11130 msgid "Asia/Kuwait" 11131 msgstr "Azeye/Kuwait" 11132 11133 #: kdecore/TIMEZONES:855 11134 #, fuzzy, kde-format 11135 #| msgid "Asia/Macau" 11136 msgid "Asia/Macao" 11137 msgstr "Azeye/Macau" 11138 11139 #: kdecore/TIMEZONES:856 11140 #, kde-format 11141 msgid "Asia/Macau" 11142 msgstr "Azeye/Macau" 11143 11144 #: kdecore/TIMEZONES:857 11145 #, kde-format 11146 msgid "Asia/Magadan" 11147 msgstr "Azeye/Magadan" 11148 11149 #. i18n: comment to the previous timezone 11150 #: kdecore/TIMEZONES:859 11151 #, kde-format 11152 msgid "Moscow+08 - Magadan" 11153 msgstr "" 11154 11155 #. i18n: comment to the previous timezone 11156 #: kdecore/TIMEZONES:861 11157 #, kde-format 11158 msgid "MSK+08 - Magadan" 11159 msgstr "" 11160 11161 #: kdecore/TIMEZONES:862 11162 #, kde-format 11163 msgid "Asia/Makassar" 11164 msgstr "Azeye/Makassar" 11165 11166 #. i18n: comment to the previous timezone 11167 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11168 #, kde-format 11169 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11170 msgstr "" 11171 11172 #. i18n: comment to the previous timezone 11173 #: kdecore/TIMEZONES:866 11174 #, kde-format 11175 msgid "" 11176 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11177 msgstr "" 11178 11179 #. i18n: comment to the previous timezone 11180 #: kdecore/TIMEZONES:868 11181 #, kde-format 11182 msgid "" 11183 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11184 msgstr "" 11185 11186 #: kdecore/TIMEZONES:869 11187 #, kde-format 11188 msgid "Asia/Manila" 11189 msgstr "Azeye/Manila" 11190 11191 #: kdecore/TIMEZONES:870 11192 #, kde-format 11193 msgid "Asia/Muscat" 11194 msgstr "Azeye/Muscat" 11195 11196 #: kdecore/TIMEZONES:871 11197 #, kde-format 11198 msgid "Asia/Nicosia" 11199 msgstr "Azeye/Nicosia" 11200 11201 #. i18n: comment to the previous timezone 11202 #: kdecore/TIMEZONES:873 11203 #, kde-format 11204 msgid "Cyprus (most areas)" 11205 msgstr "" 11206 11207 #: kdecore/TIMEZONES:874 11208 #, fuzzy, kde-format 11209 #| msgid "Asia/Irkutsk" 11210 msgid "Asia/Novokuznetsk" 11211 msgstr "Azeye/Irkutsk" 11212 11213 #. i18n: comment to the previous timezone 11214 #: kdecore/TIMEZONES:876 11215 #, fuzzy, kde-format 11216 #| msgid "Asia/Novosibirsk" 11217 msgid "Moscow+03 - Novokuznetsk" 11218 msgstr "Azeye/Novosibirsk" 11219 11220 #. i18n: comment to the previous timezone 11221 #: kdecore/TIMEZONES:878 11222 #, kde-format 11223 msgid "MSK+04 - Kemerovo" 11224 msgstr "" 11225 11226 #: kdecore/TIMEZONES:879 11227 #, kde-format 11228 msgid "Asia/Novosibirsk" 11229 msgstr "Azeye/Novosibirsk" 11230 11231 #. i18n: comment to the previous timezone 11232 #: kdecore/TIMEZONES:881 11233 #, fuzzy, kde-format 11234 #| msgid "Asia/Novosibirsk" 11235 msgid "Moscow+03 - Novosibirsk" 11236 msgstr "Azeye/Novosibirsk" 11237 11238 #. i18n: comment to the previous timezone 11239 #: kdecore/TIMEZONES:883 11240 #, fuzzy, kde-format 11241 #| msgid "Asia/Novosibirsk" 11242 msgid "MSK+04 - Novosibirsk" 11243 msgstr "Azeye/Novosibirsk" 11244 11245 #: kdecore/TIMEZONES:884 11246 #, kde-format 11247 msgid "Asia/Omsk" 11248 msgstr "Azeye/Omsk" 11249 11250 #. i18n: comment to the previous timezone 11251 #: kdecore/TIMEZONES:886 11252 #, kde-format 11253 msgid "Moscow+03 - west Siberia" 11254 msgstr "" 11255 11256 #. i18n: comment to the previous timezone 11257 #: kdecore/TIMEZONES:888 11258 #, kde-format 11259 msgid "MSK+03 - Omsk" 11260 msgstr "" 11261 11262 #: kdecore/TIMEZONES:889 11263 #, kde-format 11264 msgid "Asia/Oral" 11265 msgstr "Azeye/Oral" 11266 11267 #. i18n: comment to the previous timezone 11268 #: kdecore/TIMEZONES:891 11269 #, kde-format 11270 msgid "West Kazakhstan" 11271 msgstr "" 11272 11273 #: kdecore/TIMEZONES:892 11274 #, kde-format 11275 msgid "Asia/Phnom_Penh" 11276 msgstr "Azeye/Phnom_Penh" 11277 11278 #: kdecore/TIMEZONES:893 11279 #, kde-format 11280 msgid "Asia/Pontianak" 11281 msgstr "Azeye/Pontianak" 11282 11283 #. i18n: comment to the previous timezone 11284 #: kdecore/TIMEZONES:895 11285 #, kde-format 11286 msgid "west & central Borneo" 11287 msgstr "" 11288 11289 #. i18n: comment to the previous timezone 11290 #: kdecore/TIMEZONES:897 11291 #, kde-format 11292 msgid "Borneo (west, central)" 11293 msgstr "" 11294 11295 #: kdecore/TIMEZONES:898 11296 #, kde-format 11297 msgid "Asia/Pyongyang" 11298 msgstr "Azeye/Pyongyang" 11299 11300 #: kdecore/TIMEZONES:899 11301 #, kde-format 11302 msgid "Asia/Qatar" 11303 msgstr "Azeye/Qatar" 11304 11305 #: kdecore/TIMEZONES:900 11306 #, fuzzy, kde-format 11307 #| msgid "Asia/Pontianak" 11308 msgid "Asia/Qostanay" 11309 msgstr "Azeye/Pontianak" 11310 11311 #. i18n: comment to the previous timezone 11312 #: kdecore/TIMEZONES:902 11313 #, kde-format 11314 msgid "Qostanay/Kostanay/Kustanay" 11315 msgstr "" 11316 11317 #: kdecore/TIMEZONES:903 11318 #, kde-format 11319 msgid "Asia/Qyzylorda" 11320 msgstr "Azeye/Qyzylorda" 11321 11322 #. i18n: comment to the previous timezone 11323 #: kdecore/TIMEZONES:905 11324 #, kde-format 11325 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11326 msgstr "" 11327 11328 #. i18n: comment to the previous timezone 11329 #: kdecore/TIMEZONES:907 11330 #, kde-format 11331 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11332 msgstr "" 11333 11334 #: kdecore/TIMEZONES:908 11335 #, kde-format 11336 msgid "Asia/Rangoon" 11337 msgstr "Azeye/Rangoon" 11338 11339 #: kdecore/TIMEZONES:909 11340 #, kde-format 11341 msgid "Asia/Riyadh" 11342 msgstr "Azeye/Riyadh" 11343 11344 #: kdecore/TIMEZONES:910 11345 #, kde-format 11346 msgid "Asia/Saigon" 11347 msgstr "Azeye/Saigon" 11348 11349 #: kdecore/TIMEZONES:911 11350 #, kde-format 11351 msgid "Asia/Sakhalin" 11352 msgstr "Azeye/Sakhalin" 11353 11354 #. i18n: comment to the previous timezone 11355 #: kdecore/TIMEZONES:913 11356 #, kde-format 11357 msgid "Moscow+07 - Sakhalin Island" 11358 msgstr "" 11359 11360 #. i18n: comment to the previous timezone 11361 #: kdecore/TIMEZONES:915 11362 #, kde-format 11363 msgid "MSK+08 - Sakhalin Island" 11364 msgstr "" 11365 11366 #: kdecore/TIMEZONES:916 11367 #, kde-format 11368 msgid "Asia/Samarkand" 11369 msgstr "Azeye/Samarkand" 11370 11371 #. i18n: comment to the previous timezone 11372 #: kdecore/TIMEZONES:918 11373 #, kde-format 11374 msgid "west Uzbekistan" 11375 msgstr "" 11376 11377 #. i18n: comment to the previous timezone 11378 #: kdecore/TIMEZONES:920 11379 #, kde-format 11380 msgid "Uzbekistan (west)" 11381 msgstr "" 11382 11383 #: kdecore/TIMEZONES:921 11384 #, kde-format 11385 msgid "Asia/Seoul" 11386 msgstr "Azeye/Seoul" 11387 11388 #: kdecore/TIMEZONES:922 11389 #, kde-format 11390 msgid "Asia/Shanghai" 11391 msgstr "Azeye/Shanghai" 11392 11393 #. i18n: comment to the previous timezone 11394 #: kdecore/TIMEZONES:926 11395 #, kde-format 11396 msgid "China east" 11397 msgstr "" 11398 11399 #. i18n: comment to the previous timezone 11400 #: kdecore/TIMEZONES:928 11401 #, kde-format 11402 msgid "Beijing Time" 11403 msgstr "" 11404 11405 #: kdecore/TIMEZONES:929 11406 #, kde-format 11407 msgid "Asia/Singapore" 11408 msgstr "Azeye/Singapore" 11409 11410 #: kdecore/TIMEZONES:930 11411 #, fuzzy, kde-format 11412 #| msgid "Asia/Krasnoyarsk" 11413 msgid "Asia/Srednekolymsk" 11414 msgstr "Azeye/Krasnoyarsk" 11415 11416 #. i18n: comment to the previous timezone 11417 #: kdecore/TIMEZONES:932 11418 #, kde-format 11419 msgid "MSK+08 - Sakha (E); North Kuril Is" 11420 msgstr "" 11421 11422 #: kdecore/TIMEZONES:933 11423 #, kde-format 11424 msgid "Asia/Taipei" 11425 msgstr "Azeye/Taipei" 11426 11427 #: kdecore/TIMEZONES:934 11428 #, kde-format 11429 msgid "Asia/Tashkent" 11430 msgstr "Azeye/Tashkent" 11431 11432 #. i18n: comment to the previous timezone 11433 #: kdecore/TIMEZONES:936 11434 #, kde-format 11435 msgid "east Uzbekistan" 11436 msgstr "" 11437 11438 #. i18n: comment to the previous timezone 11439 #: kdecore/TIMEZONES:938 11440 #, kde-format 11441 msgid "Uzbekistan (east)" 11442 msgstr "" 11443 11444 #: kdecore/TIMEZONES:939 11445 #, kde-format 11446 msgid "Asia/Tbilisi" 11447 msgstr "Azeye/Tbilisi" 11448 11449 #: kdecore/TIMEZONES:940 11450 #, kde-format 11451 msgid "Asia/Tehran" 11452 msgstr "Azeye/Tehran" 11453 11454 #: kdecore/TIMEZONES:941 11455 #, fuzzy, kde-format 11456 #| msgid "Asia/Taipei" 11457 msgid "Asia/Tel_Aviv" 11458 msgstr "Azeye/Taipei" 11459 11460 #: kdecore/TIMEZONES:942 11461 #, fuzzy, kde-format 11462 #| msgid "Asia/Thimphu" 11463 msgid "Asia/Thimbu" 11464 msgstr "Azeye/Thimphu" 11465 11466 #: kdecore/TIMEZONES:943 11467 #, kde-format 11468 msgid "Asia/Thimphu" 11469 msgstr "Azeye/Thimphu" 11470 11471 #: kdecore/TIMEZONES:944 11472 #, kde-format 11473 msgid "Asia/Tokyo" 11474 msgstr "Azeye/Tokyo" 11475 11476 #: kdecore/TIMEZONES:945 11477 #, fuzzy, kde-format 11478 #| msgid "Asia/Omsk" 11479 msgid "Asia/Tomsk" 11480 msgstr "Azeye/Omsk" 11481 11482 #. i18n: comment to the previous timezone 11483 #: kdecore/TIMEZONES:947 11484 #, kde-format 11485 msgid "MSK+04 - Tomsk" 11486 msgstr "" 11487 11488 #: kdecore/TIMEZONES:948 11489 #, kde-format 11490 msgid "Asia/Ujung_Pandang" 11491 msgstr "Azeye/Ujung_Pandang" 11492 11493 #: kdecore/TIMEZONES:951 11494 #, kde-format 11495 msgid "Asia/Ulaanbaatar" 11496 msgstr "Azeye/Ulaanbaatar" 11497 11498 #. i18n: comment to the previous timezone 11499 #: kdecore/TIMEZONES:955 11500 #, kde-format 11501 msgid "Mongolia (most areas)" 11502 msgstr "" 11503 11504 #: kdecore/TIMEZONES:956 11505 #, fuzzy, kde-format 11506 #| msgid "Asia/Ulaanbaatar" 11507 msgid "Asia/Ulan_Bator" 11508 msgstr "Azeye/Ulaanbaatar" 11509 11510 #: kdecore/TIMEZONES:959 11511 #, kde-format 11512 msgid "Asia/Urumqi" 11513 msgstr "Azeye/Urumqi" 11514 11515 #. i18n: comment to the previous timezone 11516 #: kdecore/TIMEZONES:961 11517 #, kde-format 11518 msgid "most of Tibet & Xinjiang" 11519 msgstr "" 11520 11521 #. i18n: comment to the previous timezone 11522 #: kdecore/TIMEZONES:963 11523 #, kde-format 11524 msgid "China Xinjiang-Tibet" 11525 msgstr "" 11526 11527 #. i18n: comment to the previous timezone 11528 #: kdecore/TIMEZONES:965 11529 #, kde-format 11530 msgid "Xinjiang Time" 11531 msgstr "" 11532 11533 #: kdecore/TIMEZONES:966 11534 #, fuzzy, kde-format 11535 #| msgid "Asia/Tehran" 11536 msgid "Asia/Ust-Nera" 11537 msgstr "Azeye/Tehran" 11538 11539 #. i18n: comment to the previous timezone 11540 #: kdecore/TIMEZONES:968 11541 #, kde-format 11542 msgid "MSK+07 - Oymyakonsky" 11543 msgstr "" 11544 11545 #: kdecore/TIMEZONES:969 11546 #, kde-format 11547 msgid "Asia/Vientiane" 11548 msgstr "Azeye/Vientiane" 11549 11550 #: kdecore/TIMEZONES:970 11551 #, kde-format 11552 msgid "Asia/Vladivostok" 11553 msgstr "Azeye/Vladivostok" 11554 11555 #. i18n: comment to the previous timezone 11556 #: kdecore/TIMEZONES:972 11557 #, kde-format 11558 msgid "Moscow+07 - Amur River" 11559 msgstr "" 11560 11561 #. i18n: comment to the previous timezone 11562 #: kdecore/TIMEZONES:974 11563 #, kde-format 11564 msgid "MSK+07 - Amur River" 11565 msgstr "" 11566 11567 #: kdecore/TIMEZONES:975 11568 #, kde-format 11569 msgid "Asia/Yakutsk" 11570 msgstr "Azeye/Yakutsk" 11571 11572 #. i18n: comment to the previous timezone 11573 #: kdecore/TIMEZONES:977 11574 #, kde-format 11575 msgid "Moscow+06 - Lena River" 11576 msgstr "" 11577 11578 #. i18n: comment to the previous timezone 11579 #: kdecore/TIMEZONES:979 11580 #, kde-format 11581 msgid "MSK+06 - Lena River" 11582 msgstr "" 11583 11584 #: kdecore/TIMEZONES:980 11585 #, fuzzy, kde-format 11586 #| msgid "Asia/Rangoon" 11587 msgid "Asia/Yangon" 11588 msgstr "Azeye/Rangoon" 11589 11590 #: kdecore/TIMEZONES:981 11591 #, kde-format 11592 msgid "Asia/Yekaterinburg" 11593 msgstr "Azeye/Yekaterinburg" 11594 11595 #. i18n: comment to the previous timezone 11596 #: kdecore/TIMEZONES:983 11597 #, kde-format 11598 msgid "Moscow+02 - Urals" 11599 msgstr "" 11600 11601 #. i18n: comment to the previous timezone 11602 #: kdecore/TIMEZONES:985 11603 #, kde-format 