Warning, /frameworks/kdelibs4support/po/tt/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # Copyright (C) YEAR This_file_is_part_of_KDE 0002 # This file is distributed under the same license as the PACKAGE package. 0003 # 0004 # Ainur Shakirov <ainur.shakirov.tt@gmail.com>, 2011. 0005 msgid "" 0006 msgstr "" 0007 "Project-Id-Version: \n" 0008 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0009 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0010 "PO-Revision-Date: 2011-11-26 15:12+0400\n" 0011 "Last-Translator: Ainur Shakirov <ainur.shakirov.tt@gmail.com>\n" 0012 "Language-Team: Tatar <>\n" 0013 "Language: tt\n" 0014 "MIME-Version: 1.0\n" 0015 "Content-Type: text/plain; charset=UTF-8\n" 0016 "Content-Transfer-Encoding: 8bit\n" 0017 "Plural-Forms: nplurals=2; plural=n != 1;\n" 0018 "X-Generator: Lokalize 1.2\n" 0019 0020 #, kde-format 0021 msgctxt "NAME OF TRANSLATORS" 0022 msgid "Your names" 0023 msgstr "Ainur Shakirov" 0024 0025 #, kde-format 0026 msgctxt "EMAIL OF TRANSLATORS" 0027 msgid "Your emails" 0028 msgstr "ainur.shakirov.tt@gmail.com" 0029 0030 #, kde-format 0031 msgctxt "color" 0032 msgid "AliceBlue" 0033 msgstr "" 0034 0035 #, kde-format 0036 msgctxt "color" 0037 msgid "AntiqueWhite" 0038 msgstr "" 0039 0040 #, kde-format 0041 msgctxt "color" 0042 msgid "AntiqueWhite1" 0043 msgstr "" 0044 0045 #, kde-format 0046 msgctxt "color" 0047 msgid "AntiqueWhite2" 0048 msgstr "" 0049 0050 #, kde-format 0051 msgctxt "color" 0052 msgid "AntiqueWhite3" 0053 msgstr "" 0054 0055 #, kde-format 0056 msgctxt "color" 0057 msgid "AntiqueWhite4" 0058 msgstr "" 0059 0060 #, kde-format 0061 msgctxt "color" 0062 msgid "BlanchedAlmond" 0063 msgstr "" 0064 0065 #, kde-format 0066 msgctxt "color" 0067 msgid "BlueViolet" 0068 msgstr "" 0069 0070 #, kde-format 0071 msgctxt "color" 0072 msgid "CadetBlue" 0073 msgstr "" 0074 0075 #, kde-format 0076 msgctxt "color" 0077 msgid "CadetBlue1" 0078 msgstr "" 0079 0080 #, kde-format 0081 msgctxt "color" 0082 msgid "CadetBlue2" 0083 msgstr "" 0084 0085 #, kde-format 0086 msgctxt "color" 0087 msgid "CadetBlue3" 0088 msgstr "" 0089 0090 #, kde-format 0091 msgctxt "color" 0092 msgid "CadetBlue4" 0093 msgstr "" 0094 0095 #, kde-format 0096 msgctxt "color" 0097 msgid "CornflowerBlue" 0098 msgstr "" 0099 0100 #, fuzzy, kde-format 0101 #| msgid "Blue:" 0102 msgctxt "color" 0103 msgid "DarkBlue" 0104 msgstr "Количество синего:" 0105 0106 #, kde-format 0107 msgctxt "color" 0108 msgid "DarkCyan" 0109 msgstr "" 0110 0111 #, kde-format 0112 msgctxt "color" 0113 msgid "DarkGoldenrod" 0114 msgstr "" 0115 0116 #, kde-format 0117 msgctxt "color" 0118 msgid "DarkGoldenrod1" 0119 msgstr "" 0120 0121 #, kde-format 0122 msgctxt "color" 0123 msgid "DarkGoldenrod2" 0124 msgstr "" 0125 0126 #, kde-format 0127 msgctxt "color" 0128 msgid "DarkGoldenrod3" 0129 msgstr "" 0130 0131 #, kde-format 0132 msgctxt "color" 0133 msgid "DarkGoldenrod4" 0134 msgstr "" 0135 0136 #, kde-format 0137 msgctxt "color" 0138 msgid "DarkGray" 0139 msgstr "" 0140 0141 #, fuzzy, kde-format 0142 #| msgid "Green:" 0143 msgctxt "color" 0144 msgid "DarkGreen" 0145 msgstr "Количество зелёного:" 0146 0147 #, kde-format 0148 msgctxt "color" 0149 msgid "DarkGrey" 0150 msgstr "" 0151 0152 #, kde-format 0153 msgctxt "color" 0154 msgid "DarkKhaki" 0155 msgstr "" 0156 0157 #, kde-format 0158 msgctxt "color" 0159 msgid "DarkMagenta" 0160 msgstr "" 0161 0162 #, kde-format 0163 msgctxt "color" 0164 msgid "DarkOliveGreen" 0165 msgstr "" 0166 0167 #, kde-format 0168 msgctxt "color" 0169 msgid "DarkOliveGreen1" 0170 msgstr "" 0171 0172 #, kde-format 0173 msgctxt "color" 0174 msgid "DarkOliveGreen2" 0175 msgstr "" 0176 0177 #, kde-format 0178 msgctxt "color" 0179 msgid "DarkOliveGreen3" 0180 msgstr "" 0181 0182 #, kde-format 0183 msgctxt "color" 0184 msgid "DarkOliveGreen4" 0185 msgstr "" 0186 0187 #, kde-format 0188 msgctxt "color" 0189 msgid "DarkOrange" 0190 msgstr "" 0191 0192 #, kde-format 0193 msgctxt "color" 0194 msgid "DarkOrange1" 0195 msgstr "" 0196 0197 #, kde-format 0198 msgctxt "color" 0199 msgid "DarkOrange2" 0200 msgstr "" 0201 0202 #, kde-format 0203 msgctxt "color" 0204 msgid "DarkOrange3" 0205 msgstr "" 0206 0207 #, kde-format 0208 msgctxt "color" 0209 msgid "DarkOrange4" 0210 msgstr "" 0211 0212 #, kde-format 0213 msgctxt "color" 0214 msgid "DarkOrchid" 0215 msgstr "" 0216 0217 #, kde-format 0218 msgctxt "color" 0219 msgid "DarkOrchid1" 0220 msgstr "" 0221 0222 #, kde-format 0223 msgctxt "color" 0224 msgid "DarkOrchid2" 0225 msgstr "" 0226 0227 #, kde-format 0228 msgctxt "color" 0229 msgid "DarkOrchid3" 0230 msgstr "" 0231 0232 #, kde-format 0233 msgctxt "color" 0234 msgid "DarkOrchid4" 0235 msgstr "" 0236 0237 #, kde-format 0238 msgctxt "color" 0239 msgid "DarkRed" 0240 msgstr "" 0241 0242 #, kde-format 0243 msgctxt "color" 0244 msgid "DarkSalmon" 0245 msgstr "" 0246 0247 #, kde-format 0248 msgctxt "color" 0249 msgid "DarkSeaGreen" 0250 msgstr "" 0251 0252 #, kde-format 0253 msgctxt "color" 0254 msgid "DarkSeaGreen1" 0255 msgstr "" 0256 0257 #, kde-format 0258 msgctxt "color" 0259 msgid "DarkSeaGreen2" 0260 msgstr "" 0261 0262 #, kde-format 0263 msgctxt "color" 0264 msgid "DarkSeaGreen3" 0265 msgstr "" 0266 0267 #, kde-format 0268 msgctxt "color" 0269 msgid "DarkSeaGreen4" 0270 msgstr "" 0271 0272 #, kde-format 0273 msgctxt "color" 0274 msgid "DarkSlateBlue" 0275 msgstr "" 0276 0277 #, kde-format 0278 msgctxt "color" 0279 msgid "DarkSlateGray" 0280 msgstr "" 0281 0282 #, kde-format 0283 msgctxt "color" 0284 msgid "DarkSlateGray1" 0285 msgstr "" 0286 0287 #, kde-format 0288 msgctxt "color" 0289 msgid "DarkSlateGray2" 0290 msgstr "" 0291 0292 #, kde-format 0293 msgctxt "color" 0294 msgid "DarkSlateGray3" 0295 msgstr "" 0296 0297 #, kde-format 0298 msgctxt "color" 0299 msgid "DarkSlateGray4" 0300 msgstr "" 0301 0302 #, kde-format 0303 msgctxt "color" 0304 msgid "DarkSlateGrey" 0305 msgstr "" 0306 0307 #, kde-format 0308 msgctxt "color" 0309 msgid "DarkTurquoise" 0310 msgstr "" 0311 0312 #, kde-format 0313 msgctxt "color" 0314 msgid "DarkViolet" 0315 msgstr "" 0316 0317 #, kde-format 0318 msgctxt "color" 0319 msgid "DeepPink" 0320 msgstr "" 0321 0322 #, kde-format 0323 msgctxt "color" 0324 msgid "DeepPink1" 0325 msgstr "" 0326 0327 #, kde-format 0328 msgctxt "color" 0329 msgid "DeepPink2" 0330 msgstr "" 0331 0332 #, kde-format 0333 msgctxt "color" 0334 msgid "DeepPink3" 0335 msgstr "" 0336 0337 #, kde-format 0338 msgctxt "color" 0339 msgid "DeepPink4" 0340 msgstr "" 0341 0342 #, kde-format 0343 msgctxt "color" 0344 msgid "DeepSkyBlue" 0345 msgstr "" 0346 0347 #, kde-format 0348 msgctxt "color" 0349 msgid "DeepSkyBlue1" 0350 msgstr "" 0351 0352 #, kde-format 0353 msgctxt "color" 0354 msgid "DeepSkyBlue2" 0355 msgstr "" 0356 0357 #, kde-format 0358 msgctxt "color" 0359 msgid "DeepSkyBlue3" 0360 msgstr "" 0361 0362 #, kde-format 0363 msgctxt "color" 0364 msgid "DeepSkyBlue4" 0365 msgstr "" 0366 0367 #, kde-format 0368 msgctxt "color" 0369 msgid "DimGray" 0370 msgstr "" 0371 0372 #, kde-format 0373 msgctxt "color" 0374 msgid "DimGrey" 0375 msgstr "" 0376 0377 #, kde-format 0378 msgctxt "color" 0379 msgid "DodgerBlue" 0380 msgstr "" 0381 0382 #, kde-format 0383 msgctxt "color" 0384 msgid "DodgerBlue1" 0385 msgstr "" 0386 0387 #, kde-format 0388 msgctxt "color" 0389 msgid "DodgerBlue2" 0390 msgstr "" 0391 0392 #, kde-format 0393 msgctxt "color" 0394 msgid "DodgerBlue3" 0395 msgstr "" 0396 0397 #, kde-format 0398 msgctxt "color" 0399 msgid "DodgerBlue4" 0400 msgstr "" 0401 0402 #, kde-format 0403 msgctxt "color" 0404 msgid "FloralWhite" 0405 msgstr "" 0406 0407 #, kde-format 0408 msgctxt "color" 0409 msgid "ForestGreen" 0410 msgstr "" 0411 0412 #, kde-format 0413 msgctxt "color" 0414 msgid "GhostWhite" 0415 msgstr "" 0416 0417 #, kde-format 0418 msgctxt "color" 0419 msgid "GreenYellow" 0420 msgstr "" 0421 0422 #, kde-format 0423 msgctxt "color" 0424 msgid "HotPink" 0425 msgstr "" 0426 0427 #, kde-format 0428 msgctxt "color" 0429 msgid "HotPink1" 0430 msgstr "" 0431 0432 #, kde-format 0433 msgctxt "color" 0434 msgid "HotPink2" 0435 msgstr "" 0436 0437 #, kde-format 0438 msgctxt "color" 0439 msgid "HotPink3" 0440 msgstr "" 0441 0442 #, kde-format 0443 msgctxt "color" 0444 msgid "HotPink4" 0445 msgstr "" 0446 0447 #, kde-format 0448 msgctxt "color" 0449 msgid "IndianRed" 0450 msgstr "" 0451 0452 #, kde-format 0453 msgctxt "color" 0454 msgid "IndianRed1" 0455 msgstr "" 0456 0457 #, kde-format 0458 msgctxt "color" 0459 msgid "IndianRed2" 0460 msgstr "" 0461 0462 #, kde-format 0463 msgctxt "color" 0464 msgid "IndianRed3" 0465 msgstr "" 0466 0467 #, kde-format 0468 msgctxt "color" 0469 msgid "IndianRed4" 0470 msgstr "" 0471 0472 #, kde-format 0473 msgctxt "color" 0474 msgid "LavenderBlush" 0475 msgstr "" 0476 0477 #, kde-format 0478 msgctxt "color" 0479 msgid "LavenderBlush1" 0480 msgstr "" 0481 0482 #, kde-format 0483 msgctxt "color" 0484 msgid "LavenderBlush2" 0485 msgstr "" 0486 0487 #, kde-format 0488 msgctxt "color" 0489 msgid "LavenderBlush3" 0490 msgstr "" 0491 0492 #, kde-format 0493 msgctxt "color" 0494 msgid "LavenderBlush4" 0495 msgstr "" 0496 0497 #, fuzzy, kde-format 0498 #| msgid "Green:" 0499 msgctxt "color" 0500 msgid "LawnGreen" 0501 msgstr "Количество зелёного:" 0502 0503 #, kde-format 0504 msgctxt "color" 0505 msgid "LemonChiffon" 0506 msgstr "" 0507 0508 #, kde-format 0509 msgctxt "color" 0510 msgid "LemonChiffon1" 0511 msgstr "" 0512 0513 #, kde-format 0514 msgctxt "color" 0515 msgid "LemonChiffon2" 0516 msgstr "" 0517 0518 #, kde-format 0519 msgctxt "color" 0520 msgid "LemonChiffon3" 0521 msgstr "" 0522 0523 #, kde-format 0524 msgctxt "color" 0525 msgid "LemonChiffon4" 0526 msgstr "" 0527 0528 #, kde-format 0529 msgctxt "color" 0530 msgid "LightBlue" 0531 msgstr "" 0532 0533 #, kde-format 0534 msgctxt "color" 0535 msgid "LightBlue1" 0536 msgstr "" 0537 0538 #, kde-format 0539 msgctxt "color" 0540 msgid "LightBlue2" 0541 msgstr "" 0542 0543 #, kde-format 0544 msgctxt "color" 0545 msgid "LightBlue3" 0546 msgstr "" 0547 0548 #, kde-format 0549 msgctxt "color" 0550 msgid "LightBlue4" 0551 msgstr "" 0552 0553 #, kde-format 0554 msgctxt "color" 0555 msgid "LightCoral" 0556 msgstr "" 0557 0558 #, kde-format 0559 msgctxt "color" 0560 msgid "LightCyan" 0561 msgstr "" 0562 0563 #, kde-format 0564 msgctxt "color" 0565 msgid "LightCyan1" 0566 msgstr "" 0567 0568 #, kde-format 0569 msgctxt "color" 0570 msgid "LightCyan2" 0571 msgstr "" 0572 0573 #, kde-format 0574 msgctxt "color" 0575 msgid "LightCyan3" 0576 msgstr "" 0577 0578 #, kde-format 0579 msgctxt "color" 0580 msgid "LightCyan4" 0581 msgstr "" 0582 0583 #, kde-format 0584 msgctxt "color" 0585 msgid "LightGoldenrod" 0586 msgstr "" 0587 0588 #, kde-format 0589 msgctxt "color" 0590 msgid "LightGoldenrod1" 0591 msgstr "" 0592 0593 #, kde-format 0594 msgctxt "color" 0595 msgid "LightGoldenrod2" 0596 msgstr "" 0597 0598 #, kde-format 0599 msgctxt "color" 0600 msgid "LightGoldenrod3" 0601 msgstr "" 0602 0603 #, kde-format 0604 msgctxt "color" 0605 msgid "LightGoldenrod4" 0606 msgstr "" 0607 0608 #, kde-format 0609 msgctxt "color" 0610 msgid "LightGoldenrodYellow" 0611 msgstr "" 0612 0613 #, kde-format 0614 msgctxt "color" 0615 msgid "LightGray" 0616 msgstr "" 0617 0618 #, fuzzy, kde-format 0619 #| msgid "Green:" 0620 msgctxt "color" 0621 msgid "LightGreen" 0622 msgstr "Количество зелёного:" 0623 0624 #, kde-format 0625 msgctxt "color" 0626 msgid "LightGrey" 0627 msgstr "" 0628 0629 #, kde-format 0630 msgctxt "color" 0631 msgid "LightPink" 0632 msgstr "" 0633 0634 #, kde-format 0635 msgctxt "color" 0636 msgid "LightPink1" 0637 msgstr "" 0638 0639 #, kde-format 0640 msgctxt "color" 0641 msgid "LightPink2" 0642 msgstr "" 0643 0644 #, kde-format 0645 msgctxt "color" 0646 msgid "LightPink3" 0647 msgstr "" 0648 0649 #, kde-format 0650 msgctxt "color" 0651 msgid "LightPink4" 0652 msgstr "" 0653 0654 #, kde-format 0655 msgctxt "color" 0656 msgid "LightSalmon" 0657 msgstr "" 0658 0659 #, kde-format 0660 msgctxt "color" 0661 msgid "LightSalmon1" 0662 msgstr "" 0663 0664 #, kde-format 0665 msgctxt "color" 0666 msgid "LightSalmon2" 0667 msgstr "" 0668 0669 #, kde-format 0670 msgctxt "color" 0671 msgid "LightSalmon3" 0672 msgstr "" 0673 0674 #, kde-format 0675 msgctxt "color" 0676 msgid "LightSalmon4" 0677 msgstr "" 0678 0679 #, kde-format 0680 msgctxt "color" 0681 msgid "LightSeaGreen" 0682 msgstr "" 0683 0684 #, kde-format 0685 msgctxt "color" 0686 msgid "LightSkyBlue" 0687 msgstr "" 0688 0689 #, kde-format 0690 msgctxt "color" 0691 msgid "LightSkyBlue1" 0692 msgstr "" 0693 0694 #, kde-format 0695 msgctxt "color" 0696 msgid "LightSkyBlue2" 0697 msgstr "" 0698 0699 #, kde-format 0700 msgctxt "color" 0701 msgid "LightSkyBlue3" 0702 msgstr "" 0703 0704 #, kde-format 0705 msgctxt "color" 0706 msgid "LightSkyBlue4" 0707 msgstr "" 0708 0709 #, kde-format 0710 msgctxt "color" 0711 msgid "LightSlateBlue" 0712 msgstr "" 0713 0714 #, kde-format 0715 msgctxt "color" 0716 msgid "LightSlateGray" 0717 msgstr "" 0718 0719 #, kde-format 0720 msgctxt "color" 0721 msgid "LightSlateGrey" 0722 msgstr "" 0723 0724 #, kde-format 0725 msgctxt "color" 0726 msgid "LightSteelBlue" 0727 msgstr "" 0728 0729 #, kde-format 0730 msgctxt "color" 0731 msgid "LightSteelBlue1" 0732 msgstr "" 0733 0734 #, kde-format 0735 msgctxt "color" 0736 msgid "LightSteelBlue2" 0737 msgstr "" 0738 0739 #, kde-format 0740 msgctxt "color" 0741 msgid "LightSteelBlue3" 0742 msgstr "" 0743 0744 #, kde-format 0745 msgctxt "color" 0746 msgid "LightSteelBlue4" 0747 msgstr "" 0748 0749 #, kde-format 0750 msgctxt "color" 0751 msgid "LightYellow" 0752 msgstr "" 0753 0754 #, kde-format 0755 msgctxt "color" 0756 msgid "LightYellow1" 0757 msgstr "" 0758 0759 #, kde-format 0760 msgctxt "color" 0761 msgid "LightYellow2" 0762 msgstr "" 0763 0764 #, kde-format 0765 msgctxt "color" 0766 msgid "LightYellow3" 0767 msgstr "" 0768 0769 #, kde-format 0770 msgctxt "color" 0771 msgid "LightYellow4" 0772 msgstr "" 0773 0774 #, fuzzy, kde-format 0775 #| msgid "Green:" 0776 msgctxt "color" 0777 msgid "LimeGreen" 0778 msgstr "Количество зелёного:" 0779 0780 #, kde-format 0781 msgctxt "color" 0782 msgid "MediumAquamarine" 0783 msgstr "" 0784 0785 #, fuzzy, kde-format 0786 #| msgctxt "dictionary variant" 0787 #| msgid "medium" 0788 msgctxt "color" 0789 msgid "MediumBlue" 0790 msgstr "уртак" 0791 0792 #, kde-format 0793 msgctxt "color" 0794 msgid "MediumOrchid" 0795 msgstr "" 0796 0797 #, kde-format 0798 msgctxt "color" 0799 msgid "MediumOrchid1" 0800 msgstr "" 0801 0802 #, kde-format 0803 msgctxt "color" 0804 msgid "MediumOrchid2" 0805 msgstr "" 0806 0807 #, kde-format 0808 msgctxt "color" 0809 msgid "MediumOrchid3" 0810 msgstr "" 0811 0812 #, kde-format 0813 msgctxt "color" 0814 msgid "MediumOrchid4" 0815 msgstr "" 0816 0817 #, kde-format 0818 msgctxt "color" 0819 msgid "MediumPurple" 0820 msgstr "" 0821 0822 #, kde-format 0823 msgctxt "color" 0824 msgid "MediumPurple1" 0825 msgstr "" 0826 0827 #, kde-format 0828 msgctxt "color" 0829 msgid "MediumPurple2" 0830 msgstr "" 0831 0832 #, kde-format 0833 msgctxt "color" 0834 msgid "MediumPurple3" 0835 msgstr "" 0836 0837 #, kde-format 0838 msgctxt "color" 0839 msgid "MediumPurple4" 0840 msgstr "" 0841 0842 #, kde-format 0843 msgctxt "color" 0844 msgid "MediumSeaGreen" 0845 msgstr "" 0846 0847 #, kde-format 0848 msgctxt "color" 0849 msgid "MediumSlateBlue" 0850 msgstr "" 0851 0852 #, kde-format 0853 msgctxt "color" 0854 msgid "MediumSpringGreen" 0855 msgstr "" 0856 0857 #, kde-format 0858 msgctxt "color" 0859 msgid "MediumTurquoise" 0860 msgstr "" 0861 0862 #, kde-format 0863 msgctxt "color" 0864 msgid "MediumVioletRed" 0865 msgstr "" 0866 0867 #, kde-format 0868 msgctxt "color" 0869 msgid "MidnightBlue" 0870 msgstr "" 0871 0872 #, kde-format 0873 msgctxt "color" 0874 msgid "MintCream" 0875 msgstr "" 0876 0877 #, kde-format 0878 msgctxt "color" 0879 msgid "MistyRose" 0880 msgstr "" 0881 0882 #, kde-format 0883 msgctxt "color" 0884 msgid "MistyRose1" 0885 msgstr "" 0886 0887 #, kde-format 0888 msgctxt "color" 0889 msgid "MistyRose2" 0890 msgstr "" 0891 0892 #, kde-format 0893 msgctxt "color" 0894 msgid "MistyRose3" 0895 msgstr "" 0896 0897 #, kde-format 0898 msgctxt "color" 0899 msgid "MistyRose4" 0900 msgstr "" 0901 0902 #, kde-format 0903 msgctxt "color" 0904 msgid "NavajoWhite" 0905 msgstr "" 0906 0907 #, kde-format 0908 msgctxt "color" 0909 msgid "NavajoWhite1" 0910 msgstr "" 0911 0912 #, kde-format 0913 msgctxt "color" 0914 msgid "NavajoWhite2" 0915 msgstr "" 0916 0917 #, kde-format 0918 msgctxt "color" 0919 msgid "NavajoWhite3" 0920 msgstr "" 0921 0922 #, kde-format 0923 msgctxt "color" 0924 msgid "NavajoWhite4" 0925 msgstr "" 0926 0927 #, fuzzy, kde-format 0928 #| msgid "Blue:" 0929 msgctxt "color" 0930 msgid "NavyBlue" 0931 msgstr "Количество синего:" 0932 0933 #, kde-format 0934 msgctxt "color" 0935 msgid "OldLace" 0936 msgstr "" 0937 0938 #, kde-format 0939 msgctxt "color" 0940 msgid "OliveDrab" 0941 msgstr "" 0942 0943 #, kde-format 0944 msgctxt "color" 0945 msgid "OliveDrab1" 0946 msgstr "" 0947 0948 #, kde-format 0949 msgctxt "color" 0950 msgid "OliveDrab2" 0951 msgstr "" 0952 0953 #, kde-format 0954 msgctxt "color" 0955 msgid "OliveDrab3" 0956 msgstr "" 0957 0958 #, kde-format 0959 msgctxt "color" 0960 msgid "OliveDrab4" 0961 msgstr "" 0962 0963 #, kde-format 0964 msgctxt "color" 0965 msgid "OrangeRed" 0966 msgstr "" 0967 0968 #, kde-format 0969 msgctxt "color" 0970 msgid "OrangeRed1" 0971 msgstr "" 0972 0973 #, kde-format 0974 msgctxt "color" 0975 msgid "OrangeRed2" 0976 msgstr "" 0977 0978 #, kde-format 0979 msgctxt "color" 0980 msgid "OrangeRed3" 0981 msgstr "" 0982 0983 #, kde-format 0984 msgctxt "color" 0985 msgid "OrangeRed4" 0986 msgstr "" 0987 0988 #, kde-format 0989 msgctxt "color" 0990 msgid "PaleGoldenrod" 0991 msgstr "" 0992 0993 #, fuzzy, kde-format 0994 #| msgid "Green:" 0995 msgctxt "color" 0996 msgid "PaleGreen" 0997 msgstr "Количество зелёного:" 0998 0999 #, fuzzy, kde-format 1000 #| msgid "Green:" 1001 msgctxt "color" 1002 msgid "PaleGreen1" 1003 msgstr "Количество зелёного:" 1004 1005 #, fuzzy, kde-format 1006 #| msgid "Green:" 1007 msgctxt "color" 1008 msgid "PaleGreen2" 1009 msgstr "Количество зелёного:" 1010 1011 #, fuzzy, kde-format 1012 #| msgid "Green:" 1013 msgctxt "color" 1014 msgid "PaleGreen3" 1015 msgstr "Количество зелёного:" 1016 1017 #, fuzzy, kde-format 1018 #| msgid "Green:" 1019 msgctxt "color" 1020 msgid "PaleGreen4" 1021 msgstr "Количество зелёного:" 1022 1023 #, kde-format 1024 msgctxt "color" 1025 msgid "PaleTurquoise" 1026 msgstr "" 1027 1028 #, kde-format 1029 msgctxt "color" 1030 msgid "PaleTurquoise1" 1031 msgstr "" 1032 1033 #, kde-format 1034 msgctxt "color" 1035 msgid "PaleTurquoise2" 1036 msgstr "" 1037 1038 #, kde-format 1039 msgctxt "color" 1040 msgid "PaleTurquoise3" 1041 msgstr "" 1042 1043 #, kde-format 1044 msgctxt "color" 1045 msgid "PaleTurquoise4" 1046 msgstr "" 1047 1048 #, kde-format 1049 msgctxt "color" 1050 msgid "PaleVioletRed" 1051 msgstr "" 1052 1053 #, kde-format 1054 msgctxt "color" 1055 msgid "PaleVioletRed1" 1056 msgstr "" 1057 1058 #, kde-format 1059 msgctxt "color" 1060 msgid "PaleVioletRed2" 1061 msgstr "" 1062 1063 #, kde-format 1064 msgctxt "color" 1065 msgid "PaleVioletRed3" 1066 msgstr "" 1067 1068 #, kde-format 1069 msgctxt "color" 1070 msgid "PaleVioletRed4" 1071 msgstr "" 1072 1073 #, kde-format 1074 msgctxt "color" 1075 msgid "PapayaWhip" 1076 msgstr "" 1077 1078 #, kde-format 1079 msgctxt "color" 1080 msgid "PeachPuff" 1081 msgstr "" 1082 1083 #, kde-format 1084 msgctxt "color" 1085 msgid "PeachPuff1" 1086 msgstr "" 1087 1088 #, kde-format 1089 msgctxt "color" 1090 msgid "PeachPuff2" 1091 msgstr "" 1092 1093 #, kde-format 1094 msgctxt "color" 1095 msgid "PeachPuff3" 1096 msgstr "" 1097 1098 #, kde-format 1099 msgctxt "color" 1100 msgid "PeachPuff4" 1101 msgstr "" 1102 1103 #, kde-format 1104 msgctxt "color" 1105 msgid "PowderBlue" 1106 msgstr "" 1107 1108 #, kde-format 1109 msgctxt "color" 1110 msgid "RosyBrown" 1111 msgstr "" 1112 1113 #, kde-format 1114 msgctxt "color" 1115 msgid "RosyBrown1" 1116 msgstr "" 1117 1118 #, kde-format 1119 msgctxt "color" 1120 msgid "RosyBrown2" 1121 msgstr "" 1122 1123 #, kde-format 1124 msgctxt "color" 1125 msgid "RosyBrown3" 1126 msgstr "" 1127 1128 #, kde-format 1129 msgctxt "color" 1130 msgid "RosyBrown4" 1131 msgstr "" 1132 1133 #, kde-format 1134 msgctxt "color" 1135 msgid "RoyalBlue" 1136 msgstr "" 1137 1138 #, kde-format 1139 msgctxt "color" 1140 msgid "RoyalBlue1" 1141 msgstr "" 1142 1143 #, kde-format 1144 msgctxt "color" 1145 msgid "RoyalBlue2" 1146 msgstr "" 1147 1148 #, kde-format 1149 msgctxt "color" 1150 msgid "RoyalBlue3" 1151 msgstr "" 1152 1153 #, kde-format 1154 msgctxt "color" 1155 msgid "RoyalBlue4" 1156 msgstr "" 1157 1158 #, kde-format 1159 msgctxt "color" 1160 msgid "SaddleBrown" 1161 msgstr "" 1162 1163 #, kde-format 1164 msgctxt "color" 1165 msgid "SandyBrown" 1166 msgstr "" 1167 1168 #, fuzzy, kde-format 1169 #| msgid "Green:" 1170 msgctxt "color" 1171 msgid "SeaGreen" 1172 msgstr "Количество зелёного:" 1173 1174 #, fuzzy, kde-format 1175 #| msgid "Green:" 1176 msgctxt "color" 1177 msgid "SeaGreen1" 1178 msgstr "Количество зелёного:" 1179 1180 #, fuzzy, kde-format 1181 #| msgid "Green:" 1182 msgctxt "color" 1183 msgid "SeaGreen2" 1184 msgstr "Количество зелёного:" 1185 1186 #, fuzzy, kde-format 1187 #| msgid "Green:" 1188 msgctxt "color" 1189 msgid "SeaGreen3" 1190 msgstr "Количество зелёного:" 1191 1192 #, fuzzy, kde-format 1193 #| msgid "Green:" 1194 msgctxt "color" 1195 msgid "SeaGreen4" 1196 msgstr "Количество зелёного:" 1197 1198 #, fuzzy, kde-format 1199 #| msgid "Blue:" 1200 msgctxt "color" 1201 msgid "SkyBlue" 1202 msgstr "Количество синего:" 1203 1204 #, fuzzy, kde-format 1205 #| msgid "Blue:" 1206 msgctxt "color" 1207 msgid "SkyBlue1" 1208 msgstr "Количество синего:" 1209 1210 #, fuzzy, kde-format 1211 #| msgid "Blue:" 1212 msgctxt "color" 1213 msgid "SkyBlue2" 1214 msgstr "Количество синего:" 1215 1216 #, fuzzy, kde-format 1217 #| msgid "Blue:" 1218 msgctxt "color" 1219 msgid "SkyBlue3" 1220 msgstr "Количество синего:" 1221 1222 #, fuzzy, kde-format 1223 #| msgid "Blue:" 1224 msgctxt "color" 1225 msgid "SkyBlue4" 1226 msgstr "Количество синего:" 1227 1228 #, kde-format 1229 msgctxt "color" 1230 msgid "SlateBlue" 1231 msgstr "" 1232 1233 #, kde-format 1234 msgctxt "color" 1235 msgid "SlateBlue1" 1236 msgstr "" 1237 1238 #, kde-format 1239 msgctxt "color" 1240 msgid "SlateBlue2" 1241 msgstr "" 1242 1243 #, kde-format 1244 msgctxt "color" 1245 msgid "SlateBlue3" 1246 msgstr "" 1247 1248 #, kde-format 1249 msgctxt "color" 1250 msgid "SlateBlue4" 1251 msgstr "" 1252 1253 #, kde-format 1254 msgctxt "color" 1255 msgid "SlateGray" 1256 msgstr "" 1257 1258 #, kde-format 1259 msgctxt "color" 1260 msgid "SlateGray1" 1261 msgstr "" 1262 1263 #, kde-format 1264 msgctxt "color" 1265 msgid "SlateGray2" 1266 msgstr "" 1267 1268 #, kde-format 1269 msgctxt "color" 1270 msgid "SlateGray3" 1271 msgstr "" 1272 1273 #, kde-format 1274 msgctxt "color" 1275 msgid "SlateGray4" 1276 msgstr "" 1277 1278 #, kde-format 1279 msgctxt "color" 1280 msgid "SlateGrey" 1281 msgstr "" 1282 1283 #, fuzzy, kde-format 1284 #| msgctxt "keyboard-key-name" 1285 #| msgid "PrintScreen" 1286 msgctxt "color" 1287 msgid "SpringGreen" 1288 msgstr "PrintScreen" 1289 1290 #, fuzzy, kde-format 1291 #| msgctxt "keyboard-key-name" 1292 #| msgid "PrintScreen" 1293 msgctxt "color" 1294 msgid "SpringGreen1" 1295 msgstr "PrintScreen" 1296 1297 #, fuzzy, kde-format 1298 #| msgctxt "keyboard-key-name" 1299 #| msgid "PrintScreen" 1300 msgctxt "color" 1301 msgid "SpringGreen2" 1302 msgstr "PrintScreen" 1303 1304 #, fuzzy, kde-format 1305 #| msgctxt "keyboard-key-name" 1306 #| msgid "PrintScreen" 1307 msgctxt "color" 1308 msgid "SpringGreen3" 1309 msgstr "PrintScreen" 1310 1311 #, fuzzy, kde-format 1312 #| msgctxt "keyboard-key-name" 1313 #| msgid "PrintScreen" 1314 msgctxt "color" 1315 msgid "SpringGreen4" 1316 msgstr "PrintScreen" 1317 1318 #, kde-format 1319 msgctxt "color" 1320 msgid "SteelBlue" 1321 msgstr "" 1322 1323 #, kde-format 1324 msgctxt "color" 1325 msgid "SteelBlue1" 1326 msgstr "" 1327 1328 #, kde-format 1329 msgctxt "color" 1330 msgid "SteelBlue2" 1331 msgstr "" 1332 1333 #, kde-format 1334 msgctxt "color" 1335 msgid "SteelBlue3" 1336 msgstr "" 1337 1338 #, kde-format 1339 msgctxt "color" 1340 msgid "SteelBlue4" 1341 msgstr "" 1342 1343 #, kde-format 1344 msgctxt "color" 1345 msgid "VioletRed" 1346 msgstr "" 1347 1348 #, kde-format 1349 msgctxt "color" 1350 msgid "VioletRed1" 1351 msgstr "" 1352 1353 #, kde-format 1354 msgctxt "color" 1355 msgid "VioletRed2" 1356 msgstr "" 1357 1358 #, kde-format 1359 msgctxt "color" 1360 msgid "VioletRed3" 1361 msgstr "" 1362 1363 #, kde-format 1364 msgctxt "color" 1365 msgid "VioletRed4" 1366 msgstr "" 1367 1368 #, fuzzy, kde-format 1369 #| msgid "White Space" 1370 msgctxt "color" 1371 msgid "WhiteSmoke" 1372 msgstr "Буш урын" 1373 1374 #, kde-format 1375 msgctxt "color" 1376 msgid "YellowGreen" 1377 msgstr "" 1378 1379 #, fuzzy, kde-format 1380 #| msgctxt "KCharselect unicode block name" 1381 #| msgid "Samaritan" 1382 msgctxt "color" 1383 msgid "aquamarine" 1384 msgstr "Самаритян язмасы" 1385 1386 #, kde-format 1387 msgctxt "color" 1388 msgid "aquamarine1" 1389 msgstr "" 1390 1391 #, kde-format 1392 msgctxt "color" 1393 msgid "aquamarine2" 1394 msgstr "" 1395 1396 #, kde-format 1397 msgctxt "color" 1398 msgid "aquamarine3" 1399 msgstr "" 1400 1401 #, kde-format 1402 msgctxt "color" 1403 msgid "aquamarine4" 1404 msgstr "" 1405 1406 #, kde-format 1407 msgctxt "color" 1408 msgid "azure" 1409 msgstr "" 1410 1411 #, kde-format 1412 msgctxt "color" 1413 msgid "azure1" 1414 msgstr "" 1415 1416 #, kde-format 1417 msgctxt "color" 1418 msgid "azure2" 1419 msgstr "" 1420 1421 #, kde-format 1422 msgctxt "color" 1423 msgid "azure3" 1424 msgstr "" 1425 1426 #, kde-format 1427 msgctxt "color" 1428 msgid "azure4" 1429 msgstr "" 1430 1431 #, kde-format 1432 msgctxt "color" 1433 msgid "beige" 1434 msgstr "" 1435 1436 #, kde-format 1437 msgctxt "color" 1438 msgid "bisque" 1439 msgstr "" 1440 1441 #, kde-format 1442 msgctxt "color" 1443 msgid "bisque1" 1444 msgstr "" 1445 1446 #, kde-format 1447 msgctxt "color" 1448 msgid "bisque2" 1449 msgstr "" 1450 1451 #, kde-format 1452 msgctxt "color" 1453 msgid "bisque3" 1454 msgstr "" 1455 1456 #, kde-format 1457 msgctxt "color" 1458 msgid "bisque4" 1459 msgstr "" 1460 1461 #, kde-format 1462 msgctxt "color" 1463 msgid "black" 1464 msgstr "" 1465 1466 #, kde-format 1467 msgctxt "color" 1468 msgid "blue" 1469 msgstr "" 1470 1471 #, kde-format 1472 msgctxt "color" 1473 msgid "blue1" 1474 msgstr "" 1475 1476 #, kde-format 1477 msgctxt "color" 1478 msgid "blue2" 1479 msgstr "" 1480 1481 #, kde-format 1482 msgctxt "color" 1483 msgid "blue3" 1484 msgstr "" 1485 1486 #, kde-format 1487 msgctxt "color" 1488 msgid "blue4" 1489 msgstr "" 1490 1491 #, kde-format 1492 msgctxt "color" 1493 msgid "brown" 1494 msgstr "" 1495 1496 #, kde-format 1497 msgctxt "color" 1498 msgid "brown1" 1499 msgstr "" 1500 1501 #, kde-format 1502 msgctxt "color" 1503 msgid "brown2" 1504 msgstr "" 1505 1506 #, kde-format 1507 msgctxt "color" 1508 msgid "brown3" 1509 msgstr "" 1510 1511 #, kde-format 1512 msgctxt "color" 1513 msgid "brown4" 1514 msgstr "" 1515 1516 #, kde-format 1517 msgctxt "color" 1518 msgid "burlywood" 1519 msgstr "" 1520 1521 #, kde-format 1522 msgctxt "color" 1523 msgid "burlywood1" 1524 msgstr "" 1525 1526 #, kde-format 1527 msgctxt "color" 1528 msgid "burlywood2" 1529 msgstr "" 1530 1531 #, kde-format 1532 msgctxt "color" 1533 msgid "burlywood3" 1534 msgstr "" 1535 1536 #, kde-format 1537 msgctxt "color" 1538 msgid "burlywood4" 1539 msgstr "" 1540 1541 #, kde-format 1542 msgctxt "color" 1543 msgid "chartreuse" 1544 msgstr "" 1545 1546 #, kde-format 1547 msgctxt "color" 1548 msgid "chartreuse1" 1549 msgstr "" 1550 1551 #, kde-format 1552 msgctxt "color" 1553 msgid "chartreuse2" 1554 msgstr "" 1555 1556 #, kde-format 1557 msgctxt "color" 1558 msgid "chartreuse3" 1559 msgstr "" 1560 1561 #, kde-format 1562 msgctxt "color" 1563 msgid "chartreuse4" 1564 msgstr "" 1565 1566 #, kde-format 1567 msgctxt "color" 1568 msgid "chocolate" 1569 msgstr "" 1570 1571 #, kde-format 1572 msgctxt "color" 1573 msgid "chocolate1" 1574 msgstr "" 1575 1576 #, kde-format 1577 msgctxt "color" 1578 msgid "chocolate2" 1579 msgstr "" 1580 1581 #, kde-format 1582 msgctxt "color" 1583 msgid "chocolate3" 1584 msgstr "" 1585 1586 #, kde-format 1587 msgctxt "color" 1588 msgid "chocolate4" 1589 msgstr "" 1590 1591 #, kde-format 1592 msgctxt "color" 1593 msgid "coral" 1594 msgstr "" 1595 1596 #, kde-format 1597 msgctxt "color" 1598 msgid "coral1" 1599 msgstr "" 1600 1601 #, kde-format 1602 msgctxt "color" 1603 msgid "coral2" 1604 msgstr "" 1605 1606 #, kde-format 1607 msgctxt "color" 1608 msgid "coral3" 1609 msgstr "" 1610 1611 #, kde-format 1612 msgctxt "color" 1613 msgid "coral4" 1614 msgstr "" 1615 1616 #, kde-format 1617 msgctxt "color" 1618 msgid "cornsilk" 1619 msgstr "" 1620 1621 #, kde-format 1622 msgctxt "color" 1623 msgid "cornsilk1" 1624 msgstr "" 1625 1626 #, kde-format 1627 msgctxt "color" 1628 msgid "cornsilk2" 1629 msgstr "" 1630 1631 #, kde-format 1632 msgctxt "color" 1633 msgid "cornsilk3" 1634 msgstr "" 1635 1636 #, kde-format 1637 msgctxt "color" 1638 msgid "cornsilk4" 1639 msgstr "" 1640 1641 #, kde-format 1642 msgctxt "color" 1643 msgid "cyan" 1644 msgstr "" 1645 1646 #, kde-format 1647 msgctxt "color" 1648 msgid "cyan1" 1649 msgstr "" 1650 1651 #, kde-format 1652 msgctxt "color" 1653 msgid "cyan2" 1654 msgstr "" 1655 1656 #, kde-format 1657 msgctxt "color" 1658 msgid "cyan3" 1659 msgstr "" 1660 1661 #, kde-format 1662 msgctxt "color" 1663 msgid "cyan4" 1664 msgstr "" 1665 1666 #, kde-format 1667 msgctxt "color" 1668 msgid "firebrick" 1669 msgstr "" 1670 1671 #, kde-format 1672 msgctxt "color" 1673 msgid "firebrick1" 1674 msgstr "" 1675 1676 #, kde-format 1677 msgctxt "color" 1678 msgid "firebrick2" 1679 msgstr "" 1680 1681 #, kde-format 1682 msgctxt "color" 1683 msgid "firebrick3" 1684 msgstr "" 1685 1686 #, kde-format 1687 msgctxt "color" 1688 msgid "firebrick4" 1689 msgstr "" 1690 1691 #, kde-format 1692 msgctxt "color" 1693 msgid "gainsboro" 1694 msgstr "" 1695 1696 #, kde-format 1697 msgctxt "color" 1698 msgid "gold" 1699 msgstr "" 1700 1701 #, kde-format 1702 msgctxt "color" 1703 msgid "gold1" 1704 msgstr "" 1705 1706 #, kde-format 1707 msgctxt "color" 1708 msgid "gold2" 1709 msgstr "" 1710 1711 #, kde-format 1712 msgctxt "color" 1713 msgid "gold3" 1714 msgstr "" 1715 1716 #, kde-format 1717 msgctxt "color" 1718 msgid "gold4" 1719 msgstr "" 1720 1721 #, kde-format 1722 msgctxt "color" 1723 msgid "goldenrod" 1724 msgstr "" 1725 1726 #, kde-format 1727 msgctxt "color" 1728 msgid "goldenrod1" 1729 msgstr "" 1730 1731 #, kde-format 1732 msgctxt "color" 1733 msgid "goldenrod2" 1734 msgstr "" 1735 1736 #, kde-format 1737 msgctxt "color" 1738 msgid "goldenrod3" 1739 msgstr "" 1740 1741 #, kde-format 1742 msgctxt "color" 1743 msgid "goldenrod4" 1744 msgstr "" 1745 1746 #, fuzzy, kde-format 1747 #| msgid "Green:" 1748 msgctxt "color" 1749 msgid "green" 1750 msgstr "Количество зелёного:" 1751 1752 #, fuzzy, kde-format 1753 #| msgid "Green:" 1754 msgctxt "color" 1755 msgid "green1" 1756 msgstr "Количество зелёного:" 1757 1758 #, fuzzy, kde-format 1759 #| msgid "Green:" 1760 msgctxt "color" 1761 msgid "green2" 1762 msgstr "Количество зелёного:" 1763 1764 #, fuzzy, kde-format 1765 #| msgid "Green:" 1766 msgctxt "color" 1767 msgid "green3" 1768 msgstr "Количество зелёного:" 1769 1770 #, fuzzy, kde-format 1771 #| msgid "Green:" 1772 msgctxt "color" 1773 msgid "green4" 1774 msgstr "Количество зелёного:" 1775 1776 #, kde-format 1777 msgctxt "color" 1778 msgid "honeydew" 1779 msgstr "" 1780 1781 #, kde-format 1782 msgctxt "color" 1783 msgid "honeydew1" 1784 msgstr "" 1785 1786 #, kde-format 1787 msgctxt "color" 1788 msgid "honeydew2" 1789 msgstr "" 1790 1791 #, kde-format 1792 msgctxt "color" 1793 msgid "honeydew3" 1794 msgstr "" 1795 1796 #, kde-format 1797 msgctxt "color" 1798 msgid "honeydew4" 1799 msgstr "" 1800 1801 #, kde-format 1802 msgctxt "color" 1803 msgid "ivory" 1804 msgstr "" 1805 1806 #, kde-format 1807 msgctxt "color" 1808 msgid "ivory1" 1809 msgstr "" 1810 1811 #, kde-format 1812 msgctxt "color" 1813 msgid "ivory2" 1814 msgstr "" 1815 1816 #, kde-format 1817 msgctxt "color" 1818 msgid "ivory3" 1819 msgstr "" 1820 1821 #, kde-format 1822 msgctxt "color" 1823 msgid "ivory4" 1824 msgstr "" 1825 1826 #, kde-format 1827 msgctxt "color" 1828 msgid "khaki" 1829 msgstr "" 1830 1831 #, kde-format 1832 msgctxt "color" 1833 msgid "khaki1" 1834 msgstr "" 1835 1836 #, kde-format 1837 msgctxt "color" 1838 msgid "khaki2" 1839 msgstr "" 1840 1841 #, kde-format 1842 msgctxt "color" 1843 msgid "khaki3" 1844 msgstr "" 1845 1846 #, kde-format 1847 msgctxt "color" 1848 msgid "khaki4" 1849 msgstr "" 1850 1851 #, kde-format 1852 msgctxt "color" 1853 msgid "lavender" 1854 msgstr "" 1855 1856 #, fuzzy, kde-format 1857 #| msgid "Newline" 1858 msgctxt "color" 1859 msgid "linen" 1860 msgstr "Юлны күчерү" 1861 1862 #, fuzzy, kde-format 1863 #| msgctxt "@option:check A filter on file type" 1864 #| msgid "Images" 1865 msgctxt "color" 1866 msgid "magenta" 1867 msgstr "Изображения" 1868 1869 #, kde-format 1870 msgctxt "color" 1871 msgid "magenta1" 1872 msgstr "" 1873 1874 #, kde-format 1875 msgctxt "color" 1876 msgid "magenta2" 1877 msgstr "" 1878 1879 #, kde-format 1880 msgctxt "color" 1881 msgid "magenta3" 1882 msgstr "" 1883 1884 #, kde-format 1885 msgctxt "color" 1886 msgid "magenta4" 1887 msgstr "" 1888 1889 #, kde-format 1890 msgctxt "color" 1891 msgid "maroon" 1892 msgstr "" 1893 1894 #, kde-format 1895 msgctxt "color" 1896 msgid "maroon1" 1897 msgstr "" 1898 1899 #, kde-format 1900 msgctxt "color" 1901 msgid "maroon2" 1902 msgstr "" 1903 1904 #, kde-format 1905 msgctxt "color" 1906 msgid "maroon3" 1907 msgstr "" 1908 1909 #, kde-format 1910 msgctxt "color" 1911 msgid "maroon4" 1912 msgstr "" 1913 1914 #, kde-format 1915 msgctxt "color" 1916 msgid "moccasin" 1917 msgstr "" 1918 1919 #, kde-format 1920 msgctxt "color" 1921 msgid "navy" 1922 msgstr "" 1923 1924 #, kde-format 1925 msgctxt "color" 1926 msgid "orange" 1927 msgstr "" 1928 1929 #, kde-format 1930 msgctxt "color" 1931 msgid "orange1" 1932 msgstr "" 1933 1934 #, kde-format 1935 msgctxt "color" 1936 msgid "orange2" 1937 msgstr "" 1938 1939 #, kde-format 1940 msgctxt "color" 1941 msgid "orange3" 1942 msgstr "" 1943 1944 #, kde-format 1945 msgctxt "color" 1946 msgid "orange4" 1947 msgstr "" 1948 1949 #, kde-format 1950 msgctxt "color" 1951 msgid "orchid" 1952 msgstr "" 1953 1954 #, kde-format 1955 msgctxt "color" 1956 msgid "orchid1" 1957 msgstr "" 1958 1959 #, kde-format 1960 msgctxt "color" 1961 msgid "orchid2" 1962 msgstr "" 1963 1964 #, kde-format 1965 msgctxt "color" 1966 msgid "orchid3" 1967 msgstr "" 1968 1969 #, kde-format 1970 msgctxt "color" 1971 msgid "orchid4" 1972 msgstr "" 1973 1974 #, kde-format 1975 msgctxt "color" 1976 msgid "peru" 1977 msgstr "" 1978 1979 #, kde-format 1980 msgctxt "color" 1981 msgid "pink" 1982 msgstr "" 1983 1984 #, kde-format 1985 msgctxt "color" 1986 msgid "pink1" 1987 msgstr "" 1988 1989 #, kde-format 1990 msgctxt "color" 1991 msgid "pink2" 1992 msgstr "" 1993 1994 #, kde-format 1995 msgctxt "color" 1996 msgid "pink3" 1997 msgstr "" 1998 1999 #, kde-format 2000 msgctxt "color" 2001 msgid "pink4" 2002 msgstr "" 2003 2004 #, kde-format 2005 msgctxt "color" 2006 msgid "plum" 2007 msgstr "" 2008 2009 #, kde-format 2010 msgctxt "color" 2011 msgid "plum1" 2012 msgstr "" 2013 2014 #, kde-format 2015 msgctxt "color" 2016 msgid "plum2" 2017 msgstr "" 2018 2019 #, kde-format 2020 msgctxt "color" 2021 msgid "plum3" 2022 msgstr "" 2023 2024 #, kde-format 2025 msgctxt "color" 2026 msgid "plum4" 2027 msgstr "" 2028 2029 #, kde-format 2030 msgctxt "color" 2031 msgid "purple" 2032 msgstr "" 2033 2034 #, kde-format 2035 msgctxt "color" 2036 msgid "purple1" 2037 msgstr "" 2038 2039 #, kde-format 2040 msgctxt "color" 2041 msgid "purple2" 2042 msgstr "" 2043 2044 #, kde-format 2045 msgctxt "color" 2046 msgid "purple3" 2047 msgstr "" 2048 2049 #, kde-format 2050 msgctxt "color" 2051 msgid "purple4" 2052 msgstr "" 2053 2054 #, kde-format 2055 msgctxt "color" 2056 msgid "red" 2057 msgstr "" 2058 2059 #, kde-format 2060 msgctxt "color" 2061 msgid "red1" 2062 msgstr "" 2063 2064 #, kde-format 2065 msgctxt "color" 2066 msgid "red2" 2067 msgstr "" 2068 2069 #, kde-format 2070 msgctxt "color" 2071 msgid "red3" 2072 msgstr "" 2073 2074 #, kde-format 2075 msgctxt "color" 2076 msgid "red4" 2077 msgstr "" 2078 2079 #, kde-format 2080 msgctxt "color" 2081 msgid "salmon" 2082 msgstr "" 2083 2084 #, kde-format 2085 msgctxt "color" 2086 msgid "salmon1" 2087 msgstr "" 2088 2089 #, kde-format 2090 msgctxt "color" 2091 msgid "salmon2" 2092 msgstr "" 2093 2094 #, kde-format 2095 msgctxt "color" 2096 msgid "salmon3" 2097 msgstr "" 2098 2099 #, kde-format 2100 msgctxt "color" 2101 msgid "salmon4" 2102 msgstr "" 2103 2104 #, kde-format 2105 msgctxt "color" 2106 msgid "seashell" 2107 msgstr "" 2108 2109 #, kde-format 2110 msgctxt "color" 2111 msgid "seashell1" 2112 msgstr "" 2113 2114 #, kde-format 2115 msgctxt "color" 2116 msgid "seashell2" 2117 msgstr "" 2118 2119 #, kde-format 2120 msgctxt "color" 2121 msgid "seashell3" 2122 msgstr "" 2123 2124 #, kde-format 2125 msgctxt "color" 2126 msgid "seashell4" 2127 msgstr "" 2128 2129 #, kde-format 2130 msgctxt "color" 2131 msgid "sienna" 2132 msgstr "" 2133 2134 #, kde-format 2135 msgctxt "color" 2136 msgid "sienna1" 2137 msgstr "" 2138 2139 #, kde-format 2140 msgctxt "color" 2141 msgid "sienna2" 2142 msgstr "" 2143 2144 #, kde-format 2145 msgctxt "color" 2146 msgid "sienna3" 2147 msgstr "" 2148 2149 #, kde-format 2150 msgctxt "color" 2151 msgid "sienna4" 2152 msgstr "" 2153 2154 #, kde-format 2155 msgctxt "color" 2156 msgid "snow" 2157 msgstr "" 2158 2159 #, kde-format 2160 msgctxt "color" 2161 msgid "snow1" 2162 msgstr "" 2163 2164 #, kde-format 2165 msgctxt "color" 2166 msgid "snow2" 2167 msgstr "" 2168 2169 #, kde-format 2170 msgctxt "color" 2171 msgid "snow3" 2172 msgstr "" 2173 2174 #, kde-format 2175 msgctxt "color" 2176 msgid "snow4" 2177 msgstr "" 2178 2179 #, fuzzy, kde-format 2180 #| msgctxt "" 2181 #| "Boolean AND keyword in desktop search strings. You can add several " 2182 #| "variants separated by spaces, e.g. retain the English one alongside the " 2183 #| "translation; keywords are not case sensitive. Make sure there is no " 2184 #| "conflict with the OR keyword." 2185 #| msgid "and" 2186 msgctxt "color" 2187 msgid "tan" 2188 msgstr "и" 2189 2190 #, kde-format 2191 msgctxt "color" 2192 msgid "tan1" 2193 msgstr "" 2194 2195 #, kde-format 2196 msgctxt "color" 2197 msgid "tan2" 2198 msgstr "" 2199 2200 #, kde-format 2201 msgctxt "color" 2202 msgid "tan3" 2203 msgstr "" 2204 2205 #, kde-format 2206 msgctxt "color" 2207 msgid "tan4" 2208 msgstr "" 2209 2210 #, kde-format 2211 msgctxt "color" 2212 msgid "thistle" 2213 msgstr "" 2214 2215 #, kde-format 2216 msgctxt "color" 2217 msgid "thistle1" 2218 msgstr "" 2219 2220 #, kde-format 2221 msgctxt "color" 2222 msgid "thistle2" 2223 msgstr "" 2224 2225 #, kde-format 2226 msgctxt "color" 2227 msgid "thistle3" 2228 msgstr "" 2229 2230 #, kde-format 2231 msgctxt "color" 2232 msgid "thistle4" 2233 msgstr "" 2234 2235 #, fuzzy, kde-format 2236 #| msgctxt "@item:inmenu Text Completion" 2237 #| msgid "Automatic" 2238 msgctxt "color" 2239 msgid "tomato" 2240 msgstr "Актоматик рәвештә" 2241 2242 #, fuzzy, kde-format 2243 #| msgctxt "@item:inmenu Text Completion" 2244 #| msgid "Automatic" 2245 msgctxt "color" 2246 msgid "tomato1" 2247 msgstr "Актоматик рәвештә" 2248 2249 #, fuzzy, kde-format 2250 #| msgctxt "@item:inmenu Text Completion" 2251 #| msgid "Automatic" 2252 msgctxt "color" 2253 msgid "tomato2" 2254 msgstr "Актоматик рәвештә" 2255 2256 #, fuzzy, kde-format 2257 #| msgctxt "@item:inmenu Text Completion" 2258 #| msgid "Automatic" 2259 msgctxt "color" 2260 msgid "tomato3" 2261 msgstr "Актоматик рәвештә" 2262 2263 #, fuzzy, kde-format 2264 #| msgctxt "@item:inmenu Text Completion" 2265 #| msgid "Automatic" 2266 msgctxt "color" 2267 msgid "tomato4" 2268 msgstr "Актоматик рәвештә" 2269 2270 #, kde-format 2271 msgctxt "color" 2272 msgid "turquoise" 2273 msgstr "" 2274 2275 #, kde-format 2276 msgctxt "color" 2277 msgid "turquoise1" 2278 msgstr "" 2279 2280 #, kde-format 2281 msgctxt "color" 2282 msgid "turquoise2" 2283 msgstr "" 2284 2285 #, kde-format 2286 msgctxt "color" 2287 msgid "turquoise3" 2288 msgstr "" 2289 2290 #, kde-format 2291 msgctxt "color" 2292 msgid "turquoise4" 2293 msgstr "" 2294 2295 #, kde-format 2296 msgctxt "color" 2297 msgid "violet" 2298 msgstr "" 2299 2300 #, kde-format 2301 msgctxt "color" 2302 msgid "wheat" 2303 msgstr "" 2304 2305 #, kde-format 2306 msgctxt "color" 2307 msgid "wheat1" 2308 msgstr "" 2309 2310 #, kde-format 2311 msgctxt "color" 2312 msgid "wheat2" 2313 msgstr "" 2314 2315 #, kde-format 2316 msgctxt "color" 2317 msgid "wheat3" 2318 msgstr "" 2319 2320 #, kde-format 2321 msgctxt "color" 2322 msgid "wheat4" 2323 msgstr "" 2324 2325 #, kde-format 2326 msgctxt "color" 2327 msgid "white" 2328 msgstr "" 2329 2330 #, fuzzy, kde-format 2331 #| msgid "Allow" 2332 msgctxt "color" 2333 msgid "yellow" 2334 msgstr "Рөхсәт итәргә" 2335 2336 #, fuzzy, kde-format 2337 #| msgid "Allow" 2338 msgctxt "color" 2339 msgid "yellow1" 2340 msgstr "Рөхсәт итәргә" 2341 2342 #, fuzzy, kde-format 2343 #| msgid "Allow" 2344 msgctxt "color" 2345 msgid "yellow2" 2346 msgstr "Рөхсәт итәргә" 2347 2348 #, fuzzy, kde-format 2349 #| msgid "Allow" 2350 msgctxt "color" 2351 msgid "yellow3" 2352 msgstr "Рөхсәт итәргә" 2353 2354 #, fuzzy, kde-format 2355 #| msgid "Allow" 2356 msgctxt "color" 2357 msgid "yellow4" 2358 msgstr "Рөхсәт итәргә" 2359 2360 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2361 #, fuzzy, kde-format 2362 #| msgid "Settings" 2363 msgid "Debug Settings" 2364 msgstr "Көйләүләр" 2365 2366 #: kdebugdialog/kdebugdialog.cpp:59 2367 #, kde-format 2368 msgid "File" 2369 msgstr "Файл" 2370 2371 #: kdebugdialog/kdebugdialog.cpp:60 2372 #, kde-format 2373 msgid "Message Box" 2374 msgstr "" 2375 2376 #: kdebugdialog/kdebugdialog.cpp:61 2377 #, kde-format 2378 msgid "Shell" 2379 msgstr "" 2380 2381 #: kdebugdialog/kdebugdialog.cpp:62 2382 #, kde-format 2383 msgid "Syslog" 2384 msgstr "" 2385 2386 #: kdebugdialog/kdebugdialog.cpp:63 2387 #, fuzzy, kde-format 2388 #| msgctxt "No border line" 2389 #| msgid "None" 2390 msgid "None" 2391 msgstr "Юк" 2392 2393 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2394 #: kdebugdialog/kdebugdialog.ui:48 2395 #, kde-format 2396 msgid "Information" 2397 msgstr "Мәгълумат" 2398 2399 #. i18n: ectx: property (text), widget (QLabel, label_2) 2400 #. i18n: ectx: property (text), widget (QLabel, label_8) 2401 #. i18n: ectx: property (text), widget (QLabel, label_4) 2402 #. i18n: ectx: property (text), widget (QLabel, label_6) 2403 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2404 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2405 #, fuzzy, kde-format 2406 #| msgid "Output to File..." 2407 msgid "Output to:" 2408 msgstr "Файлга саклау..." 2409 2410 #. i18n: ectx: property (text), widget (QLabel, label_3) 2411 #. i18n: ectx: property (text), widget (QLabel, label_9) 2412 #. i18n: ectx: property (text), widget (QLabel, label_5) 2413 #. i18n: ectx: property (text), widget (QLabel, label_7) 2414 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2415 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2416 #, fuzzy, kde-format 2417 #| msgid "File:" 2418 msgid "Filename:" 2419 msgstr "Файл:" 2420 2421 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2422 #: kdebugdialog/kdebugdialog.ui:83 2423 #, kde-format 2424 msgid "Error" 2425 msgstr "Хата" 2426 2427 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2428 #: kdebugdialog/kdebugdialog.ui:118 2429 #, kde-format 2430 msgid "Abort on fatal errors" 2431 msgstr "" 2432 2433 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2434 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2435 #, fuzzy, kde-format 2436 #| msgid "Do not suppress debug output" 2437 msgid "Disable all debug output" 2438 msgstr "Төзәткечнең чыгышын чагылдыру" 2439 2440 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2441 #: kdebugdialog/kdebugdialog.ui:145 2442 #, kde-format 2443 msgid "Warning" 2444 msgstr "Кисәтү" 2445 2446 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2447 #: kdebugdialog/kdebugdialog.ui:180 2448 #, fuzzy, kde-format 2449 #| msgid "Error" 2450 msgid "Fatal Error" 2451 msgstr "Хата" 2452 2453 #: kdebugdialog/klistdebugdialog.cpp:69 2454 #, fuzzy, kde-format 2455 #| msgctxt "@action" 2456 #| msgid "Select All" 2457 msgid "&Select All" 2458 msgstr "Барысын сайлау" 2459 2460 #: kdebugdialog/klistdebugdialog.cpp:70 2461 #, fuzzy, kde-format 2462 #| msgctxt "@action" 2463 #| msgid "Select All" 2464 msgid "&Deselect All" 2465 msgstr "Барысын сайлау" 2466 2467 #: kdebugdialog/main.cpp:100 2468 #, kde-format 2469 msgid "KDebugDialog" 2470 msgstr "" 2471 2472 #: kdebugdialog/main.cpp:101 2473 #, kde-format 2474 msgid "A dialog box for setting preferences for debug output" 2475 msgstr "" 2476 2477 #: kdebugdialog/main.cpp:102 2478 #, fuzzy, kde-format 2479 #| msgid "Copyright 2001-2011, David Faure <email>faure@kde.org</email>" 2480 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2481 msgstr "© David Faure <email>faure@kde.org</email>, 2001-2011" 2482 2483 #: kdebugdialog/main.cpp:103 2484 #, kde-format 2485 msgid "David Faure" 2486 msgstr "David Faure" 2487 2488 #: kdebugdialog/main.cpp:103 2489 #, kde-format 2490 msgid "Maintainer" 2491 msgstr "Алып баручы" 2492 2493 #: kdebugdialog/main.cpp:108 2494 #, kde-format 2495 msgid "Show the fully-fledged dialog instead of the default list dialog" 2496 msgstr "" 2497 2498 #: kdebugdialog/main.cpp:109 2499 #, kde-format 2500 msgid "Turn area on" 2501 msgstr "" 2502 2503 #: kdebugdialog/main.cpp:110 2504 #, kde-format 2505 msgid "Turn area off" 2506 msgstr "" 2507 2508 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2509 #, kde-format 2510 msgid "no error" 2511 msgstr "хатасыз" 2512 2513 #: kdecore/k3resolver.cpp:534 2514 #, kde-format 2515 msgid "requested family not supported for this host name" 2516 msgstr "Күрсәтелгән сервер исеме өчен бу гаиләлек кабул ителми" 2517 2518 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2519 #, kde-format 2520 msgid "temporary failure in name resolution" 2521 msgstr "исемнәрне билгеләгәндә вакытлы тоткарлык килеп чыкты" 2522 2523 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2524 #, kde-format 2525 msgid "non-recoverable failure in name resolution" 2526 msgstr "Исемнернә билгеләгәндә тәнкыйть хата килеп чыкты" 2527 2528 #: kdecore/k3resolver.cpp:537 2529 #, kde-format 2530 msgid "invalid flags" 2531 msgstr "хаталы әләмләр" 2532 2533 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2534 #, kde-format 2535 msgid "memory allocation failure" 2536 msgstr "хәтер бирү хатасы" 2537 2538 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2539 #, kde-format 2540 msgid "name or service not known" 2541 msgstr "исем яисә хезмәт билгесез" 2542 2543 #: kdecore/k3resolver.cpp:540 2544 #, kde-format 2545 msgid "requested family not supported" 2546 msgstr "соралган гаиләлек тотылмый" 2547 2548 #: kdecore/k3resolver.cpp:541 2549 #, kde-format 2550 msgid "requested service not supported for this socket type" 2551 msgstr "Бу сокет төре соралган хезмәтне тотмый" 2552 2553 #: kdecore/k3resolver.cpp:542 2554 #, kde-format 2555 msgid "requested socket type not supported" 2556 msgstr "соралган сокетлар төре тотылмый" 2557 2558 #: kdecore/k3resolver.cpp:543 2559 #, kde-format 2560 msgid "unknown error" 2561 msgstr "билгесез хата" 2562 2563 #: kdecore/k3resolver.cpp:545 2564 #, kde-format 2565 msgctxt "1: the i18n'ed system error code, from errno" 2566 msgid "system error: %1" 2567 msgstr "системалы хата: %1" 2568 2569 #: kdecore/k3resolver.cpp:556 2570 #, kde-format 2571 msgid "request was canceled" 2572 msgstr "сорау кире кагылгды" 2573 2574 #: kdecore/k3socketaddress.cpp:631 2575 #, kde-format 2576 msgctxt "1: the unknown socket address family number" 2577 msgid "Unknown family %1" 2578 msgstr "%1 гаиләсе билгесез" 2579 2580 #: kdecore/k3socketbase.cpp:215 2581 #, kde-format 2582 msgctxt "Socket error code NoError" 2583 msgid "no error" 2584 msgstr "хатасыз" 2585 2586 #: kdecore/k3socketbase.cpp:220 2587 #, kde-format 2588 msgctxt "Socket error code LookupFailure" 2589 msgid "name lookup has failed" 2590 msgstr "Исемне билгеләү хатасы" 2591 2592 #: kdecore/k3socketbase.cpp:225 2593 #, kde-format 2594 msgctxt "Socket error code AddressInUse" 2595 msgid "address already in use" 2596 msgstr "адрес инде кулланыла" 2597 2598 #: kdecore/k3socketbase.cpp:230 2599 #, kde-format 2600 msgctxt "Socket error code AlreadyBound" 2601 msgid "socket is already bound" 2602 msgstr "сокет инде адрес һәм порт белән бәйләнгән" 2603 2604 #: kdecore/k3socketbase.cpp:235 2605 #, kde-format 2606 msgctxt "Socket error code AlreadyCreated" 2607 msgid "socket is already created" 2608 msgstr "сокет ясалган инде" 2609 2610 #: kdecore/k3socketbase.cpp:240 2611 #, kde-format 2612 msgctxt "Socket error code NotBound" 2613 msgid "socket is not bound" 2614 msgstr "сокет буш" 2615 2616 #: kdecore/k3socketbase.cpp:245 2617 #, kde-format 2618 msgctxt "Socket error code NotCreated" 2619 msgid "socket has not been created" 2620 msgstr "сокетны ясап булмады" 2621 2622 #: kdecore/k3socketbase.cpp:250 2623 #, kde-format 2624 msgctxt "Socket error code WouldBlock" 2625 msgid "operation would block" 2626 msgstr "гамәл блоклаштыруга китерер иде" 2627 2628 #: kdecore/k3socketbase.cpp:255 2629 #, kde-format 2630 msgctxt "Socket error code ConnectionRefused" 2631 msgid "connection actively refused" 2632 msgstr "Элемтә кире кагылды" 2633 2634 #: kdecore/k3socketbase.cpp:260 2635 #, kde-format 2636 msgctxt "Socket error code ConnectionTimedOut" 2637 msgid "connection timed out" 2638 msgstr "Тоташу вакыты үтте" 2639 2640 #: kdecore/k3socketbase.cpp:265 2641 #, kde-format 2642 msgctxt "Socket error code InProgress" 2643 msgid "operation is already in progress" 2644 msgstr "гамәл инде башкарыла" 2645 2646 #: kdecore/k3socketbase.cpp:270 2647 #, kde-format 2648 msgctxt "Socket error code NetFailure" 2649 msgid "network failure occurred" 2650 msgstr "челтәр хатасы килеп чыкты" 2651 2652 #: kdecore/k3socketbase.cpp:275 2653 #, kde-format 2654 msgctxt "Socket error code NotSupported" 2655 msgid "operation is not supported" 2656 msgstr "гамәл тотылмый" 2657 2658 #: kdecore/k3socketbase.cpp:280 2659 #, kde-format 2660 msgctxt "Socket error code Timeout" 2661 msgid "timed operation timed out" 2662 msgstr "гамәлне көтү вакыты үтте" 2663 2664 #: kdecore/k3socketbase.cpp:285 2665 #, kde-format 2666 msgctxt "Socket error code UnknownError" 2667 msgid "an unknown/unexpected error has happened" 2668 msgstr "Билгесез яисә көтелмәгән хата килеп чыкты" 2669 2670 #: kdecore/k3socketbase.cpp:290 2671 #, kde-format 2672 msgctxt "Socket error code RemotelyDisconnected" 2673 msgid "remote host closed connection" 2674 msgstr "ерактагы үзәк элемтәне өзде" 2675 2676 #: kdecore/k4aboutdata.cpp:267 2677 #, kde-format 2678 msgid "" 2679 "No licensing terms for this program have been specified.