11604 msgid "MSK+02 - Urals" 11605 msgstr "" 11606 11607 #: kdecore/TIMEZONES:986 11608 #, kde-format 11609 msgid "Asia/Yerevan" 11610 msgstr "Azeye/Yerevan" 11611 11612 #: kdecore/TIMEZONES:987 11613 #, kde-format 11614 msgid "Atlantic/Azores" 11615 msgstr "Oceyan Atlantike/Azores" 11616 11617 #. i18n: comment to the previous timezone 11618 #: kdecore/TIMEZONES:989 11619 #, kde-format 11620 msgid "Azores" 11621 msgstr "" 11622 11623 #: kdecore/TIMEZONES:990 11624 #, kde-format 11625 msgid "Atlantic/Bermuda" 11626 msgstr "Oceyan Atlantike/Bermuda" 11627 11628 #: kdecore/TIMEZONES:991 11629 #, kde-format 11630 msgid "Atlantic/Canary" 11631 msgstr "Oceyan Atlantike/Canary" 11632 11633 #. i18n: comment to the previous timezone 11634 #: kdecore/TIMEZONES:993 11635 #, kde-format 11636 msgid "Canary Islands" 11637 msgstr "" 11638 11639 #: kdecore/TIMEZONES:994 11640 #, kde-format 11641 msgid "Atlantic/Cape_Verde" 11642 msgstr "Oceyan Atlantike/Cape_Verde" 11643 11644 #: kdecore/TIMEZONES:995 11645 #, kde-format 11646 msgid "Atlantic/Faeroe" 11647 msgstr "Oceyan Atlantike/Faeroe" 11648 11649 #: kdecore/TIMEZONES:996 11650 #, fuzzy, kde-format 11651 #| msgid "Atlantic/Faeroe" 11652 msgid "Atlantic/Faroe" 11653 msgstr "Oceyan Atlantike/Faeroe" 11654 11655 #: kdecore/TIMEZONES:997 11656 #, kde-format 11657 msgid "Atlantic/Jan_Mayen" 11658 msgstr "Oceyan Atlantike/Jan_Mayen" 11659 11660 #: kdecore/TIMEZONES:998 11661 #, kde-format 11662 msgid "Atlantic/Madeira" 11663 msgstr "Oceyan Atlantike/Madeira" 11664 11665 #. i18n: comment to the previous timezone 11666 #: kdecore/TIMEZONES:1000 11667 #, kde-format 11668 msgid "Madeira Islands" 11669 msgstr "" 11670 11671 #: kdecore/TIMEZONES:1001 11672 #, kde-format 11673 msgid "Atlantic/Reykjavik" 11674 msgstr "Oceyan Atlantike/Reykjavik" 11675 11676 #: kdecore/TIMEZONES:1002 11677 #, kde-format 11678 msgid "Atlantic/South_Georgia" 11679 msgstr "Oceyan Atlantike/South_Georgia" 11680 11681 #: kdecore/TIMEZONES:1003 11682 #, kde-format 11683 msgid "Atlantic/St_Helena" 11684 msgstr "Oceyan Atlantike/St_Helena" 11685 11686 #: kdecore/TIMEZONES:1004 11687 #, kde-format 11688 msgid "Atlantic/Stanley" 11689 msgstr "Oceyan Atlantike/Stanley" 11690 11691 #: kdecore/TIMEZONES:1005 11692 #, fuzzy, kde-format 11693 #| msgid "Australia/Brisbane" 11694 msgid "Australia/ACT" 11695 msgstr "Ostraleye/Brisbane" 11696 11697 #. i18n: comment to the previous timezone 11698 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 11699 #: kdecore/TIMEZONES:1073 11700 #, kde-format 11701 msgid "New South Wales - most locations" 11702 msgstr "" 11703 11704 #: kdecore/TIMEZONES:1008 11705 #, kde-format 11706 msgid "Australia/Adelaide" 11707 msgstr "Ostraleye/Adelaida" 11708 11709 #. i18n: comment to the previous timezone 11710 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 11711 #, fuzzy, kde-format 11712 #| msgid "Australia/Adelaide" 11713 msgid "South Australia" 11714 msgstr "Ostraleye/Adelaida" 11715 11716 #: kdecore/TIMEZONES:1011 11717 #, kde-format 11718 msgid "Australia/Brisbane" 11719 msgstr "Ostraleye/Brisbane" 11720 11721 #. i18n: comment to the previous timezone 11722 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 11723 #, kde-format 11724 msgid "Queensland - most locations" 11725 msgstr "" 11726 11727 #. i18n: comment to the previous timezone 11728 #: kdecore/TIMEZONES:1015 11729 #, kde-format 11730 msgid "Queensland (most areas)" 11731 msgstr "" 11732 11733 #: kdecore/TIMEZONES:1016 11734 #, kde-format 11735 msgid "Australia/Broken_Hill" 11736 msgstr "Ostraleye/Broken_Hill" 11737 11738 #. i18n: comment to the previous timezone 11739 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 11740 #, kde-format 11741 msgid "New South Wales - Yancowinna" 11742 msgstr "" 11743 11744 #. i18n: comment to the previous timezone 11745 #: kdecore/TIMEZONES:1020 11746 #, kde-format 11747 msgid "New South Wales (Yancowinna)" 11748 msgstr "" 11749 11750 #: kdecore/TIMEZONES:1021 11751 #, fuzzy, kde-format 11752 #| msgid "Australia/Brisbane" 11753 msgid "Australia/Canberra" 11754 msgstr "Ostraleye/Brisbane" 11755 11756 #: kdecore/TIMEZONES:1024 11757 #, fuzzy, kde-format 11758 #| msgid "Australia/Brisbane" 11759 msgid "Australia/Currie" 11760 msgstr "Ostraleye/Brisbane" 11761 11762 #. i18n: comment to the previous timezone 11763 #: kdecore/TIMEZONES:1026 11764 #, kde-format 11765 msgid "Tasmania - King Island" 11766 msgstr "" 11767 11768 #: kdecore/TIMEZONES:1027 11769 #, kde-format 11770 msgid "Australia/Darwin" 11771 msgstr "Ostraleye/Darwin" 11772 11773 #. i18n: comment to the previous timezone 11774 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 11775 #, kde-format 11776 msgid "Northern Territory" 11777 msgstr "" 11778 11779 #: kdecore/TIMEZONES:1030 11780 #, fuzzy, kde-format 11781 #| msgid "Australia/Adelaide" 11782 msgid "Australia/Eucla" 11783 msgstr "Ostraleye/Adelaida" 11784 11785 #. i18n: comment to the previous timezone 11786 #: kdecore/TIMEZONES:1032 11787 #, fuzzy, kde-format 11788 #| msgid "Australia/Adelaide" 11789 msgid "Western Australia - Eucla area" 11790 msgstr "Ostraleye/Adelaida" 11791 11792 #. i18n: comment to the previous timezone 11793 #: kdecore/TIMEZONES:1034 11794 #, fuzzy, kde-format 11795 #| msgid "Australia/Adelaide" 11796 msgid "Western Australia (Eucla)" 11797 msgstr "Ostraleye/Adelaida" 11798 11799 #: kdecore/TIMEZONES:1035 11800 #, kde-format 11801 msgid "Australia/Hobart" 11802 msgstr "Ostraleye/Hobart" 11803 11804 #. i18n: comment to the previous timezone 11805 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 11806 #, kde-format 11807 msgid "Tasmania - most locations" 11808 msgstr "" 11809 11810 #. i18n: comment to the previous timezone 11811 #: kdecore/TIMEZONES:1039 11812 #, fuzzy, kde-format 11813 #| msgid "Australia/Brisbane" 11814 msgid "Tasmania" 11815 msgstr "Ostraleye/Brisbane" 11816 11817 #: kdecore/TIMEZONES:1040 11818 #, fuzzy, kde-format 11819 #| msgid "Australia/Hobart" 11820 msgid "Australia/LHI" 11821 msgstr "Ostraleye/Hobart" 11822 11823 #. i18n: comment to the previous timezone 11824 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 11825 #, kde-format 11826 msgid "Lord Howe Island" 11827 msgstr "" 11828 11829 #: kdecore/TIMEZONES:1043 11830 #, kde-format 11831 msgid "Australia/Lindeman" 11832 msgstr "Ostraleye/Lindeman" 11833 11834 #. i18n: comment to the previous timezone 11835 #: kdecore/TIMEZONES:1045 11836 #, kde-format 11837 msgid "Queensland - Holiday Islands" 11838 msgstr "" 11839 11840 #. i18n: comment to the previous timezone 11841 #: kdecore/TIMEZONES:1047 11842 #, kde-format 11843 msgid "Queensland (Whitsunday Islands)" 11844 msgstr "" 11845 11846 #: kdecore/TIMEZONES:1048 11847 #, kde-format 11848 msgid "Australia/Lord_Howe" 11849 msgstr "Ostraleye/Lord_Howe" 11850 11851 #: kdecore/TIMEZONES:1051 11852 #, kde-format 11853 msgid "Australia/Melbourne" 11854 msgstr "Ostraleye/Melbourne" 11855 11856 #. i18n: comment to the previous timezone 11857 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 11858 #, kde-format 11859 msgid "Victoria" 11860 msgstr "" 11861 11862 #: kdecore/TIMEZONES:1054 11863 #, fuzzy, kde-format 11864 #| msgid "Australia/Sydney" 11865 msgid "Australia/NSW" 11866 msgstr "Ostraleye/Sydney" 11867 11868 #: kdecore/TIMEZONES:1057 11869 #, fuzzy, kde-format 11870 #| msgid "Australia/Perth" 11871 msgid "Australia/North" 11872 msgstr "Ostraleye/Perth" 11873 11874 #: kdecore/TIMEZONES:1060 11875 #, kde-format 11876 msgid "Australia/Perth" 11877 msgstr "Ostraleye/Perth" 11878 11879 #. i18n: comment to the previous timezone 11880 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 11881 #, kde-format 11882 msgid "Western Australia - most locations" 11883 msgstr "" 11884 11885 #. i18n: comment to the previous timezone 11886 #: kdecore/TIMEZONES:1064 11887 #, fuzzy, kde-format 11888 #| msgid "Australia/Adelaide" 11889 msgid "Western Australia (most areas)" 11890 msgstr "Ostraleye/Adelaida" 11891 11892 #: kdecore/TIMEZONES:1065 11893 #, fuzzy, kde-format 11894 #| msgid "Australia/Adelaide" 11895 msgid "Australia/Queensland" 11896 msgstr "Ostraleye/Adelaida" 11897 11898 #: kdecore/TIMEZONES:1068 11899 #, fuzzy, kde-format 11900 #| msgid "Australia/Perth" 11901 msgid "Australia/South" 11902 msgstr "Ostraleye/Perth" 11903 11904 #: kdecore/TIMEZONES:1071 11905 #, kde-format 11906 msgid "Australia/Sydney" 11907 msgstr "Ostraleye/Sydney" 11908 11909 #. i18n: comment to the previous timezone 11910 #: kdecore/TIMEZONES:1075 11911 #, kde-format 11912 msgid "New South Wales (most areas)" 11913 msgstr "" 11914 11915 #: kdecore/TIMEZONES:1076 11916 #, fuzzy, kde-format 11917 #| msgid "Australia/Brisbane" 11918 msgid "Australia/Tasmania" 11919 msgstr "Ostraleye/Brisbane" 11920 11921 #: kdecore/TIMEZONES:1079 11922 #, fuzzy, kde-format 11923 #| msgid "Australia/Adelaide" 11924 msgid "Australia/Victoria" 11925 msgstr "Ostraleye/Adelaida" 11926 11927 #: kdecore/TIMEZONES:1082 11928 #, fuzzy, kde-format 11929 #| msgid "Australia/Perth" 11930 msgid "Australia/West" 11931 msgstr "Ostraleye/Perth" 11932 11933 #: kdecore/TIMEZONES:1085 11934 #, fuzzy, kde-format 11935 #| msgid "Australia/Darwin" 11936 msgid "Australia/Yancowinna" 11937 msgstr "Ostraleye/Darwin" 11938 11939 #: kdecore/TIMEZONES:1088 11940 #, kde-format 11941 msgid "Brazil/Acre" 11942 msgstr "" 11943 11944 #: kdecore/TIMEZONES:1091 11945 #, fuzzy, kde-format 11946 #| msgid "America/Noronha" 11947 msgid "Brazil/DeNoronha" 11948 msgstr "Amerike/Noronha" 11949 11950 #: kdecore/TIMEZONES:1094 11951 #, kde-format 11952 msgid "Brazil/East" 11953 msgstr "" 11954 11955 #: kdecore/TIMEZONES:1097 11956 #, kde-format 11957 msgid "Brazil/West" 11958 msgstr "" 11959 11960 #: kdecore/TIMEZONES:1100 11961 #, kde-format 11962 msgid "Canada/Atlantic" 11963 msgstr "" 11964 11965 #: kdecore/TIMEZONES:1103 11966 #, kde-format 11967 msgid "Canada/Central" 11968 msgstr "" 11969 11970 #: kdecore/TIMEZONES:1106 11971 #, kde-format 11972 msgid "Canada/East-Saskatchewan" 11973 msgstr "" 11974 11975 #: kdecore/TIMEZONES:1109 11976 #, kde-format 11977 msgid "Canada/Eastern" 11978 msgstr "" 11979 11980 #: kdecore/TIMEZONES:1112 11981 #, kde-format 11982 msgid "Canada/Mountain" 11983 msgstr "" 11984 11985 #: kdecore/TIMEZONES:1115 11986 #, kde-format 11987 msgid "Canada/Newfoundland" 11988 msgstr "" 11989 11990 #: kdecore/TIMEZONES:1118 11991 #, kde-format 11992 msgid "Canada/Pacific" 11993 msgstr "" 11994 11995 #: kdecore/TIMEZONES:1121 11996 #, kde-format 11997 msgid "Canada/Saskatchewan" 11998 msgstr "" 11999 12000 #: kdecore/TIMEZONES:1124 12001 #, kde-format 12002 msgid "Canada/Yukon" 12003 msgstr "" 12004 12005 #: kdecore/TIMEZONES:1127 12006 #, kde-format 12007 msgid "Chile/Continental" 12008 msgstr "" 12009 12010 #: kdecore/TIMEZONES:1130 12011 #, kde-format 12012 msgid "Chile/EasterIsland" 12013 msgstr "" 12014 12015 #. i18n: comment to the previous timezone 12016 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12017 #, kde-format 12018 msgid "Easter Island & Sala y Gomez" 12019 msgstr "" 12020 12021 #: kdecore/TIMEZONES:1133 12022 #, kde-format 12023 msgid "Cuba" 12024 msgstr "" 12025 12026 #: kdecore/TIMEZONES:1134 12027 #, kde-format 12028 msgid "Egypt" 12029 msgstr "" 12030 12031 #: kdecore/TIMEZONES:1135 12032 #, kde-format 12033 msgid "Eire" 12034 msgstr "" 12035 12036 #: kdecore/TIMEZONES:1136 12037 #, kde-format 12038 msgid "Europe/Amsterdam" 12039 msgstr "Urope/Amsterdam" 12040 12041 #: kdecore/TIMEZONES:1137 12042 #, kde-format 12043 msgid "Europe/Andorra" 12044 msgstr "Urope/Andorra" 12045 12046 #: kdecore/TIMEZONES:1138 12047 #, fuzzy, kde-format 12048 #| msgid "Europe/Athens" 12049 msgid "Europe/Astrakhan" 12050 msgstr "Urope/Athens" 12051 12052 #. i18n: comment to the previous timezone 12053 #: kdecore/TIMEZONES:1140 12054 #, kde-format 12055 msgid "MSK+01 - Astrakhan" 12056 msgstr "" 12057 12058 #: kdecore/TIMEZONES:1141 12059 #, kde-format 12060 msgid "Europe/Athens" 12061 msgstr "Urope/Athens" 12062 12063 #: kdecore/TIMEZONES:1142 12064 #, kde-format 12065 msgid "Europe/Belfast" 12066 msgstr "Urope/Belfast" 12067 12068 #: kdecore/TIMEZONES:1143 12069 #, kde-format 12070 msgid "Europe/Belgrade" 12071 msgstr "Urope/Belgråde" 12072 12073 #: kdecore/TIMEZONES:1144 12074 #, kde-format 12075 msgid "Europe/Berlin" 12076 msgstr "Urope/Berlin" 12077 12078 #. i18n: comment to the previous timezone 12079 #: kdecore/TIMEZONES:1146 12080 #, kde-format 12081 msgid "Germany (most areas)" 12082 msgstr "" 12083 12084 #: kdecore/TIMEZONES:1147 12085 #, kde-format 12086 msgid "Europe/Bratislava" 12087 msgstr "Urope/Bratislava" 12088 12089 #: kdecore/TIMEZONES:1148 12090 #, kde-format 12091 msgid "Europe/Brussels" 12092 msgstr "Urope/Brussele" 12093 12094 #: kdecore/TIMEZONES:1149 12095 #, kde-format 12096 msgid "Europe/Bucharest" 12097 msgstr "Urope/Bucharest" 12098 12099 #: kdecore/TIMEZONES:1150 12100 #, kde-format 12101 msgid "Europe/Budapest" 12102 msgstr "Urope/Budapest" 12103 12104 #: kdecore/TIMEZONES:1151 12105 #, fuzzy, kde-format 12106 #| msgid "Europe/Brussels" 12107 msgid "Europe/Busingen" 12108 msgstr "Urope/Brussele" 12109 12110 #. i18n: comment to the previous timezone 12111 #: kdecore/TIMEZONES:1153 12112 #, kde-format 12113 msgid "Busingen" 12114 msgstr "" 12115 12116 #: kdecore/TIMEZONES:1154 12117 #, kde-format 12118 msgid "Europe/Chisinau" 12119 msgstr "Urope/Chisinau" 12120 12121 #: kdecore/TIMEZONES:1155 12122 #, kde-format 12123 msgid "Europe/Copenhagen" 12124 msgstr "Urope/Copenhagen" 12125 12126 #: kdecore/TIMEZONES:1156 12127 #, kde-format 12128 msgid "Europe/Dublin" 12129 msgstr "Urope/Dublin" 12130 12131 #: kdecore/TIMEZONES:1157 12132 #, kde-format 12133 msgid "Europe/Gibraltar" 12134 msgstr "Urope/Djibraltar" 12135 12136 #: kdecore/TIMEZONES:1158 12137 #, fuzzy, kde-format 12138 #| msgid "Europe/Athens" 12139 msgid "Europe/Guernsey" 12140 msgstr "Urope/Athens" 12141 12142 #: kdecore/TIMEZONES:1159 12143 #, kde-format 12144 msgid "Europe/Helsinki" 12145 msgstr "Urope/Helsinki" 12146 12147 #: kdecore/TIMEZONES:1160 12148 #, fuzzy, kde-format 12149 #| msgid "Europe/Oslo" 12150 msgid "Europe/Isle_of_Man" 12151 msgstr "Urope/Oslo" 12152 12153 #: kdecore/TIMEZONES:1161 12154 #, kde-format 12155 msgid "Europe/Istanbul" 12156 msgstr "Urope/Istanbul" 12157 12158 #: kdecore/TIMEZONES:1162 12159 #, fuzzy, kde-format 12160 #| msgid "Europe/Paris" 12161 msgid "Europe/Jersey" 12162 msgstr "Urope/Paris" 12163 12164 #: kdecore/TIMEZONES:1163 12165 #, kde-format 12166 msgid "Europe/Kaliningrad" 12167 msgstr "Urope/Kaliningrad" 12168 12169 #. i18n: comment to the previous timezone 12170 #: kdecore/TIMEZONES:1165 12171 #, kde-format 12172 msgid "Moscow-01 - Kaliningrad" 12173 msgstr "" 12174 12175 #. i18n: comment to the previous timezone 12176 #: kdecore/TIMEZONES:1167 12177 #, kde-format 12178 msgid "MSK-01 - Kaliningrad" 12179 msgstr "" 12180 12181 #: kdecore/TIMEZONES:1168 12182 #, kde-format 12183 msgid "Europe/Kiev" 12184 msgstr "Urope/Kiyev" 12185 12186 #. i18n: comment to the previous timezone 12187 #: kdecore/TIMEZONES:1172 12188 #, kde-format 12189 msgid "Ukraine (most areas)" 12190 msgstr "" 12191 12192 #: kdecore/TIMEZONES:1173 12193 #, fuzzy, kde-format 12194 #| msgid "Europe/Kiev" 12195 msgid "Europe/Kirov" 12196 msgstr "Urope/Kiyev" 12197 12198 #. i18n: comment to the previous timezone 12199 #: kdecore/TIMEZONES:1175 12200 #, kde-format 12201 msgid "MSK+00 - Kirov" 12202 msgstr "" 12203 12204 #: kdecore/TIMEZONES:1176 12205 #, kde-format 12206 msgid "Europe/Lisbon" 12207 msgstr "Urope/Lisbone" 12208 12209 #. i18n: comment to the previous timezone 12210 #: kdecore/TIMEZONES:1180 12211 #, kde-format 12212 msgid "Portugal (mainland)" 12213 msgstr "" 12214 12215 #: kdecore/TIMEZONES:1181 12216 #, kde-format 12217 msgid "Europe/Ljubljana" 12218 msgstr "Urope/Ljubljana" 12219 12220 #: kdecore/TIMEZONES:1182 12221 #, kde-format 12222 msgid "Europe/London" 12223 msgstr "Urope/Londe" 12224 12225 #: kdecore/TIMEZONES:1183 12226 #, kde-format 12227 msgid "Europe/Luxembourg" 12228 msgstr "Urope/Lussimbork-veye" 12229 12230 #: kdecore/TIMEZONES:1184 12231 #, kde-format 12232 msgid "Europe/Madrid" 12233 msgstr "Urope/Madrid" 12234 12235 #. i18n: comment to the previous timezone 12236 #: kdecore/TIMEZONES:1188 12237 #, kde-format 12238 msgid "Spain (mainland)" 12239 msgstr "" 12240 12241 #: kdecore/TIMEZONES:1189 12242 #, kde-format 12243 msgid "Europe/Malta" 12244 msgstr "Urope/Male" 12245 12246 #: kdecore/TIMEZONES:1190 12247 #, kde-format 12248 msgid "Europe/Mariehamn" 12249 msgstr "Urope/Mariehamn" 12250 12251 #: kdecore/TIMEZONES:1191 12252 #, kde-format 12253 msgid "Europe/Minsk" 12254 msgstr "Urope/Minsk" 12255 12256 #: kdecore/TIMEZONES:1192 12257 #, kde-format 12258 msgid "Europe/Monaco" 12259 msgstr "Urope/Monaco" 12260 12261 #: kdecore/TIMEZONES:1193 12262 #, kde-format 12263 msgid "Europe/Moscow" 12264 msgstr "Urope/Moscou" 12265 12266 #. i18n: comment to the previous timezone 12267 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12268 #, kde-format 12269 msgid "Moscow+00 - west Russia" 12270 msgstr "" 12271 12272 #. i18n: comment to the previous timezone 12273 #: kdecore/TIMEZONES:1197 12274 #, kde-format 12275 msgid "MSK+00 - Moscow area" 12276 msgstr "" 12277 12278 #: kdecore/TIMEZONES:1198 12279 #, kde-format 12280 msgid "Europe/Oslo" 12281 msgstr "Urope/Oslo" 12282 12283 #: kdecore/TIMEZONES:1199 12284 #, kde-format 12285 msgid "Europe/Paris" 12286 msgstr "Urope/Paris" 12287 12288 #: kdecore/TIMEZONES:1200 12289 #, fuzzy, kde-format 12290 #| msgid "Europe/Andorra" 12291 msgid "Europe/Podgorica" 12292 msgstr "Urope/Andorra" 12293 12294 #: kdecore/TIMEZONES:1201 12295 #, kde-format 12296 msgid "Europe/Prague" 12297 msgstr "Urope/Prague" 12298 12299 #: kdecore/TIMEZONES:1202 12300 #, kde-format 12301 msgid "Europe/Riga" 12302 msgstr "Urope/Riga" 12303 12304 #: kdecore/TIMEZONES:1203 12305 #, kde-format 12306 msgid "Europe/Rome" 12307 msgstr "Urope/Rome" 12308 12309 #: kdecore/TIMEZONES:1204 12310 #, kde-format 12311 msgid "Europe/Samara" 12312 msgstr "Urope/Samara" 12313 12314 #. i18n: comment to the previous timezone 12315 #: kdecore/TIMEZONES:1206 12316 #, kde-format 12317 msgid "Moscow+01 - Samara, Udmurtia" 12318 msgstr "" 12319 12320 #. i18n: comment to the previous timezone 12321 #: kdecore/TIMEZONES:1208 12322 #, kde-format 12323 msgid "Moscow+00 - Samara, Udmurtia" 12324 msgstr "" 12325 12326 #. i18n: comment to the previous timezone 12327 #: kdecore/TIMEZONES:1210 12328 #, kde-format 12329 msgid "MSK+01 - Samara, Udmurtia" 12330 msgstr "" 12331 12332 #: kdecore/TIMEZONES:1211 12333 #, kde-format 12334 msgid "Europe/San_Marino" 12335 msgstr "Urope/San_Marino" 12336 12337 #: kdecore/TIMEZONES:1212 12338 #, kde-format 12339 msgid "Europe/Sarajevo" 12340 msgstr "Urope/Sarajevo" 12341 12342 #: kdecore/TIMEZONES:1213 12343 #, fuzzy, kde-format 12344 #| msgid "Europe/Sarajevo" 12345 msgid "Europe/Saratov" 12346 msgstr "Urope/Sarajevo" 12347 12348 #. i18n: comment to the previous timezone 12349 #: kdecore/TIMEZONES:1215 12350 #, kde-format 12351 msgid "MSK+01 - Saratov" 12352 msgstr "" 12353 12354 #: kdecore/TIMEZONES:1216 12355 #, kde-format 12356 msgid "Europe/Simferopol" 12357 msgstr "Urope/Simferopol" 12358 12359 #. i18n: comment to the previous timezone 12360 #: kdecore/TIMEZONES:1218 12361 #, kde-format 12362 msgid "central Crimea" 12363 msgstr "" 12364 12365 #. i18n: comment to the previous timezone 12366 #: kdecore/TIMEZONES:1220 12367 #, fuzzy, kde-format 12368 #| msgid "Prime: " 12369 msgid "Crimea" 12370 msgstr "Prumî: " 12371 12372 #: kdecore/TIMEZONES:1221 12373 #, kde-format 12374 msgid "Europe/Skopje" 12375 msgstr "Urope/Skopje" 12376 12377 #: kdecore/TIMEZONES:1222 12378 #, kde-format 12379 msgid "Europe/Sofia" 12380 msgstr "Urope/Sofia" 12381 12382 #: kdecore/TIMEZONES:1223 12383 #, kde-format 12384 msgid "Europe/Stockholm" 12385 msgstr "Urope/Stockholm" 12386 12387 #: kdecore/TIMEZONES:1224 12388 #, kde-format 12389 msgid "Europe/Tallinn" 12390 msgstr "Urope/Tallinn" 12391 12392 #: kdecore/TIMEZONES:1225 12393 #, kde-format 12394 msgid "Europe/Tirane" 12395 msgstr "Urope/Tirane" 12396 12397 #: kdecore/TIMEZONES:1226 12398 #, fuzzy, kde-format 12399 #| msgid "Europe/Tirane" 12400 msgid "Europe/Tiraspol" 12401 msgstr "Urope/Tirane" 12402 12403 #: kdecore/TIMEZONES:1227 12404 #, fuzzy, kde-format 12405 #| msgid "Europe/Minsk" 12406 msgid "Europe/Ulyanovsk" 12407 msgstr "Urope/Minsk" 12408 12409 #. i18n: comment to the previous timezone 12410 #: kdecore/TIMEZONES:1229 12411 #, kde-format 12412 msgid "MSK+01 - Ulyanovsk" 12413 msgstr "" 12414 12415 #: kdecore/TIMEZONES:1230 12416 #, kde-format 12417 msgid "Europe/Uzhgorod" 12418 msgstr "Urope/Uzhgorod" 12419 12420 #. i18n: comment to the previous timezone 12421 #: kdecore/TIMEZONES:1232 12422 #, kde-format 12423 msgid "Ruthenia" 12424 msgstr "" 12425 12426 #. i18n: comment to the previous timezone 12427 #: kdecore/TIMEZONES:1234 12428 #, kde-format 12429 msgid "Transcarpathia" 12430 msgstr "" 12431 12432 #: kdecore/TIMEZONES:1235 12433 #, kde-format 12434 msgid "Europe/Vaduz" 12435 msgstr "Urope/Vaduz" 12436 12437 #: kdecore/TIMEZONES:1236 12438 #, kde-format 12439 msgid "Europe/Vatican" 12440 msgstr "Urope/Vatican" 12441 12442 #: kdecore/TIMEZONES:1237 12443 #, kde-format 12444 msgid "Europe/Vienna" 12445 msgstr "Urope/Wîne" 12446 12447 #: kdecore/TIMEZONES:1238 12448 #, kde-format 12449 msgid "Europe/Vilnius" 12450 msgstr "Urope/Vilnius" 12451 12452 #: kdecore/TIMEZONES:1239 12453 #, fuzzy, kde-format 12454 #| msgid "Europe/Belgrade" 12455 msgid "Europe/Volgograd" 12456 msgstr "Urope/Belgråde" 12457 12458 #. i18n: comment to the previous timezone 12459 #: kdecore/TIMEZONES:1241 12460 #, kde-format 12461 msgid "Moscow+00 - Caspian Sea" 12462 msgstr "" 12463 12464 #. i18n: comment to the previous timezone 12465 #: kdecore/TIMEZONES:1243 12466 #, kde-format 12467 msgid "MSK+00 - Volgograd" 12468 msgstr "" 12469 12470 #: kdecore/TIMEZONES:1244 12471 #, kde-format 12472 msgid "Europe/Warsaw" 12473 msgstr "Urope/Warsaw" 12474 12475 #: kdecore/TIMEZONES:1245 12476 #, kde-format 12477 msgid "Europe/Zagreb" 12478 msgstr "Urope/Zagreb" 12479 12480 #: kdecore/TIMEZONES:1246 12481 #, kde-format 12482 msgid "Europe/Zaporozhye" 12483 msgstr "Urope/Zaporozhye" 12484 12485 #. i18n: comment to the previous timezone 12486 #: kdecore/TIMEZONES:1248 12487 #, kde-format 12488 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12489 msgstr "" 12490 12491 #. i18n: comment to the previous timezone 12492 #: kdecore/TIMEZONES:1250 12493 #, kde-format 12494 msgid "Zaporozhye and east Lugansk" 12495 msgstr "" 12496 12497 #: kdecore/TIMEZONES:1251 12498 #, kde-format 12499 msgid "Europe/Zurich" 12500 msgstr "Urope/Zurich" 12501 12502 #: kdecore/TIMEZONES:1252 12503 #, fuzzy, kde-format 12504 #| msgctxt "Indian National month 6 - KLocale::NarrowName" 12505 #| msgid "B" 12506 msgid "GB" 12507 msgstr "B" 12508 12509 #: kdecore/TIMEZONES:1253 12510 #, kde-format 12511 msgid "GB-Eire" 12512 msgstr "" 12513 12514 #: kdecore/TIMEZONES:1254 12515 #, fuzzy, kde-format 12516 #| msgid "Asia/Hong_Kong" 12517 msgid "Hongkong" 12518 msgstr "Azeye/Hong_Kong" 12519 12520 #: kdecore/TIMEZONES:1255 12521 #, kde-format 12522 msgid "Iceland" 12523 msgstr "" 12524 12525 #: kdecore/TIMEZONES:1256 12526 #, kde-format 12527 msgid "Indian/Antananarivo" 12528 msgstr "Oceyan Indyin/Antananarivo" 12529 12530 #: kdecore/TIMEZONES:1257 12531 #, kde-format 12532 msgid "Indian/Chagos" 12533 msgstr "Oceyan Indyin/Chagos" 12534 12535 #: kdecore/TIMEZONES:1258 12536 #, kde-format 12537 msgid "Indian/Christmas" 12538 msgstr "Oceyan Indyin/Christmas" 12539 12540 #: kdecore/TIMEZONES:1259 12541 #, kde-format 12542 msgid "Indian/Cocos" 12543 msgstr "Oceyan Indyin/Cocos" 12544 12545 #: kdecore/TIMEZONES:1260 12546 #, kde-format 12547 msgid "Indian/Comoro" 12548 msgstr "Oceyan Indyin/Comoro" 12549 12550 #: kdecore/TIMEZONES:1261 12551 #, kde-format 12552 msgid "Indian/Kerguelen" 12553 msgstr "Oceyan Indyin/Kerguelen" 12554 12555 #: kdecore/TIMEZONES:1262 12556 #, kde-format 12557 msgid "Indian/Mahe" 12558 msgstr "Oceyan Indyin/Mahe" 12559 12560 #: kdecore/TIMEZONES:1263 12561 #, kde-format 12562 msgid "Indian/Maldives" 12563 msgstr "Oceyan Indyin/Maldives" 12564 12565 #: kdecore/TIMEZONES:1264 12566 #, kde-format 12567 msgid "Indian/Mauritius" 12568 msgstr "Oceyan Indyin/Mauritius" 12569 12570 #: kdecore/TIMEZONES:1265 12571 #, kde-format 12572 msgid "Indian/Mayotte" 12573 msgstr "Oceyan Indyin/Mayotte" 12574 12575 #: kdecore/TIMEZONES:1266 12576 #, kde-format 12577 msgid "Indian/Reunion" 12578 msgstr "Oceyan Indyin/Reunion" 12579 12580 #: kdecore/TIMEZONES:1267 12581 #, kde-format 12582 msgid "Iran" 12583 msgstr "" 12584 12585 #: kdecore/TIMEZONES:1268 12586 #, fuzzy, kde-format 12587 #| msgid "Pacific/Kosrae" 12588 msgid "Israel" 12589 msgstr "Oceyan Pacifike/Kosrae" 12590 12591 #: kdecore/TIMEZONES:1269 12592 #, fuzzy, kde-format 12593 #| msgid "America/Jamaica" 12594 msgid "Jamaica" 12595 msgstr "Amerike/Jamaica" 12596 12597 #: kdecore/TIMEZONES:1270 12598 #, fuzzy, kde-format 12599 #| msgctxt "@item Calendar system" 12600 #| msgid "Japanese" 12601 msgid "Japan" 12602 msgstr "Djaponès" 12603 12604 #. i18n: comment to the previous timezone 12605 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12606 #, fuzzy, kde-format 12607 #| msgid "Pacific/Kwajalein" 12608 msgid "Kwajalein" 12609 msgstr "Oceyan Pacifike/Kwajalein" 12610 12611 #: kdecore/TIMEZONES:1274 12612 #, kde-format 12613 msgid "Libya" 12614 msgstr "" 12615 12616 #: kdecore/TIMEZONES:1275 12617 #, kde-format 12618 msgid "Mexico/BajaNorte" 12619 msgstr "" 12620 12621 #: kdecore/TIMEZONES:1278 12622 #, kde-format 12623 msgid "Mexico/BajaSur" 12624 msgstr "" 12625 12626 #: kdecore/TIMEZONES:1281 12627 #, kde-format 12628 msgid "Mexico/General" 12629 msgstr "" 12630 12631 #: kdecore/TIMEZONES:1284 12632 #, fuzzy, kde-format 12633 #| msgctxt "Gregorian month 11 - KLocale::NarrowName" 12634 #| msgid "N" 12635 msgid "NZ" 12636 msgstr "N" 12637 12638 #: kdecore/TIMEZONES:1287 12639 #, kde-format 12640 msgid "NZ-CHAT" 12641 msgstr "" 12642 12643 #. i18n: comment to the previous timezone 12644 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12645 #, kde-format 12646 msgid "Chatham Islands" 12647 msgstr "" 12648 12649 #: kdecore/TIMEZONES:1290 12650 #, kde-format 12651 msgid "Navajo" 12652 msgstr "" 12653 12654 #: kdecore/TIMEZONES:1293 12655 #, fuzzy, kde-format 12656 #| msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 12657 #| msgid "ROC" 12658 msgid "PRC" 12659 msgstr "RDCh" 12660 12661 #: kdecore/TIMEZONES:1296 12662 #, kde-format 12663 msgid "Pacific/Apia" 12664 msgstr "Oceyan Pacifike/Apia" 12665 12666 #: kdecore/TIMEZONES:1297 12667 #, kde-format 12668 msgid "Pacific/Auckland" 12669 msgstr "Oceyan Pacifike/Auckland" 12670 12671 #. i18n: comment to the previous timezone 12672 #: kdecore/TIMEZONES:1301 12673 #, kde-format 12674 msgid "New Zealand (most areas)" 12675 msgstr "" 12676 12677 #: kdecore/TIMEZONES:1302 12678 #, fuzzy, kde-format 12679 #| msgid "Pacific/Honolulu" 12680 msgid "Pacific/Bougainville" 12681 msgstr "Oceyan Pacifike/Honolulu" 12682 12683 #. i18n: comment to the previous timezone 12684 #: kdecore/TIMEZONES:1304 12685 #, kde-format 12686 msgid "Bougainville" 12687 msgstr "" 12688 12689 #: kdecore/TIMEZONES:1305 12690 #, kde-format 12691 msgid "Pacific/Chatham" 12692 msgstr "Oceyan Pacifike/Chatham" 12693 12694 #: kdecore/TIMEZONES:1308 12695 #, fuzzy, kde-format 12696 #| msgid "Pacific/Truk" 12697 msgid "Pacific/Chuuk" 12698 msgstr "Oceyan Pacifike/Truk" 12699 12700 #. i18n: comment to the previous timezone 12701 #: kdecore/TIMEZONES:1310 12702 #, kde-format 12703 msgid "Chuuk (Truk) and Yap" 12704 msgstr "" 12705 12706 #. i18n: comment to the previous timezone 12707 #: kdecore/TIMEZONES:1312 12708 #, kde-format 12709 msgid "Chuuk/Truk, Yap" 12710 msgstr "" 12711 12712 #: kdecore/TIMEZONES:1313 12713 #, kde-format 12714 msgid "Pacific/Easter" 12715 msgstr "Oceyan Pacifike/Easter" 12716 12717 #. i18n: comment to the previous timezone 12718 #: kdecore/TIMEZONES:1317 12719 #, fuzzy, kde-format 12720 #| msgctxt "digit set" 12721 #| msgid "Eastern Arabic-Indic" 12722 msgid "Easter Island" 12723 msgstr "Arabe-Indyin do Levant" 12724 12725 #: kdecore/TIMEZONES:1318 12726 #, kde-format 12727 msgid "Pacific/Efate" 12728 msgstr "Oceyan Pacifike/Efate" 12729 12730 #: kdecore/TIMEZONES:1319 12731 #, kde-format 12732 msgid "Pacific/Enderbury" 12733 msgstr "Oceyan Pacifike/Enderbury" 12734 12735 #. i18n: comment to the previous timezone 12736 #: kdecore/TIMEZONES:1321 12737 #, kde-format 12738 msgid "Phoenix Islands" 12739 msgstr "" 12740 12741 #: kdecore/TIMEZONES:1322 12742 #, kde-format 12743 msgid "Pacific/Fakaofo" 12744 msgstr "Oceyan Pacifike/Fakaofo" 12745 12746 #: kdecore/TIMEZONES:1323 12747 #, kde-format 12748 msgid "Pacific/Fiji" 12749 msgstr "Oceyan Pacifike/Fiji" 12750 12751 #: kdecore/TIMEZONES:1324 12752 #, kde-format 12753 msgid "Pacific/Funafuti" 12754 msgstr "Oceyan Pacifike/Funafuti" 12755 12756 #: kdecore/TIMEZONES:1325 12757 #, kde-format 12758 msgid "Pacific/Galapagos" 12759 msgstr "Oceyan Pacifike/Galapagos" 12760 12761 #. i18n: comment to the previous timezone 12762 #: kdecore/TIMEZONES:1327 12763 #, kde-format 12764 msgid "Galapagos Islands" 12765 msgstr "" 12766 12767 #: kdecore/TIMEZONES:1328 12768 #, kde-format 12769 msgid "Pacific/Gambier" 12770 msgstr "Oceyan Pacifike/Gambier" 12771 12772 #. i18n: comment to the previous timezone 12773 #: kdecore/TIMEZONES:1330 12774 #, kde-format 12775 msgid "Gambier Islands" 12776 msgstr "" 12777 12778 #: kdecore/TIMEZONES:1331 12779 #, kde-format 12780 msgid "Pacific/Guadalcanal" 12781 msgstr "Oceyan Pacifike/Guadalcanal" 12782 12783 #: kdecore/TIMEZONES:1332 12784 #, kde-format 12785 msgid "Pacific/Guam" 12786 msgstr "Oceyan Pacifike/Guam" 12787 12788 #: kdecore/TIMEZONES:1333 12789 #, kde-format 12790 msgid "Pacific/Honolulu" 12791 msgstr "Oceyan Pacifike/Honolulu" 12792 12793 #. i18n: comment to the previous timezone 12794 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 12795 #, kde-format 12796 msgid "Hawaii" 12797 msgstr "" 12798 12799 #: kdecore/TIMEZONES:1336 12800 #, kde-format 12801 msgid "Pacific/Johnston" 12802 msgstr "Oceyan Pacifike/Johnston" 12803 12804 #. i18n: comment to the previous timezone 12805 #: kdecore/TIMEZONES:1338 12806 #, kde-format 12807 msgid "Johnston Atoll" 12808 msgstr "" 12809 12810 #: kdecore/TIMEZONES:1339 12811 #, kde-format 12812 msgid "Pacific/Kiritimati" 12813 msgstr "Oceyan Pacifike/Kiritimati" 12814 12815 #. i18n: comment to the previous timezone 12816 #: kdecore/TIMEZONES:1341 12817 #, kde-format 12818 msgid "Line Islands" 12819 msgstr "" 12820 12821 #: kdecore/TIMEZONES:1342 12822 #, kde-format 12823 msgid "Pacific/Kosrae" 12824 msgstr "Oceyan Pacifike/Kosrae" 12825 12826 #. i18n: comment to the previous timezone 12827 #: kdecore/TIMEZONES:1344 12828 #, fuzzy, kde-format 12829 #| msgid "Pacific/Kosrae" 12830 msgid "Kosrae" 12831 msgstr "Oceyan Pacifike/Kosrae" 12832 12833 #: kdecore/TIMEZONES:1345 12834 #, kde-format 12835 msgid "Pacific/Kwajalein" 12836 msgstr "Oceyan Pacifike/Kwajalein" 12837 12838 #: kdecore/TIMEZONES:1348 12839 #, kde-format 12840 msgid "Pacific/Majuro" 12841 msgstr "Oceyan Pacifike/Majuro" 12842 12843 #. i18n: comment to the previous timezone 12844 #: kdecore/TIMEZONES:1352 12845 #, kde-format 12846 msgid "Marshall Islands (most areas)" 12847 msgstr "" 12848 12849 #: kdecore/TIMEZONES:1353 12850 #, kde-format 12851 msgid "Pacific/Marquesas" 12852 msgstr "Oceyan Pacifike/Marquesas" 12853 12854 #. i18n: comment to the previous timezone 12855 #: kdecore/TIMEZONES:1355 12856 #, kde-format 12857 msgid "Marquesas Islands" 12858 msgstr "" 12859 12860 #: kdecore/TIMEZONES:1356 12861 #, kde-format 12862 msgid "Pacific/Midway" 12863 msgstr "Oceyan Pacifike/Midway" 12864 12865 #. i18n: comment to the previous timezone 12866 #: kdecore/TIMEZONES:1358 12867 #, kde-format 12868 msgid "Midway Islands" 12869 msgstr "" 12870 12871 #: kdecore/TIMEZONES:1359 12872 #, kde-format 12873 msgid "Pacific/Nauru" 12874 msgstr "Oceyan Pacifike/Nauru" 12875 12876 #: kdecore/TIMEZONES:1360 12877 #, kde-format 12878 msgid "Pacific/Niue" 12879 msgstr "Oceyan Pacifike/Niue" 12880 12881 #: kdecore/TIMEZONES:1361 12882 #, kde-format 12883 msgid "Pacific/Norfolk" 12884 msgstr "Oceyan Pacifike/Norfolk" 12885 12886 #: kdecore/TIMEZONES:1362 12887 #, kde-format 12888 msgid "Pacific/Noumea" 12889 msgstr "Oceyan Pacifike/Noumea" 12890 12891 #: kdecore/TIMEZONES:1363 12892 #, kde-format 12893 msgid "Pacific/Pago_Pago" 12894 msgstr "Oceyan Pacifike/Pago_Pago" 12895 12896 #: kdecore/TIMEZONES:1364 12897 #, kde-format 12898 msgid "Pacific/Palau" 12899 msgstr "Oceyan Pacifike/Palau" 12900 12901 #: kdecore/TIMEZONES:1365 12902 #, kde-format 12903 msgid "Pacific/Pitcairn" 12904 msgstr "Oceyan Pacifike/Pitcairn" 12905 12906 #: kdecore/TIMEZONES:1366 12907 #, fuzzy, kde-format 12908 #| msgid "Pacific/Ponape" 12909 msgid "Pacific/Pohnpei" 12910 msgstr "Oceyan Pacifike/Ponape" 12911 12912 #. i18n: comment to the previous timezone 12913 #: kdecore/TIMEZONES:1368 12914 #, kde-format 12915 msgid "Pohnpei (Ponape)" 12916 msgstr "" 12917 12918 #. i18n: comment to the previous timezone 12919 #: kdecore/TIMEZONES:1370 12920 #, fuzzy, kde-format 12921 #| msgid "Pacific/Ponape" 12922 msgid "Pohnpei/Ponape" 12923 msgstr "Oceyan Pacifike/Ponape" 12924 12925 #: kdecore/TIMEZONES:1371 12926 #, kde-format 12927 msgid "Pacific/Ponape" 12928 msgstr "Oceyan Pacifike/Ponape" 12929 12930 #. i18n: comment to the previous timezone 12931 #: kdecore/TIMEZONES:1373 12932 #, kde-format 12933 msgid "Ponape (Pohnpei)" 12934 msgstr "" 12935 12936 #: kdecore/TIMEZONES:1374 12937 #, kde-format 12938 msgid "Pacific/Port_Moresby" 12939 msgstr "Oceyan Pacifike/Port_Moresby" 12940 12941 #. i18n: comment to the previous timezone 12942 #: kdecore/TIMEZONES:1376 12943 #, kde-format 12944 msgid "Papua New Guinea (most areas)" 12945 msgstr "" 12946 12947 #: kdecore/TIMEZONES:1377 12948 #, kde-format 12949 msgid "Pacific/Rarotonga" 12950 msgstr "Oceyan Pacifike/Rarotonga" 12951 12952 #: kdecore/TIMEZONES:1378 12953 #, kde-format 12954 msgid "Pacific/Saipan" 12955 msgstr "Oceyan Pacifike/Saipan" 12956 12957 #: kdecore/TIMEZONES:1379 12958 #, fuzzy, kde-format 12959 #| msgid "Pacific/Saipan" 12960 msgid "Pacific/Samoa" 12961 msgstr "Oceyan Pacifike/Saipan" 12962 12963 #: kdecore/TIMEZONES:1380 12964 #, kde-format 12965 msgid "Pacific/Tahiti" 12966 msgstr "Oceyan Pacifike/Tahiti" 12967 12968 #. i18n: comment to the previous timezone 12969 #: kdecore/TIMEZONES:1382 12970 #, kde-format 12971 msgid "Society Islands" 12972 msgstr "" 12973 12974 #: kdecore/TIMEZONES:1383 12975 #, kde-format 12976 msgid "Pacific/Tarawa" 12977 msgstr "Oceyan Pacifike/Tarawa" 12978 12979 #. i18n: comment to the previous timezone 12980 #: kdecore/TIMEZONES:1385 12981 #, kde-format 12982 msgid "Gilbert Islands" 12983 msgstr "" 12984 12985 #: kdecore/TIMEZONES:1386 12986 #, kde-format 12987 msgid "Pacific/Tongatapu" 12988 msgstr "Oceyan Pacifike/Tongatapu" 12989 12990 #: kdecore/TIMEZONES:1387 12991 #, kde-format 12992 msgid "Pacific/Truk" 12993 msgstr "Oceyan Pacifike/Truk" 12994 12995 #. i18n: comment to the previous timezone 12996 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 12997 #, kde-format 12998 msgid "Truk (Chuuk) and Yap" 12999 msgstr "" 13000 13001 #: kdecore/TIMEZONES:1390 13002 #, kde-format 13003 msgid "Pacific/Wake" 13004 msgstr "Oceyan Pacifike/Wake" 13005 13006 #. i18n: comment to the previous timezone 13007 #: kdecore/TIMEZONES:1392 13008 #, kde-format 13009 msgid "Wake Island" 13010 msgstr "" 13011 13012 #: kdecore/TIMEZONES:1393 