\n" 2680 "Please check the documentation or the source for any\n" 2681 "licensing terms.\n" 2682 msgstr "" 2683 "Бу кушымтада лицензия күрсәтелмәгән.\n" 2684 "Бәлки, ул кушымтаның документациясендә яки чыганаклы текстларында " 2685 "күрсәтелгәндер.\n" 2686 2687 #: kdecore/k4aboutdata.cpp:273 2688 #, kde-format 2689 msgid "This program is distributed under the terms of the %1." 2690 msgstr "Кушымта %1 шартларында таратыла." 2691 2692 #: kdecore/k4aboutdata.cpp:297 2693 #, kde-format 2694 msgctxt "@item license (short name)" 2695 msgid "GPL v2" 2696 msgstr "GPL v2" 2697 2698 #: kdecore/k4aboutdata.cpp:298 2699 #, kde-format 2700 msgctxt "@item license" 2701 msgid "GNU General Public License Version 2" 2702 msgstr "GNU General Public License, 2-нче юрамасы" 2703 2704 #: kdecore/k4aboutdata.cpp:301 2705 #, kde-format 2706 msgctxt "@item license (short name)" 2707 msgid "LGPL v2" 2708 msgstr "LGPL v2" 2709 2710 #: kdecore/k4aboutdata.cpp:302 2711 #, kde-format 2712 msgctxt "@item license" 2713 msgid "GNU Lesser General Public License Version 2" 2714 msgstr "GNU Lesser General Public License, 2-нче юрамасы" 2715 2716 #: kdecore/k4aboutdata.cpp:305 2717 #, kde-format 2718 msgctxt "@item license (short name)" 2719 msgid "BSD License" 2720 msgstr "BSD лицензиясе" 2721 2722 #: kdecore/k4aboutdata.cpp:306 2723 #, kde-format 2724 msgctxt "@item license" 2725 msgid "BSD License" 2726 msgstr "BSD лицензиясе" 2727 2728 #: kdecore/k4aboutdata.cpp:309 2729 #, kde-format 2730 msgctxt "@item license (short name)" 2731 msgid "Artistic License" 2732 msgstr "Artistic License" 2733 2734 #: kdecore/k4aboutdata.cpp:310 2735 #, kde-format 2736 msgctxt "@item license" 2737 msgid "Artistic License" 2738 msgstr "Artistic License" 2739 2740 #: kdecore/k4aboutdata.cpp:313 2741 #, kde-format 2742 msgctxt "@item license (short name)" 2743 msgid "QPL v1.0" 2744 msgstr "QPL v1.0" 2745 2746 #: kdecore/k4aboutdata.cpp:314 2747 #, kde-format 2748 msgctxt "@item license" 2749 msgid "Q Public License" 2750 msgstr "Q Public License" 2751 2752 #: kdecore/k4aboutdata.cpp:317 2753 #, kde-format 2754 msgctxt "@item license (short name)" 2755 msgid "GPL v3" 2756 msgstr "GPL v3" 2757 2758 #: kdecore/k4aboutdata.cpp:318 2759 #, kde-format 2760 msgctxt "@item license" 2761 msgid "GNU General Public License Version 3" 2762 msgstr "GNU General Public License, 3-нче юрамасы" 2763 2764 #: kdecore/k4aboutdata.cpp:321 2765 #, kde-format 2766 msgctxt "@item license (short name)" 2767 msgid "LGPL v3" 2768 msgstr "LGPL v3" 2769 2770 #: kdecore/k4aboutdata.cpp:322 2771 #, kde-format 2772 msgctxt "@item license" 2773 msgid "GNU Lesser General Public License Version 3" 2774 msgstr "GNU Lesser General Public License, 3-нче юрамасы" 2775 2776 #: kdecore/k4aboutdata.cpp:326 2777 #, kde-format 2778 msgctxt "@item license" 2779 msgid "Custom" 2780 msgstr "Өстәмә" 2781 2782 #: kdecore/k4aboutdata.cpp:329 2783 #, kde-format 2784 msgctxt "@item license" 2785 msgid "Not specified" 2786 msgstr "Лицензия күрсәтелмәгән" 2787 2788 #: kdecore/k4aboutdata.cpp:891 2789 #, kde-format 2790 msgctxt "replace this with information about your translation team" 2791 msgid "" 2792 "<p>KDE is translated into many languages thanks to the work of the " 2793 "translation teams all over the world.</p><p>For more information on KDE " 2794 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2795 "org</a></p>" 2796 msgstr "" 2797 "<p>KDE исемле график чолганышы төрле илләрдә яшәүче тәрҗемәчеләр төркемнәре " 2798 "ярдәмендә күп телләргә тәрҗемә ителгән.</p><p>KDE проектының тәрҗемә итү " 2799 "турында күбрәк мәгълумат алу өчен <a href=\"http://l10n.kde.org\">l10n.kde." 2800 "org</a> сәхифәсенә мөрәҗәгать итегез.</p>" 2801 2802 #: kdecore/kcalendarsystem.cpp:108 2803 #, kde-format 2804 msgctxt "@item Calendar system" 2805 msgid "Gregorian" 2806 msgstr "" 2807 2808 #: kdecore/kcalendarsystem.cpp:110 2809 #, fuzzy, kde-format 2810 #| msgctxt "KCharselect unicode block name" 2811 #| msgid "Coptic" 2812 msgctxt "@item Calendar system" 2813 msgid "Coptic" 2814 msgstr "Копт тамгалары" 2815 2816 #: kdecore/kcalendarsystem.cpp:112 2817 #, fuzzy, kde-format 2818 #| msgctxt "KCharselect unicode block name" 2819 #| msgid "Ethiopic" 2820 msgctxt "@item Calendar system" 2821 msgid "Ethiopian" 2822 msgstr "Эфиоп" 2823 2824 #: kdecore/kcalendarsystem.cpp:114 2825 #, fuzzy, kde-format 2826 #| msgctxt "@item Spelling dictionary" 2827 #| msgid "Hebrew" 2828 msgctxt "@item Calendar system" 2829 msgid "Hebrew" 2830 msgstr "Иврит" 2831 2832 #: kdecore/kcalendarsystem.cpp:116 2833 #, kde-format 2834 msgctxt "@item Calendar system" 2835 msgid "Islamic / Hijri (Civil)" 2836 msgstr "" 2837 2838 #: kdecore/kcalendarsystem.cpp:118 2839 #, kde-format 2840 msgctxt "@item Calendar system" 2841 msgid "Indian National" 2842 msgstr "" 2843 2844 #: kdecore/kcalendarsystem.cpp:120 2845 #, kde-format 2846 msgctxt "@item Calendar system" 2847 msgid "Jalali" 2848 msgstr "" 2849 2850 #: kdecore/kcalendarsystem.cpp:122 2851 #, fuzzy, kde-format 2852 #| msgctxt "@item Text character set" 2853 #| msgid "Japanese" 2854 msgctxt "@item Calendar system" 2855 msgid "Japanese" 2856 msgstr "Япон" 2857 2858 #: kdecore/kcalendarsystem.cpp:124 2859 #, kde-format 2860 msgctxt "@item Calendar system" 2861 msgid "Julian" 2862 msgstr "" 2863 2864 #: kdecore/kcalendarsystem.cpp:126 2865 #, fuzzy, kde-format 2866 #| msgctxt "@item Text character set" 2867 #| msgid "Japanese" 2868 msgctxt "@item Calendar system" 2869 msgid "Taiwanese" 2870 msgstr "Япон" 2871 2872 #: kdecore/kcalendarsystem.cpp:128 2873 #, fuzzy, kde-format 2874 #| msgctxt "@item Text character set" 2875 #| msgid "Thai" 2876 msgctxt "@item Calendar system" 2877 msgid "Thai" 2878 msgstr "Тай" 2879 2880 #: kdecore/kcalendarsystem.cpp:131 2881 #, kde-format 2882 msgctxt "@item Calendar system" 2883 msgid "Invalid Calendar Type" 2884 msgstr "" 2885 2886 #: kdecore/kcalendarsystem.cpp:1495 2887 #, fuzzy, kde-format 2888 #| msgctxt "subtraction" 2889 #| msgid "-" 2890 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2891 msgid "-" 2892 msgstr "-" 2893 2894 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2895 #: kio/kfilemetadataprovider.cpp:199 2896 #, kde-format 2897 msgid "Today" 2898 msgstr "Бүген" 2899 2900 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2901 #: kio/kfilemetadataprovider.cpp:202 2902 #, kde-format 2903 msgid "Yesterday" 2904 msgstr "Кичә" 2905 2906 #: kdecore/kcalendarsystemcoptic.cpp:45 2907 #, kde-format 2908 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2909 msgid "Anno Martyrum" 2910 msgstr "" 2911 2912 #: kdecore/kcalendarsystemcoptic.cpp:46 2913 #, fuzzy, kde-format 2914 #| msgctxt "Before Noon KLocale::ShortName" 2915 #| msgid "AM" 2916 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2917 msgid "AM" 2918 msgstr "ТК" 2919 2920 #: kdecore/kcalendarsystemcoptic.cpp:47 2921 #, kde-format 2922 msgctxt "" 2923 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2924 msgid "%Ey %EC" 2925 msgstr "" 2926 2927 #: kdecore/kcalendarsystemcoptic.cpp:153 2928 #, kde-format 2929 msgctxt "Coptic month 1 - KLocale::NarrowName" 2930 msgid "T" 2931 msgstr "" 2932 2933 #: kdecore/kcalendarsystemcoptic.cpp:155 2934 #, fuzzy, kde-format 2935 #| msgctxt "After Noon KLocale::NarrowName" 2936 #| msgid "P" 2937 msgctxt "Coptic month 2 - KLocale::NarrowName" 2938 msgid "P" 2939 msgstr "С" 2940 2941 #: kdecore/kcalendarsystemcoptic.cpp:157 2942 #, kde-format 2943 msgctxt "Coptic month 3 - KLocale::NarrowName" 2944 msgid "H" 2945 msgstr "" 2946 2947 #: kdecore/kcalendarsystemcoptic.cpp:159 2948 #, kde-format 2949 msgctxt "Coptic month 4 - KLocale::NarrowName" 2950 msgid "K" 2951 msgstr "" 2952 2953 #: kdecore/kcalendarsystemcoptic.cpp:161 2954 #, kde-format 2955 msgctxt "Coptic month 5 - KLocale::NarrowName" 2956 msgid "T" 2957 msgstr "" 2958 2959 #: kdecore/kcalendarsystemcoptic.cpp:163 2960 #, fuzzy, kde-format 2961 #| msgctxt "Before Noon KLocale::ShortName" 2962 #| msgid "AM" 2963 msgctxt "Coptic month 6 - KLocale::NarrowName" 2964 msgid "M" 2965 msgstr "ТК" 2966 2967 #: kdecore/kcalendarsystemcoptic.cpp:165 2968 #, fuzzy, kde-format 2969 #| msgctxt "After Noon KLocale::NarrowName" 2970 #| msgid "P" 2971 msgctxt "Coptic month 7 - KLocale::NarrowName" 2972 msgid "P" 2973 msgstr "С" 2974 2975 #: kdecore/kcalendarsystemcoptic.cpp:167 2976 #, fuzzy, kde-format 2977 #| msgctxt "After Noon KLocale::NarrowName" 2978 #| msgid "P" 2979 msgctxt "Coptic month 8 - KLocale::NarrowName" 2980 msgid "P" 2981 msgstr "С" 2982 2983 #: kdecore/kcalendarsystemcoptic.cpp:169 2984 #, fuzzy, kde-format 2985 #| msgctxt "After Noon KLocale::NarrowName" 2986 #| msgid "P" 2987 msgctxt "Coptic month 9 - KLocale::NarrowName" 2988 msgid "P" 2989 msgstr "С" 2990 2991 #: kdecore/kcalendarsystemcoptic.cpp:171 2992 #, fuzzy, kde-format 2993 #| msgctxt "After Noon KLocale::NarrowName" 2994 #| msgid "P" 2995 msgctxt "Coptic month 10 - KLocale::NarrowName" 2996 msgid "P" 2997 msgstr "С" 2998 2999 #: kdecore/kcalendarsystemcoptic.cpp:173 3000 #, kde-format 3001 msgctxt "Coptic month 11 - KLocale::NarrowName" 3002 msgid "E" 3003 msgstr "" 3004 3005 #: kdecore/kcalendarsystemcoptic.cpp:175 3006 #, fuzzy, kde-format 3007 #| msgctxt "Before Noon KLocale::ShortName" 3008 #| msgid "AM" 3009 msgctxt "Coptic month 12 - KLocale::NarrowName" 3010 msgid "M" 3011 msgstr "ТК" 3012 3013 #: kdecore/kcalendarsystemcoptic.cpp:177 3014 #, kde-format 3015 msgctxt "Coptic month 13 - KLocale::NarrowName" 3016 msgid "K" 3017 msgstr "" 3018 3019 #: kdecore/kcalendarsystemcoptic.cpp:186 3020 #, kde-format 3021 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 3022 msgid "of Tho" 3023 msgstr "" 3024 3025 #: kdecore/kcalendarsystemcoptic.cpp:188 3026 #, kde-format 3027 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 3028 msgid "of Pao" 3029 msgstr "" 3030 3031 #: kdecore/kcalendarsystemcoptic.cpp:190 3032 #, kde-format 3033 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 3034 msgid "of Hat" 3035 msgstr "" 3036 3037 #: kdecore/kcalendarsystemcoptic.cpp:192 3038 #, kde-format 3039 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 3040 msgid "of Kia" 3041 msgstr "" 3042 3043 #: kdecore/kcalendarsystemcoptic.cpp:194 3044 #, kde-format 3045 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 3046 msgid "of Tob" 3047 msgstr "" 3048 3049 #: kdecore/kcalendarsystemcoptic.cpp:196 3050 #, kde-format 3051 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 3052 msgid "of Mes" 3053 msgstr "" 3054 3055 #: kdecore/kcalendarsystemcoptic.cpp:198 3056 #, kde-format 3057 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 3058 msgid "of Par" 3059 msgstr "" 3060 3061 #: kdecore/kcalendarsystemcoptic.cpp:200 3062 #, kde-format 3063 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 3064 msgid "of Pam" 3065 msgstr "" 3066 3067 #: kdecore/kcalendarsystemcoptic.cpp:202 3068 #, kde-format 3069 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 3070 msgid "of Pas" 3071 msgstr "" 3072 3073 #: kdecore/kcalendarsystemcoptic.cpp:204 3074 #, kde-format 3075 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 3076 msgid "of Pan" 3077 msgstr "" 3078 3079 #: kdecore/kcalendarsystemcoptic.cpp:206 3080 #, kde-format 3081 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 3082 msgid "of Epe" 3083 msgstr "" 3084 3085 #: kdecore/kcalendarsystemcoptic.cpp:208 3086 #, kde-format 3087 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 3088 msgid "of Meo" 3089 msgstr "" 3090 3091 #: kdecore/kcalendarsystemcoptic.cpp:210 3092 #, kde-format 3093 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3094 msgid "of Kou" 3095 msgstr "" 3096 3097 #: kdecore/kcalendarsystemcoptic.cpp:219 3098 #, fuzzy, kde-format 3099 #| msgctxt "Email receiver address" 3100 #| msgid "To:" 3101 msgctxt "Coptic month 1 - KLocale::ShortName" 3102 msgid "Tho" 3103 msgstr "Кемгә:" 3104 3105 #: kdecore/kcalendarsystemcoptic.cpp:221 3106 #, fuzzy, kde-format 3107 #| msgctxt "KCharselect unicode block name" 3108 #| msgid "Lao" 3109 msgctxt "Coptic month 2 - KLocale::ShortName" 3110 msgid "Pao" 3111 msgstr "Лаос" 3112 3113 #: kdecore/kcalendarsystemcoptic.cpp:223 3114 #, kde-format 3115 msgctxt "Coptic month 3 - KLocale::ShortName" 3116 msgid "Hat" 3117 msgstr "" 3118 3119 #: kdecore/kcalendarsystemcoptic.cpp:225 3120 #, kde-format 3121 msgctxt "Coptic month 4 - KLocale::ShortName" 3122 msgid "Kia" 3123 msgstr "" 3124 3125 #: kdecore/kcalendarsystemcoptic.cpp:227 3126 #, fuzzy, kde-format 3127 #| msgid "Job" 3128 msgctxt "Coptic month 5 - KLocale::ShortName" 3129 msgid "Tob" 3130 msgstr "Эш" 3131 3132 #: kdecore/kcalendarsystemcoptic.cpp:229 3133 #, fuzzy, kde-format 3134 #| msgid "Yes" 3135 msgctxt "Coptic month 6 - KLocale::ShortName" 3136 msgid "Mes" 3137 msgstr "Әйе" 3138 3139 #: kdecore/kcalendarsystemcoptic.cpp:231 3140 #, kde-format 3141 msgctxt "Coptic month 7 - KLocale::ShortName" 3142 msgid "Par" 3143 msgstr "" 3144 3145 #: kdecore/kcalendarsystemcoptic.cpp:233 3146 #, fuzzy, kde-format 3147 #| msgid "am" 3148 msgctxt "Coptic month 8 - KLocale::ShortName" 3149 msgid "Pam" 3150 msgstr "am" 3151 3152 #: kdecore/kcalendarsystemcoptic.cpp:235 3153 #, fuzzy, kde-format 3154 #| msgid "Pages" 3155 msgctxt "Coptic month 9 - KLocale::ShortName" 3156 msgid "Pas" 3157 msgstr "Битләр" 3158 3159 #: kdecore/kcalendarsystemcoptic.cpp:237 3160 #, fuzzy, kde-format 3161 #| msgctxt "" 3162 #| "Boolean AND keyword in desktop search strings. You can add several " 3163 #| "variants separated by spaces, e.g. retain the English one alongside the " 3164 #| "translation; keywords are not case sensitive. Make sure there is no " 3165 #| "conflict with the OR keyword." 3166 #| msgid "and" 3167 msgctxt "Coptic month 10 - KLocale::ShortName" 3168 msgid "Pan" 3169 msgstr "и" 3170 3171 #: kdecore/kcalendarsystemcoptic.cpp:239 3172 #, fuzzy, kde-format 3173 #| msgid "Escape" 3174 msgctxt "Coptic month 11 - KLocale::ShortName" 3175 msgid "Epe" 3176 msgstr "Escape" 3177 3178 #: kdecore/kcalendarsystemcoptic.cpp:241 3179 #, kde-format 3180 msgctxt "Coptic month 12 - KLocale::ShortName" 3181 msgid "Meo" 3182 msgstr "" 3183 3184 #: kdecore/kcalendarsystemcoptic.cpp:243 3185 #, fuzzy, kde-format 3186 #| msgctxt "KCharselect unicode block name" 3187 #| msgid "NKo" 3188 msgctxt "Coptic month 12 - KLocale::ShortName" 3189 msgid "Kou" 3190 msgstr "Нко" 3191 3192 #: kdecore/kcalendarsystemcoptic.cpp:252 3193 #, kde-format 3194 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3195 msgid "of Thoout" 3196 msgstr "" 3197 3198 #: kdecore/kcalendarsystemcoptic.cpp:254 3199 #, kde-format 3200 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3201 msgid "of Paope" 3202 msgstr "" 3203 3204 #: kdecore/kcalendarsystemcoptic.cpp:256 3205 #, fuzzy, kde-format 3206 #| msgid "Contact author" 3207 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3208 msgid "of Hathor" 3209 msgstr "Автор белән элемтә" 3210 3211 #: kdecore/kcalendarsystemcoptic.cpp:258 3212 #, kde-format 3213 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3214 msgid "of Kiahk" 3215 msgstr "" 3216 3217 #: kdecore/kcalendarsystemcoptic.cpp:260 3218 #, kde-format 3219 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3220 msgid "of Tobe" 3221 msgstr "" 3222 3223 #: kdecore/kcalendarsystemcoptic.cpp:262 3224 #, kde-format 3225 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3226 msgid "of Meshir" 3227 msgstr "" 3228 3229 #: kdecore/kcalendarsystemcoptic.cpp:264 3230 #, kde-format 3231 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3232 msgid "of Paremhotep" 3233 msgstr "" 3234 3235 #: kdecore/kcalendarsystemcoptic.cpp:266 3236 #, kde-format 3237 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3238 msgid "of Parmoute" 3239 msgstr "" 3240 3241 #: kdecore/kcalendarsystemcoptic.cpp:268 3242 #, kde-format 3243 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3244 msgid "of Pashons" 3245 msgstr "" 3246 3247 #: kdecore/kcalendarsystemcoptic.cpp:270 3248 #, kde-format 3249 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3250 msgid "of Paone" 3251 msgstr "" 3252 3253 #: kdecore/kcalendarsystemcoptic.cpp:272 3254 #, kde-format 3255 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3256 msgid "of Epep" 3257 msgstr "" 3258 3259 #: kdecore/kcalendarsystemcoptic.cpp:274 3260 #, kde-format 3261 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3262 msgid "of Mesore" 3263 msgstr "" 3264 3265 #: kdecore/kcalendarsystemcoptic.cpp:276 3266 #, kde-format 3267 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3268 msgid "of Kouji nabot" 3269 msgstr "" 3270 3271 #: kdecore/kcalendarsystemcoptic.cpp:285 3272 #, kde-format 3273 msgctxt "Coptic month 1 - KLocale::LongName" 3274 msgid "Thoout" 3275 msgstr "" 3276 3277 #: kdecore/kcalendarsystemcoptic.cpp:287 3278 #, kde-format 3279 msgctxt "Coptic month 2 - KLocale::LongName" 3280 msgid "Paope" 3281 msgstr "" 3282 3283 #: kdecore/kcalendarsystemcoptic.cpp:289 3284 #, fuzzy, kde-format 3285 #| msgid "Author" 3286 msgctxt "Coptic month 3 - KLocale::LongName" 3287 msgid "Hathor" 3288 msgstr "Автор" 3289 3290 #: kdecore/kcalendarsystemcoptic.cpp:291 3291 #, kde-format 3292 msgctxt "Coptic month 4 - KLocale::LongName" 3293 msgid "Kiahk" 3294 msgstr "" 3295 3296 #: kdecore/kcalendarsystemcoptic.cpp:293 3297 #, kde-format 3298 msgctxt "Coptic month 5 - KLocale::LongName" 3299 msgid "Tobe" 3300 msgstr "" 3301 3302 #: kdecore/kcalendarsystemcoptic.cpp:295 3303 #, kde-format 3304 msgctxt "Coptic month 6 - KLocale::LongName" 3305 msgid "Meshir" 3306 msgstr "" 3307 3308 #: kdecore/kcalendarsystemcoptic.cpp:297 3309 #, kde-format 3310 msgctxt "Coptic month 7 - KLocale::LongName" 3311 msgid "Paremhotep" 3312 msgstr "" 3313 3314 #: kdecore/kcalendarsystemcoptic.cpp:299 3315 #, kde-format 3316 msgctxt "Coptic month 8 - KLocale::LongName" 3317 msgid "Parmoute" 3318 msgstr "" 3319 3320 #: kdecore/kcalendarsystemcoptic.cpp:301 3321 #, kde-format 3322 msgctxt "Coptic month 9 - KLocale::LongName" 3323 msgid "Pashons" 3324 msgstr "" 3325 3326 #: kdecore/kcalendarsystemcoptic.cpp:303 3327 #, kde-format 3328 msgctxt "Coptic month 10 - KLocale::LongName" 3329 msgid "Paone" 3330 msgstr "" 3331 3332 #: kdecore/kcalendarsystemcoptic.cpp:305 3333 #, kde-format 3334 msgctxt "Coptic month 11 - KLocale::LongName" 3335 msgid "Epep" 3336 msgstr "" 3337 3338 #: kdecore/kcalendarsystemcoptic.cpp:307 3339 #, kde-format 3340 msgctxt "Coptic month 12 - KLocale::LongName" 3341 msgid "Mesore" 3342 msgstr "" 3343 3344 #: kdecore/kcalendarsystemcoptic.cpp:309 3345 #, kde-format 3346 msgctxt "Coptic month 12 - KLocale::LongName" 3347 msgid "Kouji nabot" 3348 msgstr "" 3349 3350 #: kdecore/kcalendarsystemcoptic.cpp:324 3351 #, fuzzy, kde-format 3352 #| msgctxt "After Noon KLocale::NarrowName" 3353 #| msgid "P" 3354 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3355 msgid "P" 3356 msgstr "С" 3357 3358 #: kdecore/kcalendarsystemcoptic.cpp:326 3359 #, fuzzy, kde-format 3360 #| msgctxt "After Noon KLocale::NarrowName" 3361 #| msgid "P" 3362 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3363 msgid "P" 3364 msgstr "С" 3365 3366 #: kdecore/kcalendarsystemcoptic.cpp:328 3367 #, fuzzy, kde-format 3368 #| msgctxt "After Noon KLocale::NarrowName" 3369 #| msgid "P" 3370 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3371 msgid "P" 3372 msgstr "С" 3373 3374 #: kdecore/kcalendarsystemcoptic.cpp:330 3375 #, fuzzy, kde-format 3376 #| msgctxt "After Noon KLocale::NarrowName" 3377 #| msgid "P" 3378 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3379 msgid "P" 3380 msgstr "С" 3381 3382 #: kdecore/kcalendarsystemcoptic.cpp:332 3383 #, fuzzy, kde-format 3384 #| msgctxt "After Noon KLocale::NarrowName" 3385 #| msgid "P" 3386 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3387 msgid "P" 3388 msgstr "С" 3389 3390 #: kdecore/kcalendarsystemcoptic.cpp:334 3391 #, fuzzy, kde-format 3392 #| msgctxt "After Noon KLocale::NarrowName" 3393 #| msgid "P" 3394 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3395 msgid "P" 3396 msgstr "С" 3397 3398 #: kdecore/kcalendarsystemcoptic.cpp:336 3399 #, kde-format 3400 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3401 msgid "T" 3402 msgstr "" 3403 3404 #: kdecore/kcalendarsystemcoptic.cpp:345 3405 #, fuzzy, kde-format 3406 #| msgid "Pages" 3407 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3408 msgid "Pes" 3409 msgstr "Битләр" 3410 3411 #: kdecore/kcalendarsystemcoptic.cpp:347 3412 #, fuzzy, kde-format 3413 #| msgctxt "@item Spelling dictionary" 3414 #| msgid "Polish" 3415 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3416 msgid "Psh" 3417 msgstr "Польша" 3418 3419 #: kdecore/kcalendarsystemcoptic.cpp:349 3420 #, kde-format 3421 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3422 msgid "Pef" 3423 msgstr "" 3424 3425 #: kdecore/kcalendarsystemcoptic.cpp:351 3426 #, kde-format 3427 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3428 msgid "Pti" 3429 msgstr "" 3430 3431 #: kdecore/kcalendarsystemcoptic.cpp:353 3432 #, kde-format 3433 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3434 msgid "Pso" 3435 msgstr "" 3436 3437 #: kdecore/kcalendarsystemcoptic.cpp:355 3438 #, kde-format 3439 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3440 msgid "Psa" 3441 msgstr "" 3442 3443 #: kdecore/kcalendarsystemcoptic.cpp:357 3444 #, kde-format 3445 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3446 msgid "Tky" 3447 msgstr "" 3448 3449 #: kdecore/kcalendarsystemcoptic.cpp:365 3450 #, kde-format 3451 msgctxt "Coptic weekday 1 - KLocale::LongName" 3452 msgid "Pesnau" 3453 msgstr "" 3454 3455 #: kdecore/kcalendarsystemcoptic.cpp:367 3456 #, fuzzy, kde-format 3457 #| msgid "Comment" 3458 msgctxt "Coptic weekday 2 - KLocale::LongName" 3459 msgid "Pshoment" 3460 msgstr "Комментарий" 3461 3462 #: kdecore/kcalendarsystemcoptic.cpp:369 3463 #, kde-format 3464 msgctxt "Coptic weekday 3 - KLocale::LongName" 3465 msgid "Peftoou" 3466 msgstr "" 3467 3468 #: kdecore/kcalendarsystemcoptic.cpp:371 3469 #, kde-format 3470 msgctxt "Coptic weekday 4 - KLocale::LongName" 3471 msgid "Ptiou" 3472 msgstr "" 3473 3474 #: kdecore/kcalendarsystemcoptic.cpp:373 3475 #, kde-format 3476 msgctxt "Coptic weekday 5 - KLocale::LongName" 3477 msgid "Psoou" 3478 msgstr "" 3479 3480 #: kdecore/kcalendarsystemcoptic.cpp:375 3481 #, kde-format 3482 msgctxt "Coptic weekday 6 - KLocale::LongName" 3483 msgid "Psabbaton" 3484 msgstr "" 3485 3486 #: kdecore/kcalendarsystemcoptic.cpp:377 3487 #, kde-format 3488 msgctxt "Coptic weekday 7 - KLocale::LongName" 3489 msgid "Tkyriakē" 3490 msgstr "" 3491 3492 #: kdecore/kcalendarsystemethiopian.cpp:50 3493 #, kde-format 3494 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3495 msgid "Amata Mehrat" 3496 msgstr "" 3497 3498 #: kdecore/kcalendarsystemethiopian.cpp:51 3499 #, fuzzy, kde-format 3500 #| msgctxt "Before Noon KLocale::ShortName" 3501 #| msgid "AM" 3502 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3503 msgid "AM" 3504 msgstr "ТК" 3505 3506 #: kdecore/kcalendarsystemethiopian.cpp:52 3507 #, kde-format 3508 msgctxt "" 3509 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3510 msgid "%Ey %EC" 3511 msgstr "" 3512 3513 #: kdecore/kcalendarsystemethiopian.cpp:66 3514 #, fuzzy, kde-format 3515 #| msgctxt "Before Noon KLocale::ShortName" 3516 #| msgid "AM" 3517 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3518 msgid "M" 3519 msgstr "ТК" 3520 3521 #: kdecore/kcalendarsystemethiopian.cpp:68 3522 #, kde-format 3523 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3524 msgid "T" 3525 msgstr "" 3526 3527 #: kdecore/kcalendarsystemethiopian.cpp:70 3528 #, kde-format 3529 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3530 msgid "H" 3531 msgstr "" 3532 3533 #: kdecore/kcalendarsystemethiopian.cpp:72 3534 #, kde-format 3535 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3536 msgid "T" 3537 msgstr "" 3538 3539 #: kdecore/kcalendarsystemethiopian.cpp:74 3540 #, kde-format 3541 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3542 msgid "T" 3543 msgstr "" 3544 3545 #: kdecore/kcalendarsystemethiopian.cpp:76 3546 #, kde-format 3547 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3548 msgid "Y" 3549 msgstr "" 3550 3551 #: kdecore/kcalendarsystemethiopian.cpp:78 3552 #, fuzzy, kde-format 3553 #| msgctxt "Before Noon KLocale::ShortName" 3554 #| msgid "AM" 3555 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3556 msgid "M" 3557 msgstr "ТК" 3558 3559 #: kdecore/kcalendarsystemethiopian.cpp:80 3560 #, fuzzy, kde-format 3561 #| msgctxt "Before Noon KLocale::ShortName" 3562 #| msgid "AM" 3563 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3564 msgid "M" 3565 msgstr "ТК" 3566 3567 #: kdecore/kcalendarsystemethiopian.cpp:82 3568 #, kde-format 3569 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3570 msgid "G" 3571 msgstr "" 3572 3573 #: kdecore/kcalendarsystemethiopian.cpp:84 3574 #, kde-format 3575 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3576 msgid "S" 3577 msgstr "" 3578 3579 #: kdecore/kcalendarsystemethiopian.cpp:86 3580 #, kde-format 3581 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3582 msgid "H" 3583 msgstr "" 3584 3585 #: kdecore/kcalendarsystemethiopian.cpp:88 3586 #, fuzzy, kde-format 3587 #| msgid "No" 3588 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3589 msgid "N" 3590 msgstr "Юк" 3591 3592 #: kdecore/kcalendarsystemethiopian.cpp:90 3593 #, fuzzy, kde-format 3594 #| msgctxt "After Noon KLocale::NarrowName" 3595 #| msgid "P" 3596 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3597 msgid "P" 3598 msgstr "С" 3599 3600 #: kdecore/kcalendarsystemethiopian.cpp:99 3601 #, kde-format 3602 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3603 msgid "of Mes" 3604 msgstr "" 3605 3606 #: kdecore/kcalendarsystemethiopian.cpp:101 3607 #, kde-format 3608 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3609 msgid "of Teq" 3610 msgstr "" 3611 3612 #: kdecore/kcalendarsystemethiopian.cpp:103 3613 #, kde-format 3614 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3615 msgid "of Hed" 3616 msgstr "" 3617 3618 #: kdecore/kcalendarsystemethiopian.cpp:105 3619 #, kde-format 3620 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3621 msgid "of Tah" 3622 msgstr "" 3623 3624 #: kdecore/kcalendarsystemethiopian.cpp:107 3625 #, kde-format 3626 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3627 msgid "of Ter" 3628 msgstr "" 3629 3630 #: kdecore/kcalendarsystemethiopian.cpp:109 3631 #, kde-format 3632 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3633 msgid "of Yak" 3634 msgstr "" 3635 3636 #: kdecore/kcalendarsystemethiopian.cpp:111 3637 #, kde-format 3638 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3639 msgid "of Mag" 3640 msgstr "" 3641 3642 #: kdecore/kcalendarsystemethiopian.cpp:113 3643 #, kde-format 3644 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3645 msgid "of Miy" 3646 msgstr "" 3647 3648 #: kdecore/kcalendarsystemethiopian.cpp:115 3649 #, kde-format 3650 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3651 msgid "of Gen" 3652 msgstr "" 3653 3654 #: kdecore/kcalendarsystemethiopian.cpp:117 3655 #, kde-format 3656 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3657 msgid "of Sen" 3658 msgstr "" 3659 3660 #: kdecore/kcalendarsystemethiopian.cpp:119 3661 #, kde-format 3662 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3663 msgid "of Ham" 3664 msgstr "" 3665 3666 #: kdecore/kcalendarsystemethiopian.cpp:121 3667 #, kde-format 3668 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3669 msgid "of Neh" 3670 msgstr "" 3671 3672 #: kdecore/kcalendarsystemethiopian.cpp:123 3673 #, fuzzy, kde-format 3674 #| msgctxt "@action" 3675 #| msgid "Goto Page" 3676 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3677 msgid "of Pag" 3678 msgstr "Биткә күчергә" 3679 3680 #: kdecore/kcalendarsystemethiopian.cpp:132 3681 #, fuzzy, kde-format 3682 #| msgid "Yes" 3683 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3684 msgid "Mes" 3685 msgstr "Әйе" 3686 3687 #: kdecore/kcalendarsystemethiopian.cpp:134 3688 #, kde-format 3689 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3690 msgid "Teq" 3691 msgstr "" 3692 3693 #: kdecore/kcalendarsystemethiopian.cpp:136 3694 #, kde-format 3695 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3696 msgid "Hed" 3697 msgstr "" 3698 3699 #: kdecore/kcalendarsystemethiopian.cpp:138 3700 #, fuzzy, kde-format 3701 #| msgctxt "keyboard-key-name" 3702 #| msgid "Tab" 3703 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3704 msgid "Tah" 3705 msgstr "Tab" 3706 3707 #: kdecore/kcalendarsystemethiopian.cpp:140 3708 #, kde-format 3709 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3710 msgid "Ter" 3711 msgstr "" 3712 3713 #: kdecore/kcalendarsystemethiopian.cpp:142 3714 #, kde-format 3715 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3716 msgid "Yak" 3717 msgstr "" 3718 3719 #: kdecore/kcalendarsystemethiopian.cpp:144 3720 #, kde-format 3721 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3722 msgid "Mag" 3723 msgstr "" 3724 3725 #: kdecore/kcalendarsystemethiopian.cpp:146 3726 #, kde-format 3727 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3728 msgid "Miy" 3729 msgstr "" 3730 3731 #: kdecore/kcalendarsystemethiopian.cpp:148 3732 #, fuzzy, kde-format 3733 #| msgid "Green:" 3734 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3735 msgid "Gen" 3736 msgstr "Количество зелёного:" 3737 3738 #: kdecore/kcalendarsystemethiopian.cpp:150 3739 #, fuzzy, kde-format 3740 #| msgid "&Send" 3741 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3742 msgid "Sen" 3743 msgstr "&Тапшыру" 3744 3745 #: kdecore/kcalendarsystemethiopian.cpp:152 3746 #, fuzzy, kde-format 3747 #| msgid "am" 3748 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3749 msgid "Ham" 3750 msgstr "am" 3751 3752 #: kdecore/kcalendarsystemethiopian.cpp:154 3753 #, fuzzy, kde-format 3754 #| msgctxt "@action" 3755 #| msgid "New" 3756 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3757 msgid "Neh" 3758 msgstr "Яңа" 3759 3760 #: kdecore/kcalendarsystemethiopian.cpp:156 3761 #, fuzzy, kde-format 3762 #| msgid "Pages" 3763 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3764 msgid "Pag" 3765 msgstr "Битләр" 3766 3767 #: kdecore/kcalendarsystemethiopian.cpp:165 3768 #, kde-format 3769 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3770 msgid "of Meskerem" 3771 msgstr "" 3772 3773 #: kdecore/kcalendarsystemethiopian.cpp:167 3774 #, kde-format 3775 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3776 msgid "of Tequemt" 3777 msgstr "" 3778 3779 #: kdecore/kcalendarsystemethiopian.cpp:169 3780 #, kde-format 3781 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3782 msgid "of Hedar" 3783 msgstr "" 3784 3785 #: kdecore/kcalendarsystemethiopian.cpp:171 3786 #, kde-format 3787 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3788 msgid "of Tahsas" 3789 msgstr "" 3790 3791 #: kdecore/kcalendarsystemethiopian.cpp:173 3792 #, kde-format 3793 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3794 msgid "of Ter" 3795 msgstr "" 3796 3797 #: kdecore/kcalendarsystemethiopian.cpp:175 3798 #, kde-format 3799 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3800 msgid "of Yakatit" 3801 msgstr "" 3802 3803 #: kdecore/kcalendarsystemethiopian.cpp:177 3804 #, kde-format 3805 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3806 msgid "of Magabit" 3807 msgstr "" 3808 3809 #: kdecore/kcalendarsystemethiopian.cpp:179 3810 #, kde-format 3811 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3812 msgid "of Miyazya" 3813 msgstr "" 3814 3815 #: kdecore/kcalendarsystemethiopian.cpp:181 3816 #, kde-format 3817 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3818 msgid "of Genbot" 