13013 #, kde-format 13014 msgid "Pacific/Wallis" 13015 msgstr "Oceyan Pacifike/Wallis" 13016 13017 #: kdecore/TIMEZONES:1394 13018 #, kde-format 13019 msgid "Pacific/Yap" 13020 msgstr "Oceyan Pacifike/Yap" 13021 13022 #: kdecore/TIMEZONES:1397 13023 #, kde-format 13024 msgid "Poland" 13025 msgstr "" 13026 13027 #: kdecore/TIMEZONES:1398 13028 #, kde-format 13029 msgid "Portugal" 13030 msgstr "" 13031 13032 #: kdecore/TIMEZONES:1401 13033 #, fuzzy, kde-format 13034 #| msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 13035 #| msgid "ROC" 13036 msgid "ROC" 13037 msgstr "RDCh" 13038 13039 #: kdecore/TIMEZONES:1402 13040 #, fuzzy, kde-format 13041 #| msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 13042 #| msgid "ROC" 13043 msgid "ROK" 13044 msgstr "RDCh" 13045 13046 #: kdecore/TIMEZONES:1403 13047 #, fuzzy, kde-format 13048 #| msgid "Asia/Singapore" 13049 msgid "Singapore" 13050 msgstr "Azeye/Singapore" 13051 13052 #: kdecore/TIMEZONES:1404 13053 #, kde-format 13054 msgid "Turkey" 13055 msgstr "" 13056 13057 #: kdecore/TIMEZONES:1405 13058 #, kde-format 13059 msgid "US/Alaska" 13060 msgstr "" 13061 13062 #: kdecore/TIMEZONES:1408 13063 #, kde-format 13064 msgid "US/Aleutian" 13065 msgstr "" 13066 13067 #: kdecore/TIMEZONES:1411 13068 #, kde-format 13069 msgid "US/Arizona" 13070 msgstr "" 13071 13072 #: kdecore/TIMEZONES:1414 13073 #, kde-format 13074 msgid "US/Central" 13075 msgstr "" 13076 13077 #: kdecore/TIMEZONES:1417 13078 #, kde-format 13079 msgid "US/East-Indiana" 13080 msgstr "" 13081 13082 #: kdecore/TIMEZONES:1420 13083 #, kde-format 13084 msgid "US/Eastern" 13085 msgstr "" 13086 13087 #: kdecore/TIMEZONES:1423 13088 #, kde-format 13089 msgid "US/Hawaii" 13090 msgstr "" 13091 13092 #: kdecore/TIMEZONES:1426 13093 #, kde-format 13094 msgid "US/Indiana-Starke" 13095 msgstr "" 13096 13097 #: kdecore/TIMEZONES:1429 13098 #, kde-format 13099 msgid "US/Michigan" 13100 msgstr "" 13101 13102 #: kdecore/TIMEZONES:1432 13103 #, kde-format 13104 msgid "US/Mountain" 13105 msgstr "" 13106 13107 #: kdecore/TIMEZONES:1435 13108 #, fuzzy, kde-format 13109 #| msgid "Pacific/Yap" 13110 msgid "US/Pacific" 13111 msgstr "Oceyan Pacifike/Yap" 13112 13113 #: kdecore/TIMEZONES:1438 13114 #, kde-format 13115 msgid "US/Samoa" 13116 msgstr "" 13117 13118 #: kdecore/TIMEZONES:1439 13119 #, kde-format 13120 msgid "W-SU" 13121 msgstr "" 13122 13123 #. i18n: Generic sans serif font presented in font choosers. When selected, 13124 #. the system will choose a real font, mandated by distro settings. 13125 #: kdeui/fonthelpers.cpp:29 13126 #, kde-format 13127 msgctxt "@item Font name" 13128 msgid "Sans Serif" 13129 msgstr "Sans Serif" 13130 13131 #. i18n: Generic serif font presented in font choosers. When selected, 13132 #. the system will choose a real font, mandated by distro settings. 13133 #: kdeui/fonthelpers.cpp:32 13134 #, kde-format 13135 msgctxt "@item Font name" 13136 msgid "Serif" 13137 msgstr "Serif" 13138 13139 #. i18n: Generic monospace font presented in font choosers. When selected, 13140 #. the system will choose a real font, mandated by distro settings. 13141 #: kdeui/fonthelpers.cpp:35 13142 #, kde-format 13143 msgctxt "@item Font name" 13144 msgid "Monospace" 13145 msgstr "Monospace" 13146 13147 #: kdeui/k4timezonewidget.cpp:62 13148 #, kde-format 13149 msgctxt "Define an area in the time zone, like a town area" 13150 msgid "Area" 13151 msgstr "Aviè" 13152 13153 #: kdeui/k4timezonewidget.cpp:62 13154 #, kde-format 13155 msgctxt "Time zone" 13156 msgid "Region" 13157 msgstr "Redjon" 13158 13159 #: kdeui/k4timezonewidget.cpp:62 13160 #, fuzzy, kde-format 13161 msgid "Comment" 13162 msgstr "Rawete" 13163 13164 #: kdeui/kapplication.cpp:741 13165 #, kde-format 13166 msgid "The style '%1' was not found" 13167 msgstr "Li stîle « %1 » n' a nén stî trové" 13168 13169 #: kdeui/kcolordialog.cpp:102 13170 #, kde-format 13171 msgctxt "palette name" 13172 msgid "* Recent Colors *" 13173 msgstr "* Dierinnès Coleurs *" 13174 13175 #: kdeui/kcolordialog.cpp:103 13176 #, kde-format 13177 msgctxt "palette name" 13178 msgid "* Custom Colors *" 13179 msgstr "* Coleurs da vosse *" 13180 13181 #: kdeui/kcolordialog.cpp:104 13182 #, kde-format 13183 msgctxt "palette name" 13184 msgid "Forty Colors" 13185 msgstr "Coleurs Forty" 13186 13187 #: kdeui/kcolordialog.cpp:105 13188 #, kde-format 13189 msgctxt "palette name" 13190 msgid "Oxygen Colors" 13191 msgstr "Coleurs Ocsidjinne" 13192 13193 #: kdeui/kcolordialog.cpp:106 13194 #, kde-format 13195 msgctxt "palette name" 13196 msgid "Rainbow Colors" 13197 msgstr "Coleurs di l' airdiè" 13198 13199 #: kdeui/kcolordialog.cpp:107 13200 #, kde-format 13201 msgctxt "palette name" 13202 msgid "Royal Colors" 13203 msgstr "Rweyålès coleurs" 13204 13205 #: kdeui/kcolordialog.cpp:108 13206 #, kde-format 13207 msgctxt "palette name" 13208 msgid "Web Colors" 13209 msgstr "Coleurs waibe" 13210 13211 #: kdeui/kcolordialog.cpp:572 13212 #, kde-format 13213 msgid "Named Colors" 13214 msgstr "Coleurs lomêyes" 13215 13216 #: kdeui/kcolordialog.cpp:746 13217 #, kde-format 13218 msgctxt "" 13219 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13220 "them)" 13221 msgid "" 13222 "Unable to read X11 RGB color strings. The following file location was " 13223 "examined:\n" 13224 "%2" 13225 msgid_plural "" 13226 "Unable to read X11 RGB color strings. The following file locations were " 13227 "examined:\n" 13228 "%2" 13229 msgstr[0] "" 13230 msgstr[1] "" 13231 13232 #: kdeui/kcolordialog.cpp:997 13233 #, kde-format 13234 msgid "Select Color" 13235 msgstr "Tchoezi l' coleur" 13236 13237 #: kdeui/kcolordialog.cpp:1077 13238 #, kde-format 13239 msgid "Hue:" 13240 msgstr "Tinte:" 13241 13242 #: kdeui/kcolordialog.cpp:1083 13243 #, kde-format 13244 msgctxt "The angular degree unit (for hue)" 13245 msgid "°" 13246 msgstr "°" 13247 13248 #: kdeui/kcolordialog.cpp:1088 13249 #, fuzzy, kde-format 13250 #| msgctxt "Gregorian weekday 6 - KLocale::LongName" 13251 #| msgid "Saturday" 13252 msgid "Saturation:" 13253 msgstr "Semdi" 13254 13255 #: kdeui/kcolordialog.cpp:1098 13256 #, kde-format 13257 msgctxt "This is the V of HSV" 13258 msgid "Value:" 13259 msgstr "Valixhance :" 13260 13261 #: kdeui/kcolordialog.cpp:1111 13262 #, kde-format 13263 msgid "Red:" 13264 msgstr "Rodje :" 13265 13266 #: kdeui/kcolordialog.cpp:1121 13267 #, kde-format 13268 msgid "Green:" 13269 msgstr "Vert :" 13270 13271 #: kdeui/kcolordialog.cpp:1131 13272 #, kde-format 13273 msgid "Blue:" 13274 msgstr "Bleu :" 13275 13276 #: kdeui/kcolordialog.cpp:1152 13277 #, kde-format 13278 msgid "Alpha:" 13279 msgstr "Alfa :" 13280 13281 #: kdeui/kcolordialog.cpp:1206 13282 #, kde-format 13283 msgid "&Add to Custom Colors" 13284 msgstr "&Radjouter ås coleurs da vosse" 13285 13286 #: kdeui/kcolordialog.cpp:1234 13287 #, kde-format 13288 msgid "Name:" 13289 msgstr "No:" 13290 13291 #: kdeui/kcolordialog.cpp:1241 13292 #, kde-format 13293 msgid "HTML:" 13294 msgstr "HTML:" 13295 13296 #: kdeui/kcolordialog.cpp:1328 13297 #, kde-format 13298 msgid "Default color" 13299 msgstr "Prémetowe coleur" 13300 13301 #: kdeui/kcolordialog.cpp:1393 13302 #, kde-format 13303 msgid "-default-" 13304 msgstr "-prémetou-" 13305 13306 #: kdeui/kcolordialog.cpp:1668 13307 #, kde-format 13308 msgid "-unnamed-" 13309 msgstr "-sins no-" 13310 13311 #: kdeui/kdeprintdialog.cpp:40 13312 #, kde-format 13313 msgctxt "@title:window" 13314 msgid "Print" 13315 msgstr "Imprimer" 13316 13317 #: kdeui/kdialog.cpp:271 13318 #, kde-format 13319 msgid "&Try" 13320 msgstr "&Sayî" 13321 13322 #: kdeui/kdialog.cpp:484 13323 #, kde-format 13324 msgid "modified" 13325 msgstr "candjî" 13326 13327 #: kdeui/kdialog.cpp:495 13328 #, kde-format 13329 msgctxt "Document/application separator in titlebar" 13330 msgid " – " 13331 msgstr " – " 13332 13333 #: kdeui/kdialog.cpp:896 13334 #, kde-format 13335 msgid "&Details" 13336 msgstr "&Po les spepieus" 13337 13338 #: kdeui/kdialog.cpp:1054 13339 #, kde-format 13340 msgid "Get help..." 13341 msgstr "Aidance..." 13342 13343 #: kdeui/keditlistbox.cpp:324 13344 #, kde-format 13345 msgid "&Add" 13346 msgstr "R&adjouter" 13347 13348 #: kdeui/keditlistbox.cpp:336 13349 #, kde-format 13350 msgid "&Remove" 13351 msgstr "&Oister" 13352 13353 #: kdeui/keditlistbox.cpp:348 13354 #, kde-format 13355 msgid "Move &Up" 13356 msgstr "&Monter" 13357 13358 #: kdeui/keditlistbox.cpp:353 13359 #, kde-format 13360 msgid "Move &Down" 13361 msgstr "&Dischinde" 13362 13363 #. i18n: A shorter version of the alphabet test phrase translated in 13364 #. another message. It is displayed in the dropdown list of font previews 13365 #. (the font selection combo box), so keep it under the length equivalent 13366 #. to 60 or so proportional Latin characters. 13367 #: kdeui/kfontcombobox.cpp:48 13368 #, kde-format 13369 msgctxt "short" 13370 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13371 msgstr "" 13372 "Mi trûte a les balzins, co pés ki l' grijhe cawe di m' pôve fayé vexhåd!" 13373 13374 #. i18n: Integer which indicates the script you used in the sample text 13375 #. for font previews in your language. For the possible values, see 13376 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13377 #. If the sample text contains several scripts, their IDs can be given 13378 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13379 #: kdeui/kfontcombobox.cpp:119 13380 #, kde-format 13381 msgctxt "Numeric IDs of scripts for font previews" 13382 msgid "1" 13383 msgstr "1" 13384 13385 #: kdeui/kfontdialog.cpp:51 13386 #, kde-format 13387 msgid "Select Font" 13388 msgstr "Tchoezi fonte" 13389 13390 #: kdeui/kprintpreview.cpp:118 13391 #, kde-format 13392 msgid "Could not load print preview part" 13393 msgstr "Dji n' a savou tcherdjî l' pårt di prévoeyaedje d' imprimaedje" 13394 13395 #: kdeui/kprintpreview.cpp:135 13396 #, kde-format 13397 msgid "Print Preview" 13398 msgstr "Voeyaedje divant d' imprimer" 13399 13400 #: kdeui/ksystemtrayicon.cpp:153 13401 #, kde-format 13402 msgid "Minimize" 13403 msgstr "Å pus ptit" 13404 13405 #: kdeui/ksystemtrayicon.cpp:205 13406 #, kde-format 13407 msgid "&Minimize" 13408 msgstr "Å pus &ptit" 13409 13410 #: kdeui/ksystemtrayicon.cpp:207 13411 #, kde-format 13412 msgid "&Restore" 13413 msgstr "&Rimete come divant" 13414 13415 #: kdeui/ksystemtrayicon.cpp:226 13416 #, kde-format 13417 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13418 msgstr "<qt>Estoz seur di voleur cwiter <b>%1</b>?</qt>" 13419 13420 #: kdeui/ksystemtrayicon.cpp:229 13421 #, kde-format 13422 msgid "Confirm Quit From System Tray" 13423 msgstr "Acertiner di cwiter del boesse ås imådjetes" 13424 13425 #: kdeui/kundostack.cpp:47 13426 #, kde-format 13427 msgid "Redo" 13428 msgstr "Rifé" 13429 13430 #: kdeui/kundostack.cpp:66 13431 #, kde-format 13432 msgid "Undo" 13433 msgstr "Disfé" 13434 13435 #: kdeui/kuniqueapplication.cpp:79 13436 #, kde-format 13437 msgid "Do not run in the background." 13438 msgstr "Èn nén enonder come bouye di fond." 13439 13440 #: kdeui/kuniqueapplication.cpp:81 13441 #, kde-format 13442 msgid "Internally added if launched from Finder" 13443 msgstr "" 13444 13445 #: kio/kcommentwidget.cpp:68 13446 #, fuzzy, kde-format 13447 #| msgid "Add Entry..." 13448 msgctxt "@label" 13449 msgid "Add Comment..." 13450 msgstr "Radjouter intrêye..." 13451 13452 #: kio/kcommentwidget.cpp:74 13453 #, kde-format 13454 msgctxt "@label" 13455 msgid "Change..." 13456 msgstr "Candjî..." 