3819 msgstr "" 3820 3821 #: kdecore/kcalendarsystemethiopian.cpp:183 3822 #, kde-format 3823 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3824 msgid "of Sene" 3825 msgstr "" 3826 3827 #: kdecore/kcalendarsystemethiopian.cpp:185 3828 #, kde-format 3829 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3830 msgid "of Hamle" 3831 msgstr "" 3832 3833 #: kdecore/kcalendarsystemethiopian.cpp:187 3834 #, kde-format 3835 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3836 msgid "of Nehase" 3837 msgstr "" 3838 3839 #: kdecore/kcalendarsystemethiopian.cpp:189 3840 #, fuzzy, kde-format 3841 #| msgctxt "@action" 3842 #| msgid "Goto Page" 3843 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3844 msgid "of Pagumen" 3845 msgstr "Биткә күчергә" 3846 3847 #: kdecore/kcalendarsystemethiopian.cpp:198 3848 #, kde-format 3849 msgctxt "Ethiopian month 1 - KLocale::LongName" 3850 msgid "Meskerem" 3851 msgstr "" 3852 3853 #: kdecore/kcalendarsystemethiopian.cpp:200 3854 #, kde-format 3855 msgctxt "Ethiopian month 2 - KLocale::LongName" 3856 msgid "Tequemt" 3857 msgstr "" 3858 3859 #: kdecore/kcalendarsystemethiopian.cpp:202 3860 #, kde-format 3861 msgctxt "Ethiopian month 3 - KLocale::LongName" 3862 msgid "Hedar" 3863 msgstr "" 3864 3865 #: kdecore/kcalendarsystemethiopian.cpp:204 3866 #, kde-format 3867 msgctxt "Ethiopian month 4 - KLocale::LongName" 3868 msgid "Tahsas" 3869 msgstr "" 3870 3871 #: kdecore/kcalendarsystemethiopian.cpp:206 3872 #, kde-format 3873 msgctxt "Ethiopian month 5 - KLocale::LongName" 3874 msgid "Ter" 3875 msgstr "" 3876 3877 #: kdecore/kcalendarsystemethiopian.cpp:208 3878 #, kde-format 3879 msgctxt "Ethiopian month 6 - KLocale::LongName" 3880 msgid "Yakatit" 3881 msgstr "" 3882 3883 #: kdecore/kcalendarsystemethiopian.cpp:210 3884 #, kde-format 3885 msgctxt "Ethiopian month 7 - KLocale::LongName" 3886 msgid "Magabit" 3887 msgstr "" 3888 3889 #: kdecore/kcalendarsystemethiopian.cpp:212 3890 #, kde-format 3891 msgctxt "Ethiopian month 8 - KLocale::LongName" 3892 msgid "Miyazya" 3893 msgstr "" 3894 3895 #: kdecore/kcalendarsystemethiopian.cpp:214 3896 #, kde-format 3897 msgctxt "Ethiopian month 9 - KLocale::LongName" 3898 msgid "Genbot" 3899 msgstr "" 3900 3901 #: kdecore/kcalendarsystemethiopian.cpp:216 3902 #, kde-format 3903 msgctxt "Ethiopian month 10 - KLocale::LongName" 3904 msgid "Sene" 3905 msgstr "" 3906 3907 #: kdecore/kcalendarsystemethiopian.cpp:218 3908 #, kde-format 3909 msgctxt "Ethiopian month 11 - KLocale::LongName" 3910 msgid "Hamle" 3911 msgstr "" 3912 3913 #: kdecore/kcalendarsystemethiopian.cpp:220 3914 #, kde-format 3915 msgctxt "Ethiopian month 12 - KLocale::LongName" 3916 msgid "Nehase" 3917 msgstr "" 3918 3919 #: kdecore/kcalendarsystemethiopian.cpp:222 3920 #, kde-format 3921 msgctxt "Ethiopian month 13 - KLocale::LongName" 3922 msgid "Pagumen" 3923 msgstr "" 3924 3925 #: kdecore/kcalendarsystemethiopian.cpp:236 3926 #, kde-format 3927 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3928 msgid "S" 3929 msgstr "" 3930 3931 #: kdecore/kcalendarsystemethiopian.cpp:238 3932 #, fuzzy, kde-format 3933 #| msgctxt "Before Noon KLocale::ShortName" 3934 #| msgid "AM" 3935 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3936 msgid "M" 3937 msgstr "ТК" 3938 3939 #: kdecore/kcalendarsystemethiopian.cpp:240 3940 #, kde-format 3941 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3942 msgid "R" 3943 msgstr "" 3944 3945 #: kdecore/kcalendarsystemethiopian.cpp:242 3946 #, kde-format 3947 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3948 msgid "H" 3949 msgstr "" 3950 3951 #: kdecore/kcalendarsystemethiopian.cpp:244 3952 #, fuzzy, kde-format 3953 #| msgctxt "Before Noon KLocale::NarrowName" 3954 #| msgid "A" 3955 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3956 msgid "A" 3957 msgstr "К" 3958 3959 #: kdecore/kcalendarsystemethiopian.cpp:246 3960 #, fuzzy, kde-format 3961 #| msgid "Qt" 3962 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3963 msgid "Q" 3964 msgstr "Qt" 3965 3966 #: kdecore/kcalendarsystemethiopian.cpp:248 3967 #, kde-format 3968 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3969 msgid "E" 3970 msgstr "" 3971 3972 #: kdecore/kcalendarsystemethiopian.cpp:257 3973 #, kde-format 3974 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3975 msgid "Seg" 3976 msgstr "" 3977 3978 #: kdecore/kcalendarsystemethiopian.cpp:259 3979 #, kde-format 3980 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3981 msgid "Mak" 3982 msgstr "" 3983 3984 #: kdecore/kcalendarsystemethiopian.cpp:261 3985 #, fuzzy, kde-format 3986 #| msgid "Job" 3987 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3988 msgid "Rob" 3989 msgstr "Эш" 3990 3991 #: kdecore/kcalendarsystemethiopian.cpp:263 3992 #, fuzzy, kde-format 3993 #| msgid "am" 3994 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3995 msgid "Ham" 3996 msgstr "am" 3997 3998 #: kdecore/kcalendarsystemethiopian.cpp:265 3999 #, fuzzy, kde-format 4000 #| msgctxt "@item Text character set" 4001 #| msgid "Arabic" 4002 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 4003 msgid "Arb" 4004 msgstr "Гарәп" 4005 4006 #: kdecore/kcalendarsystemethiopian.cpp:267 4007 #, kde-format 4008 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 4009 msgid "Qed" 4010 msgstr "" 4011 4012 #: kdecore/kcalendarsystemethiopian.cpp:269 4013 #, kde-format 4014 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 4015 msgid "Ehu" 4016 msgstr "" 4017 4018 #: kdecore/kcalendarsystemethiopian.cpp:276 4019 #, kde-format 4020 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 4021 msgid "Segno" 4022 msgstr "" 4023 4024 #: kdecore/kcalendarsystemethiopian.cpp:278 4025 #, kde-format 4026 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 4027 msgid "Maksegno" 4028 msgstr "" 4029 4030 #: kdecore/kcalendarsystemethiopian.cpp:280 4031 #, fuzzy, kde-format 4032 #| msgid "Job" 4033 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 4034 msgid "Rob" 4035 msgstr "Эш" 4036 4037 #: kdecore/kcalendarsystemethiopian.cpp:282 4038 #, kde-format 4039 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 4040 msgid "Hamus" 4041 msgstr "" 4042 4043 #: kdecore/kcalendarsystemethiopian.cpp:284 4044 #, fuzzy, kde-format 4045 #| msgctxt "@item Text character set" 4046 #| msgid "Arabic" 4047 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 4048 msgid "Arb" 4049 msgstr "Гарәп" 4050 4051 #: kdecore/kcalendarsystemethiopian.cpp:286 4052 #, kde-format 4053 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 4054 msgid "Qedame" 4055 msgstr "" 4056 4057 #: kdecore/kcalendarsystemethiopian.cpp:288 4058 #, kde-format 4059 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 4060 msgid "Ehud" 4061 msgstr "" 4062 4063 #: kdecore/kcalendarsystemgregorian.cpp:53 4064 #, kde-format 4065 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 4066 msgid "Before Common Era" 4067 msgstr "" 4068 4069 #: kdecore/kcalendarsystemgregorian.cpp:54 4070 #, fuzzy, kde-format 4071 #| msgctxt "@item:inmenu uppercase abc lists" 4072 #| msgid "ABC" 4073 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 4074 msgid "BCE" 4075 msgstr "ABC" 4076 4077 #: kdecore/kcalendarsystemgregorian.cpp:56 4078 #, fuzzy, kde-format 4079 #| msgid "Before" 4080 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 4081 msgid "Before Christ" 4082 msgstr "Моңа кадәр" 4083 4084 #: kdecore/kcalendarsystemgregorian.cpp:57 4085 #, fuzzy, kde-format 4086 #| msgctxt "@item:inmenu uppercase abc lists" 4087 #| msgid "ABC" 4088 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 4089 msgid "BC" 4090 msgstr "ABC" 4091 4092 #: kdecore/kcalendarsystemgregorian.cpp:59 4093 #, kde-format 4094 msgctxt "" 4095 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 4096 msgid "%Ey %EC" 4097 msgstr "" 4098 4099 #: kdecore/kcalendarsystemgregorian.cpp:63 4100 #, fuzzy, kde-format 4101 #| msgid "Comment on entry" 4102 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 4103 msgid "Common Era" 4104 msgstr "Фикер" 4105 4106 #: kdecore/kcalendarsystemgregorian.cpp:64 4107 #, kde-format 4108 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 4109 msgid "CE" 4110 msgstr "" 4111 4112 #: kdecore/kcalendarsystemgregorian.cpp:66 4113 #: kdecore/kcalendarsystemjapanese.cpp:57 4114 #, kde-format 4115 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 4116 msgid "Anno Domini" 4117 msgstr "" 4118 4119 #: kdecore/kcalendarsystemgregorian.cpp:67 4120 #: kdecore/kcalendarsystemjapanese.cpp:58 4121 #, fuzzy, kde-format 4122 #| msgctxt "Before Noon KLocale::NarrowName" 4123 #| msgid "A" 4124 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 4125 msgid "AD" 4126 msgstr "К" 4127 4128 #: kdecore/kcalendarsystemgregorian.cpp:69 4129 #: kdecore/kcalendarsystemjapanese.cpp:59 4130 #, kde-format 4131 msgctxt "" 4132 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 4133 msgid "%Ey %EC" 4134 msgstr "" 4135 4136 #: kdecore/kcalendarsystemgregorian.cpp:138 4137 #, kde-format 4138 msgctxt "Gregorian month 1 - KLocale::NarrowName" 4139 msgid "J" 4140 msgstr "" 4141 4142 #: kdecore/kcalendarsystemgregorian.cpp:140 4143 #, kde-format 4144 msgctxt "Gregorian month 2 - KLocale::NarrowName" 4145 msgid "F" 4146 msgstr "" 4147 4148 #: kdecore/kcalendarsystemgregorian.cpp:142 4149 #, fuzzy, kde-format 4150 #| msgctxt "Before Noon KLocale::ShortName" 4151 #| msgid "AM" 4152 msgctxt "Gregorian month 3 - KLocale::NarrowName" 4153 msgid "M" 4154 msgstr "ТК" 4155 4156 #: kdecore/kcalendarsystemgregorian.cpp:144 4157 #, fuzzy, kde-format 4158 #| msgctxt "Before Noon KLocale::NarrowName" 4159 #| msgid "A" 4160 msgctxt "Gregorian month 4 - KLocale::NarrowName" 4161 msgid "A" 4162 msgstr "К" 4163 4164 #: kdecore/kcalendarsystemgregorian.cpp:146 4165 #, fuzzy, kde-format 4166 #| msgctxt "Before Noon KLocale::ShortName" 4167 #| msgid "AM" 4168 msgctxt "Gregorian month 5 - KLocale::NarrowName" 4169 msgid "M" 4170 msgstr "ТК" 4171 4172 #: kdecore/kcalendarsystemgregorian.cpp:148 4173 #, kde-format 4174 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4175 msgid "J" 4176 msgstr "" 4177 4178 #: kdecore/kcalendarsystemgregorian.cpp:150 4179 #, kde-format 4180 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4181 msgid "J" 4182 msgstr "" 4183 4184 #: kdecore/kcalendarsystemgregorian.cpp:152 4185 #, fuzzy, kde-format 4186 #| msgctxt "Before Noon KLocale::NarrowName" 4187 #| msgid "A" 4188 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4189 msgid "A" 4190 msgstr "К" 4191 4192 #: kdecore/kcalendarsystemgregorian.cpp:154 4193 #, kde-format 4194 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4195 msgid "S" 4196 msgstr "" 4197 4198 #: kdecore/kcalendarsystemgregorian.cpp:156 4199 #, kde-format 4200 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4201 msgid "O" 4202 msgstr "" 4203 4204 #: kdecore/kcalendarsystemgregorian.cpp:158 4205 #, fuzzy, kde-format 4206 #| msgid "No" 4207 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4208 msgid "N" 4209 msgstr "Юк" 4210 4211 #: kdecore/kcalendarsystemgregorian.cpp:160 4212 #, kde-format 4213 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4214 msgid "D" 4215 msgstr "" 4216 4217 #: kdecore/kcalendarsystemgregorian.cpp:169 4218 #, kde-format 4219 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4220 msgid "of Jan" 4221 msgstr "" 4222 4223 #: kdecore/kcalendarsystemgregorian.cpp:171 4224 #, kde-format 4225 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4226 msgid "of Feb" 4227 msgstr "" 4228 4229 #: kdecore/kcalendarsystemgregorian.cpp:173 4230 #, kde-format 4231 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4232 msgid "of Mar" 4233 msgstr "" 4234 4235 #: kdecore/kcalendarsystemgregorian.cpp:175 4236 #, kde-format 4237 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4238 msgid "of Apr" 4239 msgstr "" 4240 4241 #: kdecore/kcalendarsystemgregorian.cpp:177 4242 #, kde-format 4243 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4244 msgid "of May" 4245 msgstr "" 4246 4247 #: kdecore/kcalendarsystemgregorian.cpp:179 4248 #, kde-format 4249 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4250 msgid "of Jun" 4251 msgstr "" 4252 4253 #: kdecore/kcalendarsystemgregorian.cpp:181 4254 #, kde-format 4255 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4256 msgid "of Jul" 4257 msgstr "" 4258 4259 #: kdecore/kcalendarsystemgregorian.cpp:183 4260 #, kde-format 4261 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4262 msgid "of Aug" 4263 msgstr "" 4264 4265 #: kdecore/kcalendarsystemgregorian.cpp:185 4266 #, kde-format 4267 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4268 msgid "of Sep" 4269 msgstr "" 4270 4271 #: kdecore/kcalendarsystemgregorian.cpp:187 4272 #, kde-format 4273 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4274 msgid "of Oct" 4275 msgstr "" 4276 4277 #: kdecore/kcalendarsystemgregorian.cpp:189 4278 #, kde-format 4279 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4280 msgid "of Nov" 4281 msgstr "" 4282 4283 #: kdecore/kcalendarsystemgregorian.cpp:191 4284 #, kde-format 4285 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4286 msgid "of Dec" 4287 msgstr "" 4288 4289 #: kdecore/kcalendarsystemgregorian.cpp:200 4290 #, fuzzy, kde-format 4291 #| msgctxt "" 4292 #| "Boolean AND keyword in desktop search strings. You can add several " 4293 #| "variants separated by spaces, e.g. retain the English one alongside the " 4294 #| "translation; keywords are not case sensitive. Make sure there is no " 4295 #| "conflict with the OR keyword." 4296 #| msgid "and" 4297 msgctxt "Gregorian month 1 - KLocale::ShortName" 4298 msgid "Jan" 4299 msgstr "и" 4300 4301 #: kdecore/kcalendarsystemgregorian.cpp:202 4302 #, kde-format 4303 msgctxt "Gregorian month 2 - KLocale::ShortName" 4304 msgid "Feb" 4305 msgstr "" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:204 4308 #, kde-format 4309 msgctxt "Gregorian month 3 - KLocale::ShortName" 4310 msgid "Mar" 4311 msgstr "" 4312 4313 #: kdecore/kcalendarsystemgregorian.cpp:206 4314 #, kde-format 4315 msgctxt "Gregorian month 4 - KLocale::ShortName" 4316 msgid "Apr" 4317 msgstr "" 4318 4319 #: kdecore/kcalendarsystemgregorian.cpp:208 4320 #, kde-format 4321 msgctxt "Gregorian month 5 - KLocale::ShortName" 4322 msgid "May" 4323 msgstr "" 4324 4325 #: kdecore/kcalendarsystemgregorian.cpp:210 4326 #, fuzzy, kde-format 4327 #| msgid "Run" 4328 msgctxt "Gregorian month 6 - KLocale::ShortName" 4329 msgid "Jun" 4330 msgstr "Җибәрү" 4331 4332 #: kdecore/kcalendarsystemgregorian.cpp:212 4333 #, kde-format 4334 msgctxt "Gregorian month 7 - KLocale::ShortName" 4335 msgid "Jul" 4336 msgstr "" 4337 4338 #: kdecore/kcalendarsystemgregorian.cpp:214 4339 #, kde-format 4340 msgctxt "Gregorian month 8 - KLocale::ShortName" 4341 msgid "Aug" 4342 msgstr "" 4343 4344 #: kdecore/kcalendarsystemgregorian.cpp:216 4345 #, fuzzy, kde-format 4346 #| msgid "Step" 4347 msgctxt "Gregorian month 9 - KLocale::ShortName" 4348 msgid "Sep" 4349 msgstr "Чик" 4350 4351 #: kdecore/kcalendarsystemgregorian.cpp:218 4352 #, kde-format 4353 msgctxt "Gregorian month 10 - KLocale::ShortName" 4354 msgid "Oct" 4355 msgstr "" 4356 4357 #: kdecore/kcalendarsystemgregorian.cpp:220 4358 #, fuzzy, kde-format 4359 #| msgid "No" 4360 msgctxt "Gregorian month 11 - KLocale::ShortName" 4361 msgid "Nov" 4362 msgstr "Юк" 4363 4364 #: kdecore/kcalendarsystemgregorian.cpp:222 4365 #, fuzzy, kde-format 4366 #| msgid "Detach" 4367 msgctxt "Gregorian month 12 - KLocale::ShortName" 4368 msgid "Dec" 4369 msgstr "Аеру" 4370 4371 #: kdecore/kcalendarsystemgregorian.cpp:231 4372 #, kde-format 4373 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4374 msgid "of January" 4375 msgstr "" 4376 4377 #: kdecore/kcalendarsystemgregorian.cpp:233 4378 #, kde-format 4379 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4380 msgid "of February" 4381 msgstr "" 4382 4383 #: kdecore/kcalendarsystemgregorian.cpp:235 4384 #, kde-format 4385 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4386 msgid "of March" 4387 msgstr "" 4388 4389 #: kdecore/kcalendarsystemgregorian.cpp:237 4390 #, kde-format 4391 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4392 msgid "of April" 4393 msgstr "" 4394 4395 #: kdecore/kcalendarsystemgregorian.cpp:239 4396 #, kde-format 4397 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4398 msgid "of May" 4399 msgstr "" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:241 4402 #, kde-format 4403 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4404 msgid "of June" 4405 msgstr "" 4406 4407 #: kdecore/kcalendarsystemgregorian.cpp:243 4408 #, kde-format 4409 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4410 