13457 13458 #: kio/kcommentwidget.cpp:128 13459 #, fuzzy, kde-format 13460 #| msgid "Comment" 13461 msgctxt "@title:window" 13462 msgid "Change Comment" 13463 msgstr "Rawete" 13464 13465 #: kio/kcommentwidget.cpp:129 13466 #, fuzzy, kde-format 13467 #| msgid "Comment" 13468 msgctxt "@title:window" 13469 msgid "Add Comment" 13470 msgstr "Rawete" 13471 13472 #: kio/kdevicelistmodel.cpp:115 13473 #, kde-format 13474 msgid "Device name" 13475 msgstr "No d' l' éndjine" 13476 13477 #: kio/kdirselectdialog.cpp:136 13478 #, kde-format 13479 msgctxt "folder name" 13480 msgid "New Folder" 13481 msgstr "Novea ridant" 13482 13483 #: kio/kdirselectdialog.cpp:141 13484 #, kde-format 13485 msgctxt "@title:window" 13486 msgid "New Folder" 13487 msgstr "Novea ridant" 13488 13489 #: kio/kdirselectdialog.cpp:142 13490 #, kde-format 13491 msgctxt "@label:textbox" 13492 msgid "" 13493 "Create new folder in:\n" 13494 "%1" 13495 msgstr "" 13496 "Ahiver on novea ridant dins:\n" 13497 "%1" 13498 13499 #: kio/kdirselectdialog.cpp:172 13500 #, kde-format 13501 msgid "A file or folder named %1 already exists." 13502 msgstr "On fitchî ou on ridant.lomé %1 egzistêye dedja." 13503 13504 #: kio/kdirselectdialog.cpp:175 13505 #, kde-format 13506 msgid "You do not have permission to create that folder." 13507 msgstr "Vos n' avoz nén les bons droets po fé ci ridant la." 13508 13509 #: kio/kdirselectdialog.cpp:290 13510 #, kde-format 13511 msgctxt "@title:window" 13512 msgid "Select Folder" 13513 msgstr "Tchoezi ridant" 13514 13515 #: kio/kdirselectdialog.cpp:299 13516 #, kde-format 13517 msgctxt "@action:button" 13518 msgid "New Folder..." 13519 msgstr "Novea ridant..." 13520 13521 #: kio/kdirselectdialog.cpp:345 13522 #, kde-format 13523 msgctxt "@action:inmenu" 13524 msgid "New Folder..." 13525 msgstr "Novea ridant..." 13526 13527 #: kio/kdirselectdialog.cpp:352 13528 #, fuzzy, kde-format 13529 #| msgid "Move to Trash" 13530 msgctxt "@action:inmenu" 13531 msgid "Move to Trash" 13532 msgstr "Taper å batch" 13533 13534 #: kio/kdirselectdialog.cpp:359 13535 #, kde-format 13536 msgctxt "@action:inmenu" 13537 msgid "Delete" 13538 msgstr "Disfacer" 13539 13540 #: kio/kdirselectdialog.cpp:368 13541 #, kde-format 13542 msgctxt "@option:check" 13543 msgid "Show Hidden Folders" 13544 msgstr "Mostrer ridants catchîs" 13545 13546 #: kio/kdirselectdialog.cpp:375 13547 #, kde-format 13548 msgctxt "@action:inmenu" 13549 msgid "Properties" 13550 msgstr "Prôpietés" 13551 13552 #: kio/kfiledialog.cpp:132 13553 #, fuzzy, kde-format 13554 #| msgid "*|All Files" 13555 msgid "*|All files" 13556 msgstr "*|Tos les fitchîs" 13557 13558 #: kio/kfiledialog.cpp:332 13559 #, kde-format 13560 msgid "All Supported Files" 13561 msgstr "Tos les fitchîs sopoirtés" 13562 13563 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13564 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13565 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13566 #, kde-format 13567 msgid "Open" 13568 msgstr "Drovi" 13569 13570 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13571 #: kio/kfiledialog.cpp:838 13572 #, kde-format 13573 msgid "Save As" 13574 msgstr "Schaper et rlomer" 13575 13576 #: kio/kfilemetadataprovider.cpp:245 13577 #, kde-format 13578 msgctxt "@item:intable" 13579 msgid "%1 item" 13580 msgid_plural "%1 items" 13581 msgstr[0] "" 13582 msgstr[1] "" 13583 13584 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13585 #, fuzzy, kde-format 13586 msgctxt "@label" 13587 msgid "Comment" 13588 msgstr "Rawete" 13589 13590 #: kio/kfilemetadataprovider.cpp:447 13591 #, fuzzy, kde-format 13592 #| msgctxt "@title:column" 13593 #| msgid "Modified" 13594 msgctxt "@label" 13595 msgid "Modified" 13596 msgstr "Candjî" 13597 13598 #: kio/kfilemetadataprovider.cpp:448 13599 #, fuzzy, kde-format 13600 #| msgid "Owner" 13601 msgctxt "@label" 13602 msgid "Owner" 13603 msgstr "Prôpietaire" 13604 13605 #: kio/kfilemetadataprovider.cpp:449 13606 #, fuzzy, kde-format 13607 #| msgid "Permissions" 13608 msgctxt "@label" 13609 msgid "Permissions" 13610 msgstr "Droets" 13611 13612 #: kio/kfilemetadataprovider.cpp:450 13613 #, fuzzy, kde-format 13614 #| msgid "Sorting" 13615 msgctxt "@label" 13616 msgid "Rating" 13617 msgstr "Dji relî" 13618 13619 #: kio/kfilemetadataprovider.cpp:451 13620 #, fuzzy, kde-format 13621 #| msgid "Size" 13622 msgctxt "@label" 13623 msgid "Size" 13624 msgstr "Grandeu" 13625 13626 #: kio/kfilemetadataprovider.cpp:452 13627 #, fuzzy, kde-format 13628 #| msgid "Trash" 13629 msgctxt "@label" 13630 msgid "Tags" 13631 msgstr "Batch" 13632 13633 #: kio/kfilemetadataprovider.cpp:453 13634 #, fuzzy, kde-format 13635 #| msgid "Size:" 13636 msgctxt "@label" 13637 msgid "Total Size" 13638 msgstr "Grandeu:" 13639 13640 #: kio/kfilemetadataprovider.cpp:454 13641 #, fuzzy, kde-format 13642 #| msgid "Type" 13643 msgctxt "@label" 13644 msgid "Type" 13645 msgstr "Sôre" 13646 13647 #: kio/kfilemetadatareaderprocess.cpp:234 13648 #, kde-format 13649 msgid "KFileMetaDataReader" 13650 msgstr "" 13651 13652 #: kio/kfilemetadatareaderprocess.cpp:236 13653 #, kde-format 13654 msgid "KFileMetaDataReader can be used to read metadata from a file" 13655 msgstr "" 13656 13657 #: kio/kfilemetadatareaderprocess.cpp:238 13658 #, kde-format 13659 msgid "(C) 2011, Peter Penz" 13660 msgstr "" 13661 13662 #: kio/kfilemetadatareaderprocess.cpp:239 13663 #, kde-format 13664 msgid "Peter Penz" 13665 msgstr "" 13666 13667 #: kio/kfilemetadatareaderprocess.cpp:239 13668 #, kde-format 13669 msgid "Current maintainer" 13670 msgstr "" 13671 13672 #: kio/kfilemetadatareaderprocess.cpp:244 13673 #, kde-format 13674 msgid "Only the meta data that is part of the file is read" 13675 msgstr "" 13676 13677 #: kio/kfilemetadatareaderprocess.cpp:245 13678 #, kde-format 13679 msgid "List of URLs where the meta-data should be read from" 13680 msgstr "" 13681 13682 #: kio/kfilemetainfowidget.cpp:161 13683 #, kde-format 13684 msgid "<Error>" 13685 msgstr "<Aroke>" 13686 13687 #: kio/kfiletreeview.cpp:192 13688 #, kde-format 13689 msgid "Show Hidden Folders" 13690 msgstr "Mostrer ridants catchîs" 13691 13692 #: kio/kimageio.cpp:46 13693 #, kde-format 13694 msgid "All Pictures" 13695 msgstr "Totes les imådjes" 13696 13697 #: kio/kmetaprops.cpp:57 13698 #, kde-format 13699 msgctxt "@title:window" 13700 msgid "Configure Shown Data" 13701 msgstr "" 13702 13703 #: kio/kmetaprops.cpp:60 13704 #, kde-format 13705 msgctxt "@label::textbox" 13706 msgid "Select which data should be shown:" 13707 msgstr "" 13708 13709 #: kio/kmetaprops.cpp:123 13710 #, fuzzy, kde-format 13711 #| msgid "Calculating..." 13712 msgctxt "@action:button" 13713 msgid "Configure..." 13714 msgstr "Dji carcule..." 13715 13716 #: kio/kmetaprops.cpp:133 13717 #, fuzzy, kde-format 13718 #| msgid "Information" 13719 msgctxt "@title:tab" 13720 msgid "Information" 13721 msgstr "Infôrmåcion" 13722 13723 #: kio/knfotranslator.cpp:40 13724 #, fuzzy, kde-format 13725 #| msgid "Created:" 13726 msgctxt "@label creation date" 13727 msgid "Created" 13728 msgstr "Fwait:" 13729 13730 #: kio/knfotranslator.cpp:41 13731 #, fuzzy, kde-format 13732 #| msgid "Size" 13733 msgctxt "@label file content size" 13734 msgid "Size" 13735 msgstr "Grandeu" 13736 13737 #: kio/knfotranslator.cpp:42 13738 #, kde-format 13739 msgctxt "@label file depends from" 13740 msgid "Depends" 13741 msgstr "" 13742 13743 #: kio/knfotranslator.cpp:43 13744 #, fuzzy, kde-format 13745 #| msgid "Description" 13746 msgctxt "@label" 13747 msgid "Description" 13748 msgstr "Discrijhaedje" 13749 13750 #: kio/knfotranslator.cpp:44 13751 #, fuzzy, kde-format 13752 #| msgid "&General" 13753 msgctxt "@label Software used to generate content" 13754 msgid "Generator" 13755 msgstr "&Djenerå" 13756 13757 #: kio/knfotranslator.cpp:45 13758 #, kde-format 13759 msgctxt "" 13760 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 13761 msgid "Has Part" 13762 msgstr "" 13763 13764 #: kio/knfotranslator.cpp:46 13765 #, kde-format 13766 msgctxt "" 13767 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 13768 "nie#hasLogicalPart" 13769 msgid "Has Logical Part" 13770 msgstr "" 13771 13772 #: kio/knfotranslator.cpp:47 13773 #, fuzzy, kde-format 13774 #| msgid "Parent Folder" 13775 msgctxt "@label parent directory" 13776 msgid "Part of" 13777 msgstr "Ridant parint" 13778 13779 #: kio/knfotranslator.cpp:48 13780 #, kde-format 13781 msgctxt "@label" 13782 msgid "Keyword" 13783 msgstr "" 13784 13785 #: kio/knfotranslator.cpp:49 13786 #, fuzzy, kde-format 13787 #| msgctxt "@title:column" 13788 #| msgid "Modified" 13789 msgctxt "@label modified date of file" 13790 msgid "Modified" 13791 msgstr "Candjî" 13792 13793 #: kio/knfotranslator.cpp:50 13794 #, fuzzy, kde-format 13795 #| msgid "Mime Type" 13796 msgctxt "@label" 13797 msgid "MIME Type" 13798 msgstr "Sôre MIME" 13799 13800 #: kio/knfotranslator.cpp:51 13801 #, fuzzy, kde-format 13802 #| msgid "Contents:" 13803 msgctxt "@label" 13804 msgid "Content" 13805 msgstr "Å dvins:" 13806 13807 #: kio/knfotranslator.cpp:52 13808 #, fuzzy, kde-format 13809 #| msgid "created on %1" 13810 msgctxt "@label" 13811 msgid "Related To" 13812 msgstr "ahivé li %1" 13813 13814 #: kio/knfotranslator.cpp:53 13815 #, fuzzy, kde-format 13816 #| msgid "Subject line" 13817 msgctxt "@label" 13818 msgid "Subject" 13819 msgstr "Roye di sudjet" 13820 13821 #: kio/knfotranslator.cpp:54 13822 #, fuzzy, kde-format 13823 #| msgid "File" 13824 msgctxt "@label music title" 13825 msgid "Title" 13826 msgstr "Fitchî" 13827 13828 #: kio/knfotranslator.cpp:55 13829 #, kde-format 13830 msgctxt "@label file URL" 13831 msgid "File Location" 13832 msgstr "" 13833 13834 #: kio/knfotranslator.cpp:56 13835 #, fuzzy, kde-format 13836 #| msgid "Created:" 13837 msgctxt "@label" 13838 msgid "Creator" 13839 msgstr "Fwait:" 13840 13841 #: kio/knfotranslator.cpp:57 13842 #, kde-format 13843 msgctxt "@label" 13844 msgid "Average Bitrate" 13845 msgstr "" 13846 13847 #: kio/knfotranslator.cpp:58 13848 #, kde-format 13849 msgctxt "@label" 13850 msgid "Channels" 13851 msgstr "" 13852 13853 #: kio/knfotranslator.cpp:59 13854 #, fuzzy, kde-format 13855 #| msgid "Categories" 13856 msgctxt "@label number of characters" 13857 msgid "Characters" 13858 msgstr "Categoreyes" 13859 13860 #: kio/knfotranslator.cpp:60 13861 #, fuzzy, kde-format 13862 #| msgid "C&onnect" 13863 msgctxt "@label" 13864 msgid "Codec" 13865 msgstr "Si ralo&yî" 13866 13867 #: kio/knfotranslator.cpp:61 13868 #, kde-format 13869 msgctxt "@label" 13870 msgid "Color Depth" 13871 msgstr "" 13872 13873 #: kio/knfotranslator.cpp:62 13874 #, fuzzy, kde-format 13875 #| msgid "Destination" 13876 msgctxt "@label" 13877 msgid "Duration" 13878 msgstr "Destinåcion" 13879 13880 #: kio/knfotranslator.cpp:63 13881 #, fuzzy, kde-format 13882 #| msgid "Device name" 13883 msgctxt "@label" 13884 msgid "Filename" 13885 msgstr "No d' l' éndjine" 13886 13887 #: kio/knfotranslator.cpp:64 13888 #, kde-format 13889 msgctxt "@label" 13890 msgid "Hash" 13891 msgstr "" 13892 13893 #: kio/knfotranslator.cpp:65 13894 #, kde-format 13895 msgctxt "@label" 13896 msgid "Height" 13897 msgstr "" 13898 13899 #: kio/knfotranslator.cpp:66 13900 #, kde-format 13901 msgctxt "@label" 13902 msgid "Interlace Mode" 13903 msgstr "" 13904 13905 #: kio/knfotranslator.cpp:67 13906 #, fuzzy, kde-format 13907 #| msgid "Link" 13908 msgctxt "@label number of lines" 13909 msgid "Lines" 13910 msgstr "Loyén" 13911 13912 #: kio/knfotranslator.cpp:68 13913 #, kde-format 13914 msgctxt "@label" 13915 msgid "Programming Language" 13916 msgstr "" 13917 13918 #: kio/knfotranslator.cpp:69 13919 #, kde-format 13920 msgctxt "@label" 13921 msgid "Sample Rate" 13922 msgstr "" 13923 13924 #: kio/knfotranslator.cpp:70 13925 #, fuzzy, kde-format 13926 #| msgid "Write" 13927 msgctxt "@label" 13928 msgid "Width" 13929 msgstr "Sicrire" 13930 13931 #: kio/knfotranslator.cpp:71 13932 #, kde-format 13933 msgctxt "@label number of words" 13934 msgid "Words" 13935 msgstr "" 13936 13937 #: kio/knfotranslator.cpp:72 13938 #, kde-format 13939 msgctxt "@label EXIF aperture value" 13940 msgid "Aperture" 13941 msgstr "" 13942 13943 #: kio/knfotranslator.cpp:73 13944 #, kde-format 13945 msgctxt "@label EXIF" 13946 msgid "Exposure Bias Value" 13947 msgstr "" 13948 13949 #: kio/knfotranslator.cpp:74 13950 #, fuzzy, kde-format 13951 #| msgid "Exposure:" 13952 msgctxt "@label EXIF" 13953 msgid "Exposure Time" 13954 msgstr "Mostraedje:" 13955 13956 #: kio/knfotranslator.cpp:75 13957 #, fuzzy, kde-format 13958 #| msgid "Class" 13959 msgctxt "@label EXIF" 13960 msgid "Flash" 13961 msgstr "Classe" 13962 13963 #: kio/knfotranslator.cpp:76 13964 #, kde-format 13965 msgctxt "@label EXIF" 13966 msgid "Focal Length" 13967 msgstr "" 13968 13969 #: kio/knfotranslator.cpp:77 13970 #, kde-format 13971 msgctxt "@label EXIF" 13972 msgid "Focal Length 35 mm" 13973 msgstr "" 13974 13975 #: kio/knfotranslator.cpp:78 13976 #, kde-format 13977 msgctxt "@label EXIF" 13978 msgid "ISO Speed Ratings" 13979 msgstr "" 13980 13981 #: kio/knfotranslator.cpp:79 13982 #, fuzzy, kde-format 13983 msgctxt "@label EXIF" 13984 msgid "Make" 13985 msgstr "Nou masse rantoele" 13986 13987 #: kio/knfotranslator.cpp:80 13988 #, kde-format 13989 msgctxt "@label EXIF" 13990 msgid "Metering Mode" 13991 msgstr "" 13992 13993 #: kio/knfotranslator.cpp:81 13994 #, fuzzy, kde-format 13995 #| msgctxt "@title:column" 13996 #| msgid "Modified" 13997 msgctxt "@label EXIF" 13998 msgid "Model" 13999 msgstr "Candjî" 14000 14001 #: kio/knfotranslator.cpp:82 14002 #, fuzzy, kde-format 14003 #| msgid "Organization:" 14004 msgctxt "@label EXIF" 14005 msgid "Orientation" 14006 msgstr "Organizåcion:" 14007 14008 #: kio/knfotranslator.cpp:83 14009 #, kde-format 14010 msgctxt "@label EXIF" 14011 msgid "White Balance" 14012 msgstr "" 14013 14014 #: kio/knfotranslator.cpp:84 14015 #, fuzzy, kde-format 14016 #| msgid "Directory" 14017 msgctxt "@label video director" 14018 msgid "Director" 14019 msgstr "Ridant" 14020 14021 #: kio/knfotranslator.cpp:85 14022 #, fuzzy, kde-format 14023 #| msgid "&General" 14024 msgctxt "@label music genre" 14025 msgid "Genre" 14026 msgstr "&Djenerå" 14027 14028 #: kio/knfotranslator.cpp:86 14029 #, kde-format 14030 msgctxt "@label music album" 14031 msgid "Album" 14032 msgstr "" 14033 14034 #: kio/knfotranslator.cpp:87 14035 #, kde-format 14036 msgctxt "@label" 14037 msgid "Performer" 14038 msgstr "" 14039 14040 #: kio/knfotranslator.cpp:88 14041 #, fuzzy, kde-format 14042 #| msgid "&Release '%1'" 14043 msgctxt "@label" 14044 msgid "Release Date" 14045 msgstr "&Liberer «%1»" 14046 14047 #: kio/knfotranslator.cpp:89 14048 #, kde-format 14049 msgctxt "@label music track number" 14050 msgid "Track" 14051 msgstr "" 14052 14053 #: kio/knfotranslator.cpp:90 14054 #, fuzzy, kde-format 14055 #| msgid "URL Resource Invalid" 14056 msgctxt "@label resource created time" 14057 msgid "Resource Created" 14058 msgstr "Rissoûce d' URL nén valide" 14059 14060 #: kio/knfotranslator.cpp:91 14061 #, fuzzy, kde-format 14062 #| msgid "Source" 14063 msgctxt "@label" 14064 msgid "Sub Resource" 14065 msgstr "Sourdant" 14066 14067 #: kio/knfotranslator.cpp:92 14068 #, fuzzy, kde-format 14069 #| msgctxt "@title:column" 14070 #| msgid "Modified" 14071 msgctxt "@label resource last modified" 14072 msgid "Resource Modified" 14073 msgstr "Candjî" 14074 14075 #: kio/knfotranslator.cpp:93 14076 #, fuzzy, kde-format 14077 #| msgid "Sorting" 14078 msgctxt "@label" 14079 msgid "Numeric Rating" 14080 msgstr "Dji relî" 14081 14082 #: kio/knfotranslator.cpp:94 14083 #, kde-format 14084 msgctxt "@label" 14085 msgid "Copied From" 14086 msgstr "" 14087 14088 #: kio/knfotranslator.cpp:95 14089 #, kde-format 14090 msgctxt "@label" 14091 msgid "First Usage" 14092 msgstr "" 14093 14094 #: kio/knfotranslator.cpp:96 14095 #, kde-format 14096 msgctxt "@label" 14097 msgid "Last Usage" 14098 msgstr "" 14099 14100 #: kio/knfotranslator.cpp:97 14101 #, fuzzy, kde-format 14102 #| msgid "Comment" 14103 msgctxt "@label" 14104 msgid "Usage Count" 14105 msgstr "Rawete" 14106 14107 #: kio/knfotranslator.cpp:98 14108 #, kde-format 14109 msgctxt "@label" 14110 msgid "Unix File Group" 14111 msgstr "" 14112 14113 #: kio/knfotranslator.cpp:99 14114 #, kde-format 14115 msgctxt "@label" 14116 msgid "Unix File Mode" 14117 msgstr "" 14118 14119 #: kio/knfotranslator.cpp:100 14120 #, fuzzy, kde-format 14121 #| msgid "Open file dialog" 14122 msgctxt "@label" 14123 msgid "Unix File Owner" 14124 msgstr "Boesse di drovaedje des fitchîs" 14125 14126 #: kio/knfotranslator.cpp:101 14127 #, fuzzy, kde-format 14128 #| msgid "Type" 14129 msgctxt "@label file type" 14130 msgid "Type" 14131 msgstr "Sôre" 14132 14133 #: kio/knfotranslator.cpp:102 14134 #, kde-format 14135 msgctxt "@label Number of fuzzy translations" 14136 msgid "Fuzzy Translations" 14137 msgstr "" 14138 14139 #: kio/knfotranslator.cpp:103 14140 #, kde-format 14141 msgctxt "@label Name of last translator" 14142 msgid "Last Translator" 14143 msgstr "" 14144 14145 #: kio/knfotranslator.cpp:104 14146 #, kde-format 14147 msgctxt "@label Number of obsolete translations" 14148 msgid "Obsolete Translations" 14149 msgstr "" 14150 14151 #: kio/knfotranslator.cpp:105 14152 #, kde-format 14153 msgctxt "@label" 14154 msgid "Translation Source Date" 14155 msgstr "" 14156 14157 #: kio/knfotranslator.cpp:106 14158 #, kde-format 14159 msgctxt "@label Number of total translations" 14160 msgid "Total Translations" 14161 msgstr "" 14162 14163 #: kio/knfotranslator.cpp:107 14164 #, fuzzy, kde-format 14165 #| msgid "Trusted:" 14166 msgctxt "@label Number of translated strings" 14167 msgid "Translated" 14168 msgstr "Fiyåve:" 14169 14170 #: kio/knfotranslator.cpp:108 14171 #, kde-format 14172 msgctxt "@label" 14173 msgid "Translation Date" 14174 msgstr "" 14175 14176 #: kio/knfotranslator.cpp:109 14177 #, kde-format 14178 msgctxt "@label Number of untranslated strings" 14179 msgid "Untranslated" 14180 msgstr "" 14181 14182 #: kio/kpreviewprops.cpp:51 14183 #, kde-format 14184 msgid "P&review" 14185 msgstr "P&révey" 14186 14187 #: kio/kscan.cpp:49 14188 #, kde-format 14189 msgid "Acquire Image" 14190 msgstr "Acweri l' imådje" 14191 14192 #: kio/kscan.cpp:97 14193 #, kde-format 14194 msgid "OCR Image" 14195 msgstr "Imådje OCR" 14196 14197 #: kio/netaccess.cpp:102 14198 #, kde-format 14199 msgid "File '%1' is not readable" 14200 msgstr "Nén moyén do lére li fitchî «%1»." 14201 14202 #: kio/netaccess.cpp:435 14203 #, kde-format 14204 msgid "ERROR: Unknown protocol '%1'" 14205 msgstr "Aroke: Protocole nén cnoxhou «%1»." 14206 14207 #: kio/passworddialog.cpp:56 14208 #, kde-format 14209 msgid "Authorization Dialog" 14210 msgstr "Purnea d' otorijhåcion" 14211 14212 #: kioslave/metainfo/metainfo.cpp:98 14213 #, kde-format 14214 msgid "No metainfo for %1" 14215 msgstr "Nole meta-infôrmåcion po %1" 14216 14217 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14218 #: kssl/kcm/cacertificates.ui:24 14219 #, fuzzy, kde-format 14220 #| msgid "Organization:" 14221 msgid "Organization / Common Name" 14222 msgstr "Organizåcion:" 14223 14224 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14225 #: kssl/kcm/cacertificates.ui:29 14226 #, fuzzy, kde-format 14227 #| msgid "Organizational unit:" 14228 msgid "Organizational Unit" 14229 msgstr "Unité d' organizåcion:" 14230 14231 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14232 #: kssl/kcm/cacertificates.ui:42 14233 #, kde-format 14234 msgid "Display..." 14235 msgstr "" 14236 14237 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14238 #: kssl/kcm/cacertificates.ui:68 14239 #, fuzzy, kde-format 14240 #| msgid "disable XIM" 14241 msgid "Disable" 14242 msgstr "dismete XIM" 14243 14244 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14245 #: kssl/kcm/cacertificates.ui:78 14246 #, kde-format 14247 msgid "Enable" 14248 msgstr "" 14249 14250 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14251 #: kssl/kcm/cacertificates.ui:104 14252 #, kde-format 14253 msgid "Remove" 14254 msgstr "Oister" 14255 14256 #. i18n: ectx: property (text), widget (QPushButton, add) 14257 #: kssl/kcm/cacertificates.ui:111 14258 #, kde-format 14259 msgid "Add..." 14260 msgstr "Radjouter..." 14261 14262 #: kssl/kcm/cacertificatespage.cpp:140 14263 #, fuzzy, kde-format 14264 #| msgid "Send certificate" 14265 msgid "System certificates" 14266 msgstr "Evoyî acertineure" 14267 14268 #: kssl/kcm/cacertificatespage.cpp:147 14269 #, fuzzy, kde-format 14270 #| msgid "Send certificate" 14271 msgid "User-added certificates" 14272 msgstr "Evoyî acertineure" 14273 14274 #: kssl/kcm/cacertificatespage.cpp:302 14275 #, fuzzy, kde-format 14276 #| msgid "Certificate" 14277 msgid "Pick Certificates" 14278 msgstr "Acertineure" 14279 14280 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14281 #: kssl/kcm/displaycert.ui:23 14282 #, fuzzy, kde-format 14283 #| msgid "Security Information" 14284 msgid "<b>Subject Information</b>" 14285 msgstr "Infôrmåcion sol såvrité" 14286 14287 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14288 #: kssl/kcm/displaycert.ui:39 14289 #, fuzzy, kde-format 14290 #| msgid " <b>[Cross Domain]</b>" 14291 msgid "<b>Issuer Information</b>" 14292 msgstr " <b>[Betchfessî dominne]</b>" 14293 14294 #. i18n: ectx: property (text), widget (QLabel, label) 14295 #: kssl/kcm/displaycert.ui:55 14296 #, fuzzy, kde-format 14297 #| msgid "<b>%1</b>" 14298 msgid "<b>Other</b>" 14299 msgstr "<b>%1</b>" 14300 14301 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14302 #: kssl/kcm/displaycert.ui:64 14303 #, fuzzy, kde-format 14304 #| msgid "Validity period:" 14305 msgid "Validity period" 14306 msgstr "Moumint d' validité:" 14307 14308 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14309 #: kssl/kcm/displaycert.ui:78 14310 #, fuzzy, kde-format 14311 #| msgid "Serial Number:" 14312 msgid "Serial number" 14313 msgstr "Limero d' séreye:" 14314 14315 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14316 #: kssl/kcm/displaycert.ui:92 14317 #, fuzzy, kde-format 14318 #| msgid "MD5 Digest:" 14319 msgid "MD5 digest" 14320 msgstr "Racourti MD5:" 14321 14322 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14323 #: kssl/kcm/displaycert.ui:106 14324 #, fuzzy, kde-format 14325 #| msgid "MD5 Digest:" 14326 msgid "SHA1 digest" 14327 msgstr "Racourti MD5:" 14328 14329 #: kssl/kcm/displaycertdialog.cpp:73 14330 #, fuzzy, kde-format 14331 #| msgid "%1 (%2)" 14332 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14333 msgid "%1 to %2" 14334 msgstr "%1 (%2)" 14335 14336 #: kssl/kcm/kcmssl.cpp:37 14337 #, fuzzy, kde-format 14338 #| msgid "Reload configuration file" 14339 msgid "SSL Configuration Module" 14340 msgstr "Ritcherdjî l' fitchî d' apontiaedje" 14341 14342 #: kssl/kcm/kcmssl.cpp:39 14343 #, kde-format 14344 msgid "Copyright 2010 Andreas Hartmetz" 14345 msgstr "" 14346 14347 #: kssl/kcm/kcmssl.cpp:40 14348 #, kde-format 14349 msgid "Andreas Hartmetz" 14350 msgstr "" 14351 14352 #: kssl/kcm/kcmssl.cpp:52 14353 #, fuzzy, kde-format 14354 #| msgid "Link" 14355 msgid "SSL Signers" 14356 msgstr "Loyén" 14357 14358 #: kssl/ksslcertificate.cpp:202 14359 #, kde-format 14360 msgid "Signature Algorithm: " 14361 msgstr "Algorite del sinateure: " 14362 14363 #: kssl/ksslcertificate.cpp:203 14364 #, kde-format 14365 msgid "Unknown" 14366 msgstr "Nén cnoxhou" 14367 14368 #: kssl/ksslcertificate.cpp:206 14369 #, kde-format 14370 msgid "Signature Contents:" 14371 msgstr "Ådvins del sinateure:" 14372 14373 #: kssl/ksslcertificate.cpp:341 14374 #, kde-format 14375 msgctxt "Unknown" 14376 msgid "Unknown key algorithm" 14377 msgstr "Algorite del clé nén cnoxhou" 14378 14379 #: kssl/ksslcertificate.cpp:347 14380 #, kde-format 14381 msgid "Key type: RSA (%1 bit)" 14382 msgstr "Sôre di clé: RSA (%1 bits)" 14383 14384 #: kssl/ksslcertificate.cpp:349 14385 #, kde-format 14386 msgid "Modulus: " 14387 msgstr "Modulo: " 14388 14389 #: kssl/ksslcertificate.cpp:362 14390 #, kde-format 14391 msgid "Exponent: 0x" 14392 msgstr "Espôzant: 0x" 14393 14394 #: kssl/ksslcertificate.cpp:374 14395 #, kde-format 14396 msgid "Key type: DSA (%1 bit)" 14397 msgstr "Sôre di clé: DSA (%1 bits)" 14398 14399 #: kssl/ksslcertificate.cpp:376 14400 #, kde-format 14401 msgid "Prime: " 14402 msgstr "Prumî: " 14403 14404 #: kssl/ksslcertificate.cpp:389 14405 #, kde-format 14406 msgid "160 bit prime factor: " 14407 msgstr "Facteur prumî di 160 bits: " 14408 14409 #: kssl/ksslcertificate.cpp:417 14410 #, kde-format 14411 msgid "Public key: " 14412 msgstr "Clé publike: " 14413 14414 #: kssl/ksslcertificate.cpp:1065 14415 #, kde-format 14416 msgid "The certificate is valid." 14417 msgstr "L' acertineure est valide." 14418 14419 #: kssl/ksslcertificate.cpp:1067 14420 #, kde-format 14421 msgid "" 14422 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14423 "Authority) certificate can not be found." 14424 msgstr "" 14425 14426 #: kssl/ksslcertificate.cpp:1069 14427 #, kde-format 14428 msgid "" 14429 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14430 "CA's (Certificate Authority) CRL can not be found." 14431 msgstr "" 14432 14433 #: kssl/ksslcertificate.cpp:1071 14434 #, kde-format 14435 msgid "" 14436 "The decryption of the certificate's signature failed. This means it could " 14437 "not even be calculated as opposed to just not matching the expected result." 14438 msgstr "" 14439 14440 #: kssl/ksslcertificate.cpp:1073 14441 #, kde-format 14442 msgid "" 14443 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14444 "This means it could not even be calculated as opposed to just not matching " 14445 "the expected result." 14446 msgstr "" 14447 14448 #: kssl/ksslcertificate.cpp:1075 14449 #, kde-format 14450 msgid "" 14451 "The decoding of the public key of the issuer failed. This means that the " 14452 "CA's (Certificate Authority) certificate can not be used to verify the " 14453 "certificate you wanted to use." 14454 msgstr "" 14455 14456 #: kssl/ksslcertificate.cpp:1077 14457 #, kde-format 14458 msgid "" 14459 "The certificate's signature is invalid. This means that the certificate can " 14460 "not be verified." 14461 msgstr "" 14462 14463 #: kssl/ksslcertificate.cpp:1079 14464 #, fuzzy, kde-format 14465 #| msgid "The certificate is invalid." 14466 msgid "" 14467 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14468 "that the CRL can not be verified." 14469 msgstr "L' acertineure n' est nén valide." 14470 14471 #: kssl/ksslcertificate.cpp:1081 14472 #, fuzzy, kde-format 14473 #| msgid "The certificate is invalid." 14474 msgid "The certificate is not valid, yet." 14475 msgstr "L' acertineure n' est nén valide." 14476 14477 #: kssl/ksslcertificate.cpp:1083 14478 #, fuzzy, kde-format 14479 #| msgid "The certificate is invalid." 14480 msgid "The certificate is not valid, any more." 14481 msgstr "L' acertineure n' est nén valide." 14482 14483 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14484 #, fuzzy, kde-format 14485 #| msgid "The certificate is invalid." 14486 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14487 msgstr "L' acertineure n' est nén valide." 14488 14489 #: kssl/ksslcertificate.cpp:1089 14490 #, kde-format 14491 msgid "The time format of the certificate's 'notBefore' field is invalid." 14492 msgstr "" 14493 14494 #: kssl/ksslcertificate.cpp:1091 14495 #, kde-format 14496 msgid "The time format of the certificate's 'notAfter' field is invalid." 14497 msgstr "" 14498 14499 #: kssl/ksslcertificate.cpp:1093 14500 #, fuzzy, kde-format 14501 #| msgid "The certificate is invalid." 14502 msgid "" 14503 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14504 "field is invalid." 14505 msgstr "L' acertineure n' est nén valide." 14506 14507 #: kssl/ksslcertificate.cpp:1095 14508 #, fuzzy, kde-format 14509 #| msgid "The certificate is invalid." 14510 msgid "" 14511 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14512 "field is invalid." 14513 msgstr "L' acertineure n' est nén valide." 14514 14515 #: kssl/ksslcertificate.cpp:1097 14516 #, kde-format 14517 msgid "The OpenSSL process ran out of memory." 14518 msgstr "" 14519 14520 #: kssl/ksslcertificate.cpp:1099 14521 #, kde-format 14522 msgid "" 14523 "The certificate is self-signed and not in the list of trusted certificates. " 14524 "If you want to accept this certificate, import it into the list of trusted " 14525 "certificates." 14526 msgstr "" 14527 14528 #: kssl/ksslcertificate.cpp:1102 14529 #, kde-format 14530 msgid "" 14531 "The certificate is self-signed. While the trust chain could be built up, the " 14532 "root CA's (Certificate Authority) certificate can not be found." 14533 msgstr "" 14534 14535 #: kssl/ksslcertificate.cpp:1104 14536 #, kde-format 14537 msgid "" 14538 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14539 "your trust chain is broken." 14540 msgstr "" 14541 14542 #: kssl/ksslcertificate.cpp:1106 14543 #, kde-format 14544 msgid "" 14545 "The certificate can not be verified as it is the only certificate in the " 14546 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14547 "to import it into the list of trusted certificates." 14548 msgstr "" 14549 14550 #: kssl/ksslcertificate.cpp:1108 14551 #, kde-format 14552 msgid "The certificate chain is longer than the maximum depth specified." 14553 msgstr "" 14554 14555 #: kssl/ksslcertificate.cpp:1111 14556 #, fuzzy, kde-format 14557 #| msgid "The certificate is invalid." 14558 msgid "The certificate has been revoked." 14559 msgstr "L' acertineure n' est nén valide." 14560 14561 #: kssl/ksslcertificate.cpp:1113 14562 #, fuzzy, kde-format 14563 #| msgid "The certificate is invalid." 14564 msgid "The certificate's CA (Certificate Authority) is invalid." 14565 msgstr "L' acertineure n' est nén valide." 14566 14567 #: kssl/ksslcertificate.cpp:1115 14568 #, kde-format 14569 msgid "" 14570 "The length of the trust chain exceeded one of the CA's (Certificate " 14571 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14572 msgstr "" 14573 14574 #: kssl/ksslcertificate.cpp:1117 14575 #, kde-format 14576 msgid "" 14577 "The certificate has not been signed for the purpose you tried to use it for. " 14578 "This means the CA (Certificate Authority) does not allow this usage." 14579 msgstr "" 14580 14581 #: kssl/ksslcertificate.cpp:1120 14582 #, kde-format 14583 msgid "" 14584 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14585 "to use this certificate for." 14586 msgstr "" 14587 14588 #: kssl/ksslcertificate.cpp:1123 14589 #, kde-format 14590 msgid "" 14591 "The root CA (Certificate Authority) has been marked to be rejected for the " 14592 "purpose you tried to use it for." 14593 msgstr "" 14594 14595 #: kssl/ksslcertificate.cpp:1125 14596 #, fuzzy, kde-format 14597 #| msgid "" 14598 #| "The IP address of the host %1 does not match the one the certificate was " 14599 #| "issued to." 14600 msgid "" 14601 "The certificate's CA (Certificate Authority) does not match the CA name of " 14602 "the certificate." 14603 msgstr "" 14604 "L' adresse IP do lodjoe %1 ni corespond nén al cene ki l' acertineure a stî " 14605 "evoyeye." 14606 14607 #: kssl/ksslcertificate.cpp:1127 14608 #, fuzzy, kde-format 14609 #| msgid "" 14610 #| "The IP address of the host %1 does not match the one the certificate was " 14611 #| "issued to." 14612 msgid "" 14613 "The CA (Certificate Authority) certificate's key ID does not match the key " 14614 "ID in the 'Issuer' section of the certificate you are trying to use." 14615 msgstr "" 14616 "L' adresse IP do lodjoe %1 ni corespond nén al cene ki l' acertineure a stî " 14617 "evoyeye." 14618 14619 #: kssl/ksslcertificate.cpp:1129 14620 #, kde-format 14621 msgid "" 14622 "The CA (Certificate Authority) certificate's key ID and name do not match " 14623 "the key ID and name in the 'Issuer' section of the certificate you are " 14624 "trying to use." 14625 msgstr "" 14626 14627 #: kssl/ksslcertificate.cpp:1131 14628 #, kde-format 14629 msgid "" 14630 "The certificate's CA (Certificate Authority) is not allowed to sign " 14631 "certificates." 14632 msgstr "" 14633 14634 #: kssl/ksslcertificate.cpp:1133 14635 #, kde-format 14636 msgid "OpenSSL could not be verified." 14637 msgstr "" 14638 14639 #: kssl/ksslcertificate.cpp:1137 14640 #, kde-format 14641 msgid "" 14642 "The signature test for this certificate failed. This could mean that the " 14643 "signature of this certificate or any in its trust path are invalid, could " 14644 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14645 "verified. If you see this message, please let the author of the software you " 14646 "are using know that he or she should use the new, more specific error " 14647 "messages." 14648 msgstr "" 14649 14650 #: kssl/ksslcertificate.cpp:1139 14651 #, kde-format 14652 msgid "" 14653 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14654 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14655 "valid yet or not valid any more. If you see this message, please let the " 14656 "author of the software you are using know that he or she should use the new, " 14657 "more specific error messages." 14658 msgstr "" 14659 14660 #: kssl/ksslcertificate.cpp:1145 14661 #, kde-format 14662 msgid "" 14663 "Certificate signing authority root files could not be found so the " 14664 "certificate is not verified." 14665 msgstr "" 14666 14667 #: kssl/ksslcertificate.cpp:1147 14668 #, kde-format 14669 msgid "SSL support was not found." 14670 msgstr "Li sopoirt SSL n' a nén stî trové." 14671 14672 #: kssl/ksslcertificate.cpp:1149 14673 #, kde-format 14674 msgid "Private key test failed." 14675 msgstr "" 14676 14677 #: kssl/ksslcertificate.cpp:1151 14678 #, kde-format 14679 msgid "The certificate has not been issued for this host." 14680 msgstr "" 14681 14682 #: kssl/ksslcertificate.cpp:1153 14683 #, kde-format 14684 msgid "This certificate is not relevant." 14685 msgstr "" 14686 14687 #: kssl/ksslcertificate.cpp:1158 14688 #, kde-format 14689 msgid "The certificate is invalid." 14690 msgstr "L' acertineure n' est nén valide." 14691 14692 #: kssl/ksslutils.cpp:90 14693 #, kde-format 14694 msgid "GMT" 14695 msgstr "UTC" 14696 14697 #, fuzzy 14698 #~| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 14699 #~| msgid "Before Christ" 14700 #~ msgctxt "color" 14701 #~ msgid "forest" 14702 #~ msgstr "Divant Djezus-Crisse" 14703 14704 #, fuzzy 14705 #~ msgctxt "color" 14706 #~ msgid "hot" 14707 #~ msgstr "Thl" 14708 14709 #, fuzzy 14710 #~ msgctxt "color" 14711 #~ msgid "sea" 14712 #~ msgstr "Djoker" 14713 14714 #~ msgctxt "@item Calendar system" 14715 #~ msgid "Gregorian (Proleptic)" 14716 #~ msgstr "Gregoryin (Proleptike)" 14717 14718 #, fuzzy 14719 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 14720 #~ msgid "of Mes" 14721 #~ msgstr "di Meh" 14722 14723 #, fuzzy 14724 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 14725 #~ msgid "of Ter" 14726 #~ msgstr "di Tir" 14727 14728 #, fuzzy 14729 #~ msgctxt "Ethiopian month 1 - ShortName" 14730 #~ msgid "Mes" 14731 #~ msgstr "Oyi" 14732 14733 #, fuzzy 14734 #~ msgctxt "Ethiopian month 5 - LongName" 14735 #~ msgid "Ter" 14736 #~ msgstr "mår" 14737 14738 #, fuzzy 14739 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 14740 #~ msgid "Ham" 14741 #~ msgstr "am" 14742 14743 #, fuzzy 14744 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 14745 #~ msgid "Arb" 14746 #~ msgstr "Arb" 14747 14748 #, fuzzy 14749 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 14750 #~ msgid "Rob" 14751 #~ msgstr "Bouye" 14752 14753 #, fuzzy 14754 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 14755 #~ msgid "Arb" 14756 #~ msgstr "Arb" 14757 14758 #~ msgctxt "of May long" 14759 #~ msgid "of May" 14760 #~ msgstr "di may" 14761 14762 #~ msgctxt "May long" 14763 #~ msgid "May" 14764 #~ msgstr "May" 14765 14766 #~ msgid "R. Thaani" 14767 #~ msgstr "R. Thaani" 14768 14769 #~ msgid "J. Thaani" 14770 #~ msgstr "J. Thaani" 14771 14772 #~ msgid "Hijjah" 14773 #~ msgstr "Hijjah" 14774 14775 #~ msgctxt "of Tir long" 14776 #~ msgid "of Tir" 14777 #~ msgstr "di Tir" 14778 14779 #~ msgctxt "of Dei long" 14780 #~ msgid "of Dei" 14781 #~ msgstr "di Dei" 14782 14783 #~ msgctxt "Tir long" 14784 #~ msgid "Tir" 14785 #~ msgstr "Tir" 14786 14787 #~ msgctxt "Dei long" 14788 #~ msgid "Dei" 14789 #~ msgstr "Dei" 14790 14791 #~ msgctxt "Shanbe short" 14792 #~ msgid "shn" 14793 #~ msgstr "shn"