msgid "of July" 4411 msgstr "" 4412 4413 #: kdecore/kcalendarsystemgregorian.cpp:245 4414 #, kde-format 4415 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4416 msgid "of August" 4417 msgstr "" 4418 4419 #: kdecore/kcalendarsystemgregorian.cpp:247 4420 #, kde-format 4421 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4422 msgid "of September" 4423 msgstr "" 4424 4425 #: kdecore/kcalendarsystemgregorian.cpp:249 4426 #, kde-format 4427 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4428 msgid "of October" 4429 msgstr "" 4430 4431 #: kdecore/kcalendarsystemgregorian.cpp:251 4432 #, kde-format 4433 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4434 msgid "of November" 4435 msgstr "" 4436 4437 #: kdecore/kcalendarsystemgregorian.cpp:253 4438 #, kde-format 4439 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4440 msgid "of December" 4441 msgstr "" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:262 4444 #, fuzzy, kde-format 4445 #| msgctxt "@item:inmenu Text Completion" 4446 #| msgid "Manual" 4447 msgctxt "Gregorian month 1 - KLocale::LongName" 4448 msgid "January" 4449 msgstr "Кулдан" 4450 4451 #: kdecore/kcalendarsystemgregorian.cpp:264 4452 #, kde-format 4453 msgctxt "Gregorian month 2 - KLocale::LongName" 4454 msgid "February" 4455 msgstr "" 4456 4457 #: kdecore/kcalendarsystemgregorian.cpp:266 4458 #, fuzzy, kde-format 4459 #| msgid "Search" 4460 msgctxt "Gregorian month 3 - KLocale::LongName" 4461 msgid "March" 4462 msgstr "Поиск" 4463 4464 #: kdecore/kcalendarsystemgregorian.cpp:268 4465 #, kde-format 4466 msgctxt "Gregorian month 4 - KLocale::LongName" 4467 msgid "April" 4468 msgstr "" 4469 4470 #: kdecore/kcalendarsystemgregorian.cpp:270 4471 #, kde-format 4472 msgctxt "Gregorian month 5 - KLocale::LongName" 4473 msgid "May" 4474 msgstr "" 4475 4476 #: kdecore/kcalendarsystemgregorian.cpp:272 4477 #, kde-format 4478 msgctxt "Gregorian month 6 - KLocale::LongName" 4479 msgid "June" 4480 msgstr "" 4481 4482 #: kdecore/kcalendarsystemgregorian.cpp:274 4483 #, kde-format 4484 msgctxt "Gregorian month 7 - KLocale::LongName" 4485 msgid "July" 4486 msgstr "" 4487 4488 #: kdecore/kcalendarsystemgregorian.cpp:276 4489 #, kde-format 4490 msgctxt "Gregorian month 8 - KLocale::LongName" 4491 msgid "August" 4492 msgstr "" 4493 4494 #: kdecore/kcalendarsystemgregorian.cpp:278 4495 #, kde-format 4496 msgctxt "Gregorian month 9 - KLocale::LongName" 4497 msgid "September" 4498 msgstr "" 4499 4500 #: kdecore/kcalendarsystemgregorian.cpp:280 4501 #, kde-format 4502 msgctxt "Gregorian month 10 - KLocale::LongName" 4503 msgid "October" 4504 msgstr "" 4505 4506 #: kdecore/kcalendarsystemgregorian.cpp:282 4507 #, kde-format 4508 msgctxt "Gregorian month 11 - KLocale::LongName" 4509 msgid "November" 4510 msgstr "" 4511 4512 #: kdecore/kcalendarsystemgregorian.cpp:284 4513 #, kde-format 4514 msgctxt "Gregorian month 12 - KLocale::LongName" 4515 msgid "December" 4516 msgstr "" 4517 4518 #: kdecore/kcalendarsystemgregorian.cpp:297 4519 #: kdecore/kcalendarsystemhebrew.cpp:807 4520 #, fuzzy, kde-format 4521 #| msgctxt "Before Noon KLocale::ShortName" 4522 #| msgid "AM" 4523 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4524 msgid "M" 4525 msgstr "ТК" 4526 4527 #: kdecore/kcalendarsystemgregorian.cpp:299 4528 #: kdecore/kcalendarsystemhebrew.cpp:809 4529 #, kde-format 4530 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4531 msgid "T" 4532 msgstr "" 4533 4534 #: kdecore/kcalendarsystemgregorian.cpp:301 4535 #: kdecore/kcalendarsystemhebrew.cpp:811 4536 #, kde-format 4537 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4538 msgid "W" 4539 msgstr "" 4540 4541 #: kdecore/kcalendarsystemgregorian.cpp:303 4542 #: kdecore/kcalendarsystemhebrew.cpp:813 4543 #, kde-format 4544 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4545 msgid "T" 4546 msgstr "" 4547 4548 #: kdecore/kcalendarsystemgregorian.cpp:305 4549 #: kdecore/kcalendarsystemhebrew.cpp:815 4550 #, kde-format 4551 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4552 msgid "F" 4553 msgstr "" 4554 4555 #: kdecore/kcalendarsystemgregorian.cpp:307 4556 #: kdecore/kcalendarsystemhebrew.cpp:817 4557 #, kde-format 4558 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4559 msgid "S" 4560 msgstr "" 4561 4562 #: kdecore/kcalendarsystemgregorian.cpp:309 4563 #: kdecore/kcalendarsystemhebrew.cpp:819 4564 #, kde-format 4565 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4566 msgid "S" 4567 msgstr "" 4568 4569 #: kdecore/kcalendarsystemgregorian.cpp:318 4570 #: kdecore/kcalendarsystemhebrew.cpp:828 4571 #, kde-format 4572 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4573 msgid "Mon" 4574 msgstr "" 4575 4576 #: kdecore/kcalendarsystemgregorian.cpp:320 4577 #: kdecore/kcalendarsystemhebrew.cpp:830 4578 #, kde-format 4579 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4580 msgid "Tue" 4581 msgstr "" 4582 4583 #: kdecore/kcalendarsystemgregorian.cpp:322 4584 #: kdecore/kcalendarsystemhebrew.cpp:832 4585 #, kde-format 4586 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4587 msgid "Wed" 4588 msgstr "" 4589 4590 #: kdecore/kcalendarsystemgregorian.cpp:324 4591 #: kdecore/kcalendarsystemhebrew.cpp:834 4592 #, kde-format 4593 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4594 msgid "Thu" 4595 msgstr "" 4596 4597 #: kdecore/kcalendarsystemgregorian.cpp:326 4598 #: kdecore/kcalendarsystemhebrew.cpp:836 4599 #, kde-format 4600 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4601 msgid "Fri" 4602 msgstr "" 4603 4604 #: kdecore/kcalendarsystemgregorian.cpp:328 4605 #: kdecore/kcalendarsystemhebrew.cpp:838 4606 #, fuzzy, kde-format 4607 #| msgid "Start" 4608 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4609 msgid "Sat" 4610 msgstr "Башлау" 4611 4612 #: kdecore/kcalendarsystemgregorian.cpp:330 4613 #: kdecore/kcalendarsystemhebrew.cpp:840 4614 #, fuzzy, kde-format 4615 #| msgid "Run" 4616 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4617 msgid "Sun" 4618 msgstr "Җибәрү" 4619 4620 #: kdecore/kcalendarsystemgregorian.cpp:337 4621 #: kdecore/kcalendarsystemhebrew.cpp:847 4622 #, kde-format 4623 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4624 msgid "Monday" 4625 msgstr "" 4626 4627 #: kdecore/kcalendarsystemgregorian.cpp:339 4628 #: kdecore/kcalendarsystemhebrew.cpp:849 4629 #, kde-format 4630 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4631 msgid "Tuesday" 4632 msgstr "" 4633 4634 #: kdecore/kcalendarsystemgregorian.cpp:341 4635 #: kdecore/kcalendarsystemhebrew.cpp:851 4636 #, kde-format 4637 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4638 msgid "Wednesday" 4639 msgstr "" 4640 4641 #: kdecore/kcalendarsystemgregorian.cpp:343 4642 #: kdecore/kcalendarsystemhebrew.cpp:853 4643 #, kde-format 4644 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4645 msgid "Thursday" 4646 msgstr "" 4647 4648 #: kdecore/kcalendarsystemgregorian.cpp:345 4649 #: kdecore/kcalendarsystemhebrew.cpp:855 4650 #, kde-format 4651 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4652 msgid "Friday" 4653 msgstr "" 4654 4655 #: kdecore/kcalendarsystemgregorian.cpp:347 4656 #: kdecore/kcalendarsystemhebrew.cpp:857 4657 #, fuzzy, kde-format 4658 #| msgid "Saturation:" 4659 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4660 msgid "Saturday" 4661 msgstr "Насыщенность:" 4662 4663 #: kdecore/kcalendarsystemgregorian.cpp:349 4664 #: kdecore/kcalendarsystemhebrew.cpp:859 4665 #, fuzzy, kde-format 4666 #| msgctxt "KCharselect unicode block name" 4667 #| msgid "Sundanese" 4668 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4669 msgid "Sunday" 4670 msgstr "Сунданез" 4671 4672 #: kdecore/kcalendarsystemhebrew.cpp:281 4673 #, kde-format 4674 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4675 msgid "Anno Mundi" 4676 msgstr "" 4677 4678 #: kdecore/kcalendarsystemhebrew.cpp:282 4679 #, fuzzy, kde-format 4680 #| msgctxt "Before Noon KLocale::ShortName" 4681 #| msgid "AM" 4682 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4683 msgid "AM" 4684 msgstr "ТК" 4685 4686 #: kdecore/kcalendarsystemhebrew.cpp:283 4687 #, kde-format 4688 msgctxt "" 4689 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4690 msgid "%Ey %EC" 4691 msgstr "" 4692 4693 #: kdecore/kcalendarsystemhebrew.cpp:625 4694 #, kde-format 4695 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4696 msgid "T" 4697 msgstr "" 4698 4699 #: kdecore/kcalendarsystemhebrew.cpp:627 4700 #, kde-format 4701 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4702 msgid "H" 4703 msgstr "" 4704 4705 #: kdecore/kcalendarsystemhebrew.cpp:629 4706 #, kde-format 4707 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4708 msgid "K" 4709 msgstr "" 4710 4711 #: kdecore/kcalendarsystemhebrew.cpp:631 4712 #, kde-format 4713 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4714 msgid "T" 4715 msgstr "" 4716 4717 #: kdecore/kcalendarsystemhebrew.cpp:633 4718 #, kde-format 4719 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4720 msgid "S" 4721 msgstr "" 4722 4723 #: kdecore/kcalendarsystemhebrew.cpp:635 4724 #, fuzzy, kde-format 4725 #| msgctxt "Before Noon KLocale::NarrowName" 4726 #| msgid "A" 4727 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4728 msgid "A" 4729 msgstr "К" 4730 4731 #: kdecore/kcalendarsystemhebrew.cpp:637 4732 #, fuzzy, kde-format 4733 #| msgid "No" 4734 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4735 msgid "N" 4736 msgstr "Юк" 4737 4738 #: kdecore/kcalendarsystemhebrew.cpp:639 4739 #, kde-format 4740 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4741 msgid "I" 4742 msgstr "" 4743 4744 #: kdecore/kcalendarsystemhebrew.cpp:641 4745 #, kde-format 4746 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4747 msgid "S" 4748 msgstr "" 4749 4750 #: kdecore/kcalendarsystemhebrew.cpp:643 4751 #, kde-format 4752 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4753 msgid "T" 4754 msgstr "" 4755 4756 #: kdecore/kcalendarsystemhebrew.cpp:645 4757 #, fuzzy, kde-format 4758 #| msgctxt "Before Noon KLocale::NarrowName" 4759 #| msgid "A" 4760 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4761 msgid "A" 4762 msgstr "К" 4763 4764 #: kdecore/kcalendarsystemhebrew.cpp:647 4765 #, kde-format 4766 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4767 msgid "E" 4768 msgstr "" 4769 4770 #: kdecore/kcalendarsystemhebrew.cpp:649 4771 #, fuzzy, kde-format 4772 #| msgctxt "Before Noon KLocale::NarrowName" 4773 #| msgid "A" 4774 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4775 msgid "A" 4776 msgstr "К" 4777 4778 #: kdecore/kcalendarsystemhebrew.cpp:651 4779 #, fuzzy, kde-format 4780 #| msgctxt "Before Noon KLocale::NarrowName" 4781 #| msgid "A" 4782 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4783 msgid "A" 4784 msgstr "К" 4785 4786 #: kdecore/kcalendarsystemhebrew.cpp:660 4787 #, kde-format 4788 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4789 msgid "of Tis" 4790 msgstr "" 4791 4792 #: kdecore/kcalendarsystemhebrew.cpp:662 4793 #, kde-format 4794 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4795 msgid "of Hes" 4796 msgstr "" 4797 4798 #: kdecore/kcalendarsystemhebrew.cpp:664 4799 #, kde-format 4800 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4801 msgid "of Kis" 4802 msgstr "" 4803 4804 #: kdecore/kcalendarsystemhebrew.cpp:666 4805 #, kde-format 4806 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4807 msgid "of Tev" 4808 msgstr "" 4809 4810 #: kdecore/kcalendarsystemhebrew.cpp:668 4811 #, kde-format 4812 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4813 msgid "of Shv" 4814 msgstr "" 4815 4816 #: kdecore/kcalendarsystemhebrew.cpp:670 4817 #, kde-format 4818 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4819 msgid "of Ada" 4820 msgstr "" 4821 4822 #: kdecore/kcalendarsystemhebrew.cpp:672 4823 #, kde-format 4824 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4825 msgid "of Nis" 4826 msgstr "" 4827 4828 #: kdecore/kcalendarsystemhebrew.cpp:674 4829 #, kde-format 4830 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4831 msgid "of Iya" 4832 msgstr "" 4833 4834 #: kdecore/kcalendarsystemhebrew.cpp:676 4835 #, kde-format 4836 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4837 msgid "of Siv" 4838 msgstr "" 4839 4840 #: kdecore/kcalendarsystemhebrew.cpp:678 4841 #, kde-format 4842 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4843 msgid "of Tam" 4844 msgstr "" 4845 4846 #: kdecore/kcalendarsystemhebrew.cpp:680 4847 #, kde-format 4848 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4849 msgid "of Av" 4850 msgstr "" 4851 4852 #: kdecore/kcalendarsystemhebrew.cpp:682 4853 #, kde-format 4854 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4855 msgid "of Elu" 4856 msgstr "" 4857 4858 #: kdecore/kcalendarsystemhebrew.cpp:684 4859 #, kde-format 4860 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4861 msgid "of Ad1" 4862 msgstr "" 4863 4864 #: kdecore/kcalendarsystemhebrew.cpp:686 4865 #, kde-format 4866 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4867 msgid "of Ad2" 4868 msgstr "" 4869 4870 #: kdecore/kcalendarsystemhebrew.cpp:695 4871 #, kde-format 4872 msgctxt "Hebrew month 1 - KLocale::ShortName" 4873 msgid "Tis" 4874 msgstr "" 4875 4876 #: kdecore/kcalendarsystemhebrew.cpp:697 4877 #, fuzzy, kde-format 4878 #| msgid "Yes" 4879 msgctxt "Hebrew month 2 - KLocale::ShortName" 4880 msgid "Hes" 4881 msgstr "Әйе" 4882 4883 #: kdecore/kcalendarsystemhebrew.cpp:699 4884 #, kde-format 4885 msgctxt "Hebrew month 3 - KLocale::ShortName" 4886 msgid "Kis" 4887 msgstr "" 4888 4889 #: kdecore/kcalendarsystemhebrew.cpp:701 4890 #, kde-format 4891 msgctxt "Hebrew month 4 - KLocale::ShortName" 4892 msgid "Tev" 4893 msgstr "" 4894 4895 #: kdecore/kcalendarsystemhebrew.cpp:703 4896 #, kde-format 4897 msgctxt "Hebrew month 5 - KLocale::ShortName" 4898 msgid "Shv" 4899 msgstr "" 4900 4901 #: kdecore/kcalendarsystemhebrew.cpp:705 4902 #, fuzzy, kde-format 4903 #| msgid "Add" 4904 msgctxt "Hebrew month 6 - KLocale::ShortName" 4905 msgid "Ada" 4906 msgstr "Өстәү" 4907 4908 #: kdecore/kcalendarsystemhebrew.cpp:707 4909 #, kde-format 4910 msgctxt "Hebrew month 7 - KLocale::ShortName" 4911 msgid "Nis" 4912 msgstr "" 4913 4914 #: kdecore/kcalendarsystemhebrew.cpp:709 4915 #, kde-format 4916 msgctxt "Hebrew month 8 - KLocale::ShortName" 4917 msgid "Iya" 4918 msgstr "" 4919 4920 #: kdecore/kcalendarsystemhebrew.cpp:711 4921 #, kde-format 4922 msgctxt "Hebrew month 9 - KLocale::ShortName" 4923 msgid "Siv" 4924 msgstr "" 4925 4926 #: kdecore/kcalendarsystemhebrew.cpp:713 4927 #, fuzzy, kde-format 4928 #| msgid "am" 4929 msgctxt "Hebrew month 10 - KLocale::ShortName" 4930 msgid "Tam" 4931 msgstr "am" 4932 4933 #: kdecore/kcalendarsystemhebrew.cpp:715 4934 #, fuzzy, kde-format 4935 #| msgctxt "Before Noon KLocale::NarrowName" 4936 #| msgid "A" 4937 msgctxt "Hebrew month 11 - KLocale::ShortName" 4938 msgid "Av" 4939 msgstr "К" 4940 4941 #: kdecore/kcalendarsystemhebrew.cpp:717 4942 #, kde-format 4943 msgctxt "Hebrew month 12 - KLocale::ShortName" 4944 msgid "Elu" 4945 msgstr "" 4946 4947 #: kdecore/kcalendarsystemhebrew.cpp:719 4948 #, fuzzy, kde-format 4949 #| msgid "Add" 4950 msgctxt "Hebrew month 13 - KLocale::ShortName" 4951 msgid "Ad1" 4952 msgstr "Өстәү" 4953 4954 #: kdecore/kcalendarsystemhebrew.cpp:721 4955 #, fuzzy, kde-format 4956 #| msgid "Add" 4957 msgctxt "Hebrew month 14 - KLocale::ShortName" 4958 msgid "Ad2" 4959 msgstr "Өстәү" 4960 4961 #: kdecore/kcalendarsystemhebrew.cpp:730 4962 #, kde-format 4963 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4964 msgid "of Tishrey" 4965 msgstr "" 4966 4967 #: kdecore/kcalendarsystemhebrew.cpp:732 4968 #, kde-format 4969 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4970 msgid "of Heshvan" 4971 msgstr "" 4972 4973 #: kdecore/kcalendarsystemhebrew.cpp:734 4974 #, kde-format 4975 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4976 msgid "of Kislev" 4977 msgstr "" 4978 4979 #: kdecore/kcalendarsystemhebrew.cpp:736 4980 #, kde-format 4981 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4982 msgid "of Tevet" 4983 msgstr "" 4984 4985 #: kdecore/kcalendarsystemhebrew.cpp:738 4986 #, kde-format 4987 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4988 msgid "of Shvat" 4989 msgstr "" 4990 4991 #: kdecore/kcalendarsystemhebrew.cpp:740 4992 #, kde-format 4993 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4994 msgid "of Adar" 4995 msgstr "" 4996 4997 #: kdecore/kcalendarsystemhebrew.cpp:742 4998 #, kde-format 4999 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 5000 msgid "of Nisan" 5001 msgstr "" 5002 5003 #: kdecore/kcalendarsystemhebrew.cpp:744 5004 #, kde-format 5005 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 5006 msgid "of Iyar" 5007 msgstr "" 5008 5009 #: kdecore/kcalendarsystemhebrew.cpp:746 5010 #, kde-format 5011 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 5012 msgid "of Sivan" 5013 msgstr "" 5014 5015 #: kdecore/kcalendarsystemhebrew.cpp:748 5016 #, kde-format 5017 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 5018 msgid "of Tamuz" 5019 msgstr "" 5020 5021 #: kdecore/kcalendarsystemhebrew.cpp:750 5022 #, kde-format 5023 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 5024 msgid "of Av" 5025 msgstr "" 5026 5027 #: kdecore/kcalendarsystemhebrew.cpp:752 5028 #, kde-format 5029 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 5030 msgid "of Elul" 5031 msgstr "" 5032 5033 #: kdecore/kcalendarsystemhebrew.cpp:754 5034 #, kde-format 5035 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 5036 msgid "of Adar I" 5037 msgstr "" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:756 5040 #, kde-format 5041 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 5042 msgid "of Adar II" 5043 msgstr "" 5044 5045 #: kdecore/kcalendarsystemhebrew.cpp:765 5046 #, kde-format 5047 msgctxt "Hebrew month 1 - KLocale::LongName" 5048 msgid "Tishrey" 5049 msgstr "" 5050 5051 #: kdecore/kcalendarsystemhebrew.cpp:767 5052 #, kde-format 5053 msgctxt "Hebrew month 2 - KLocale::LongName" 5054 msgid "Heshvan" 5055 msgstr "" 5056 5057 #: kdecore/kcalendarsystemhebrew.cpp:769 5058 #, kde-format 5059 msgctxt "Hebrew month 3 - KLocale::LongName" 5060 msgid "Kislev" 5061 msgstr "" 5062 5063 #: kdecore/kcalendarsystemhebrew.cpp:771 5064 #, kde-format 5065 msgctxt "Hebrew month 4 - KLocale::LongName" 5066 msgid "Tevet" 5067 msgstr "" 5068 5069 #: kdecore/kcalendarsystemhebrew.cpp:773 5070 #, kde-format 5071 msgctxt "Hebrew month 5 - KLocale::LongName" 5072 msgid "Shvat" 5073 msgstr "" 5074 5075 #: kdecore/kcalendarsystemhebrew.cpp:775 5076 #, kde-format 5077 msgctxt "Hebrew month 6 - KLocale::LongName" 5078 msgid "Adar" 5079 msgstr "" 5080 5081 #: kdecore/kcalendarsystemhebrew.cpp:777 5082 #, kde-format 5083 msgctxt "Hebrew month 7 - KLocale::LongName" 5084 msgid "Nisan" 5085 msgstr "" 5086 5087 #: kdecore/kcalendarsystemhebrew.cpp:779 5088 #, kde-format 5089 msgctxt "Hebrew month 8 - KLocale::LongName" 5090 msgid "Iyar" 5091 msgstr "" 5092 5093 #: kdecore/kcalendarsystemhebrew.cpp:781 5094 #, kde-format 5095 msgctxt "Hebrew month 9 - KLocale::LongName" 5096 msgid "Sivan" 5097 msgstr "" 5098 5099 #: kdecore/kcalendarsystemhebrew.cpp:783 5100 #, kde-format 5101 msgctxt "Hebrew month 10 - KLocale::LongName" 5102 msgid "Tamuz" 5103 msgstr "" 5104 5105 #: kdecore/kcalendarsystemhebrew.cpp:785 5106 #, fuzzy, kde-format 5107 #| msgctxt "Before Noon KLocale::NarrowName" 5108 #| msgid "A" 5109 msgctxt "Hebrew month 11 - KLocale::LongName" 5110 msgid "Av" 5111 msgstr "К" 5112 5113 #: kdecore/kcalendarsystemhebrew.cpp:787 5114 #, kde-format 5115 msgctxt "Hebrew month 12 - KLocale::LongName" 5116 msgid "Elul" 5117 msgstr "" 5118 5119 #: kdecore/kcalendarsystemhebrew.cpp:789 5120 #, kde-format 5121 msgctxt "Hebrew month 13 - KLocale::LongName" 5122 msgid "Adar I" 5123 msgstr "" 5124 5125 #: kdecore/kcalendarsystemhebrew.cpp:791 5126 #, kde-format 5127 msgctxt "Hebrew month 14 - KLocale::LongName" 5128 msgid "Adar II" 5129 msgstr "" 5130 5131 #: kdecore/kcalendarsystemindiannational.cpp:66 5132 #, kde-format 5133 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5134 msgid "Saka Era" 5135 msgstr "" 5136 5137 #: kdecore/kcalendarsystemindiannational.cpp:67 5138 #, kde-format 5139 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5140 msgid "SE" 5141 msgstr "" 5142 5143 #: kdecore/kcalendarsystemindiannational.cpp:68 5144 #, kde-format 5145 msgctxt "" 5146 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5147 "2000 SE" 5148 msgid "%Ey %EC" 5149 msgstr "" 5150 5151 #: kdecore/kcalendarsystemindiannational.cpp:158 5152 #, fuzzy, kde-format 5153 #| msgid "AC" 5154 msgctxt "Indian National month 1 - KLocale::NarrowName" 5155 msgid "C" 5156 msgstr "AC" 5157 5158 #: kdecore/kcalendarsystemindiannational.cpp:160 5159 #, kde-format 5160 msgctxt "Indian National month 2 - KLocale::NarrowName" 5161 msgid "V" 5162 msgstr "" 5163 5164 #: kdecore/kcalendarsystemindiannational.cpp:162 5165 #, kde-format 5166 msgctxt "Indian National month 3 - KLocale::NarrowName" 5167 msgid "J" 5168 msgstr "" 5169 5170 #: kdecore/kcalendarsystemindiannational.cpp:164 5171 #, kde-format 5172 msgctxt "Indian National month 4 - KLocale::NarrowName" 5173 msgid "Ā" 5174 msgstr "" 5175 5176 #: kdecore/kcalendarsystemindiannational.cpp:166 5177 #, kde-format 5178 msgctxt "Indian National month 5 - KLocale::NarrowName" 5179 msgid "S" 5180 msgstr "" 5181 5182 #: kdecore/kcalendarsystemindiannational.cpp:168 5183 #, kde-format 5184 msgctxt "Indian National month 6 - KLocale::NarrowName" 5185 msgid "B" 5186 msgstr "" 5187 5188 #: kdecore/kcalendarsystemindiannational.cpp:170 5189 #, kde-format 5190 msgctxt "Indian National month 7 - KLocale::NarrowName" 5191 msgid "Ā" 5192 msgstr "" 5193 5194 #: kdecore/kcalendarsystemindiannational.cpp:172 5195 #, kde-format 5196 msgctxt "Indian National month 8 - KLocale::NarrowName" 5197 msgid "K" 5198 msgstr "" 5199 5200 #: kdecore/kcalendarsystemindiannational.cpp:174 5201 #, fuzzy, kde-format 5202 #| msgctxt "Before Noon KLocale::NarrowName" 5203 #| msgid "A" 5204 msgctxt "Indian National month 9 - KLocale::NarrowName" 5205 msgid "A" 5206 msgstr "К" 5207 5208 #: kdecore/kcalendarsystemindiannational.cpp:176 5209 #, fuzzy, kde-format 5210 #| msgctxt "After Noon KLocale::NarrowName" 5211 #| msgid "P" 5212 msgctxt "Indian National month 10 - KLocale::NarrowName" 5213 msgid "P" 5214 msgstr "С" 5215 5216 #: kdecore/kcalendarsystemindiannational.cpp:178 5217 #, fuzzy, kde-format 5218 #| msgctxt "Before Noon KLocale::ShortName" 5219 #| msgid "AM" 5220 msgctxt "Indian National month 11 - KLocale::NarrowName" 5221 msgid "M" 5222 msgstr "ТК" 5223 5224 #: kdecore/kcalendarsystemindiannational.cpp:180 5225 #, fuzzy, kde-format 5226 #| msgctxt "After Noon KLocale::NarrowName" 5227 #| msgid "P" 5228 msgctxt "Indian National month 12 - KLocale::NarrowName" 5229 msgid "P" 5230 msgstr "С" 5231 5232 #: kdecore/kcalendarsystemindiannational.cpp:189 5233 #, kde-format 5234 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5235 msgid "of Cha" 5236 msgstr "" 5237 5238 #: kdecore/kcalendarsystemindiannational.cpp:191 5239 #, kde-format 5240 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5241 msgid "of Vai" 5242 msgstr "" 5243 5244 #: kdecore/kcalendarsystemindiannational.cpp:193 5245 #, kde-format 5246 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5247 msgid "of Jya" 5248 msgstr "" 5249 5250 #: kdecore/kcalendarsystemindiannational.cpp:195 5251 #, kde-format 5252 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5253 msgid "of Āsh" 5254 msgstr "" 5255 5256 #: kdecore/kcalendarsystemindiannational.cpp:197 5257 #, kde-format 5258 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5259 msgid "of Shr" 5260 msgstr "" 5261 5262 #: kdecore/kcalendarsystemindiannational.cpp:199 5263 #, kde-format 5264 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5265 msgid "of Bhā" 5266 msgstr "" 5267 5268 #: kdecore/kcalendarsystemindiannational.cpp:201 5269 #, kde-format 5270 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5271 msgid "of Āsw" 5272 msgstr "" 5273 5274 #: kdecore/kcalendarsystemindiannational.cpp:203 5275 #, kde-format 5276 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5277 msgid "of Kār" 5278 msgstr "" 5279 5280 #: kdecore/kcalendarsystemindiannational.cpp:205 5281 #, kde-format 5282 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5283 msgid "of Agr" 5284 msgstr "" 5285 5286 #: kdecore/kcalendarsystemindiannational.cpp:207 5287 #, kde-format 5288 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5289 msgid "of Pau" 5290 msgstr "" 5291 5292 #: kdecore/kcalendarsystemindiannational.cpp:209 5293 #, kde-format 5294 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5295 msgid "of Māg" 5296 msgstr "" 5297 5298 #: kdecore/kcalendarsystemindiannational.cpp:211 5299 #, kde-format 5300 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5301 msgid "of Phā" 5302 msgstr "" 5303 5304 #: kdecore/kcalendarsystemindiannational.cpp:220 5305 #, fuzzy, kde-format 5306 #| msgctxt "KCharselect unicode block name" 5307 #| msgid "Cham" 5308 msgctxt "Indian National month 1 - KLocale::ShortName" 5309 msgid "Cha" 5310 msgstr "Чам язмасы" 5311 5312 #: kdecore/kcalendarsystemindiannational.cpp:222 5313 #, fuzzy, kde-format 5314 #| msgctxt "KCharselect unicode block name" 5315 #| msgid "Vai" 5316 msgctxt "Indian National month 2 - KLocale::ShortName" 5317 msgid "Vai" 5318 msgstr "Ваи язмасы" 5319 5320 #: kdecore/kcalendarsystemindiannational.cpp:224 5321 #, kde-format 5322 msgctxt "Indian National month 3 - KLocale::ShortName" 5323 msgid "Jya" 5324 msgstr "" 5325 5326 #: kdecore/kcalendarsystemindiannational.cpp:226 5327 #, kde-format 5328 msgctxt "Indian National month 4 - KLocale::ShortName" 5329 msgid "Āsh" 5330 msgstr "" 5331 5332 #: kdecore/kcalendarsystemindiannational.cpp:228 5333 #, kde-format 5334 msgctxt "Indian National month 5 - KLocale::ShortName" 5335 msgid "Shr" 5336 msgstr "" 5337 5338 #: kdecore/kcalendarsystemindiannational.cpp:230 5339 #, kde-format 5340 msgctxt "Indian National month 6 - KLocale::ShortName" 5341 msgid "Bhā" 5342 msgstr "" 5343 5344 #: kdecore/kcalendarsystemindiannational.cpp:232 5345 #, kde-format 5346 msgctxt "Indian National month 7 - KLocale::ShortName" 5347 msgid "Āsw" 5348 msgstr "" 5349 5350 #: kdecore/kcalendarsystemindiannational.cpp:234 5351 #, kde-format 5352 msgctxt "Indian National month 8 - KLocale::ShortName" 5353 msgid "Kār" 5354 msgstr "" 5355 5356 #: kdecore/kcalendarsystemindiannational.cpp:236 5357 #, kde-format 5358 msgctxt "Indian National month 9 - KLocale::ShortName" 5359 msgid "Agr" 5360 msgstr "" 5361 5362 #: kdecore/kcalendarsystemindiannational.cpp:238 5363 #, fuzzy, kde-format 5364 #| msgid "Pause" 5365 msgctxt "Indian National month 10 - KLocale::ShortName" 5366 msgid "Pau" 5367 msgstr "Тыналыш" 5368 5369 #: kdecore/kcalendarsystemindiannational.cpp:240 5370 #, kde-format 5371 msgctxt "Indian National month 11 - KLocale::ShortName" 5372 msgid "Māg" 5373 msgstr "" 5374 5375 #: kdecore/kcalendarsystemindiannational.cpp:242 5376 #, kde-format 5377 msgctxt "Indian National month 12 - KLocale::ShortName" 5378 msgid "Phā" 5379 msgstr "" 5380 5381 #: kdecore/kcalendarsystemindiannational.cpp:251 5382 #, kde-format 5383 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5384 msgid "of Chaitra" 5385 msgstr "" 5386 5387 #: kdecore/kcalendarsystemindiannational.cpp:253 5388 #, kde-format 5389 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5390 msgid "of Vaishākh" 5391 msgstr "" 5392 5393 #: kdecore/kcalendarsystemindiannational.cpp:255 5394 #, kde-format 5395 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5396 msgid "of Jyaishtha" 5397 msgstr "" 5398 5399 #: kdecore/kcalendarsystemindiannational.cpp:257 5400 #, kde-format 5401 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5402 msgid "of Āshādha" 5403 msgstr "" 5404 5405 #: kdecore/kcalendarsystemindiannational.cpp:259 5406 #, kde-format 5407 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5408 msgid "of Shrāvana" 5409 msgstr "" 5410 5411 #: kdecore/kcalendarsystemindiannational.cpp:261 5412 #, kde-format 5413 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5414 msgid "of Bhādrapad" 5415 msgstr "" 5416 5417 #: kdecore/kcalendarsystemindiannational.cpp:263 5418 #, kde-format 5419 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5420 msgid "of Āshwin" 5421 msgstr "" 5422 5423 #: kdecore/kcalendarsystemindiannational.cpp:265 5424 #, kde-format 5425 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5426 msgid "of Kārtik" 5427 msgstr "" 5428 5429 #: kdecore/kcalendarsystemindiannational.cpp:267 5430 #, kde-format 5431 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5432 msgid "of Agrahayana" 5433 msgstr "" 5434 5435 #: kdecore/kcalendarsystemindiannational.cpp:269 5436 #, fuzzy, kde-format 5437 #| msgid "Pause" 5438 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5439 msgid "of Paush" 5440 msgstr "Тыналыш" 5441 5442 #: kdecore/kcalendarsystemindiannational.cpp:271 5443 #, kde-format 5444 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5445 msgid "of Māgh" 5446 msgstr "" 5447 5448 #: kdecore/kcalendarsystemindiannational.cpp:273 5449 #, kde-format 5450 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5451 msgid "of Phālgun" 5452 msgstr "" 5453 5454 #: kdecore/kcalendarsystemindiannational.cpp:282 5455 #, kde-format 5456 msgctxt "Indian National month 1 - KLocale::LongName" 5457 msgid "Chaitra" 5458 msgstr "" 5459 5460 #: kdecore/kcalendarsystemindiannational.cpp:284 5461 #, kde-format 5462 msgctxt "Indian National month 2 - KLocale::LongName" 5463 msgid "Vaishākh" 5464 msgstr "" 5465 5466 #: kdecore/kcalendarsystemindiannational.cpp:286 5467 #, kde-format 5468 msgctxt "Indian National month 3 - KLocale::LongName" 5469 msgid "Jyaishtha" 5470 msgstr "" 5471 5472 #: kdecore/kcalendarsystemindiannational.cpp:288 5473 #, kde-format 5474 msgctxt "Indian National month 4 - KLocale::LongName" 5475 msgid "Āshādha" 5476 msgstr "" 5477 5478 #: kdecore/kcalendarsystemindiannational.cpp:290 5479 #, kde-format 5480 msgctxt "Indian National month 5 - KLocale::LongName" 5481 msgid "Shrāvana" 5482 msgstr "" 5483 5484 #: kdecore/kcalendarsystemindiannational.cpp:292 5485 #, kde-format 5486 msgctxt "Indian National month 6 - KLocale::LongName" 5487 msgid "Bhādrapad" 5488 msgstr "" 5489 5490 #: kdecore/kcalendarsystemindiannational.cpp:294 5491 #, kde-format 5492 msgctxt "Indian National month 7 - KLocale::LongName" 5493 msgid "Āshwin" 5494 msgstr "" 5495 5496 #: kdecore/kcalendarsystemindiannational.cpp:296 5497 #, kde-format 5498 msgctxt "Indian National month 8 - KLocale::LongName" 5499 msgid "Kārtik" 5500 msgstr "" 5501 5502 #: kdecore/kcalendarsystemindiannational.cpp:298 5503 #, kde-format 5504 msgctxt "Indian National month 9 - KLocale::LongName" 5505 msgid "Agrahayana" 5506 msgstr "" 5507 5508 #: kdecore/kcalendarsystemindiannational.cpp:300 5509 #, fuzzy, kde-format 5510 #| msgid "Pause" 5511 msgctxt "Indian National month 10 - KLocale::LongName" 5512 msgid "Paush" 5513 msgstr "Тыналыш" 5514 5515 #: kdecore/kcalendarsystemindiannational.cpp:302 5516 #, kde-format 5517 msgctxt "Indian National month 11 - KLocale::LongName" 5518 msgid "Māgh" 5519 msgstr "" 5520 5521 #: kdecore/kcalendarsystemindiannational.cpp:304 5522 #, kde-format 5523 msgctxt "Indian National month 12 - KLocale::LongName" 5524 msgid "Phālgun" 5525 msgstr "" 5526 5527 #: kdecore/kcalendarsystemindiannational.cpp:317 5528 #, kde-format 5529 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5530 msgid "S" 5531 msgstr "" 5532 5533 #: kdecore/kcalendarsystemindiannational.cpp:319 5534 #, fuzzy, kde-format 5535 #| msgctxt "Before Noon KLocale::ShortName" 5536 #| msgid "AM" 5537 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5538 msgid "M" 5539 msgstr "ТК" 5540 5541 #: kdecore/kcalendarsystemindiannational.cpp:321 5542 #, kde-format 5543 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5544 msgid "B" 5545 msgstr "" 5546 5547 #: kdecore/kcalendarsystemindiannational.cpp:323 5548 #, kde-format 5549 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5550 msgid "G" 5551 msgstr "" 5552 5553 #: kdecore/kcalendarsystemindiannational.cpp:325 5554 #, kde-format 5555 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5556 msgid "S" 5557 msgstr "" 5558 5559 #: kdecore/kcalendarsystemindiannational.cpp:327 5560 #, kde-format 5561 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5562 msgid "S" 5563 msgstr "" 5564 5565 #: kdecore/kcalendarsystemindiannational.cpp:329 5566 #, kde-format 5567 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5568 msgid "R" 5569 msgstr "" 5570 5571 #: kdecore/kcalendarsystemindiannational.cpp:338 5572 #, kde-format 5573 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5574 msgid "Som" 5575 msgstr "" 5576 5577 #: kdecore/kcalendarsystemindiannational.cpp:340 5578 #, kde-format 5579 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5580 msgid "Mañ" 5581 msgstr "" 5582 5583 #: kdecore/kcalendarsystemindiannational.cpp:342 5584 #, fuzzy, kde-format 5585 #| msgctxt "KCharselect unicode block name" 5586 #| msgid "Buhid" 5587 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5588 msgid "Bud" 5589 msgstr "Бухид" 5590 5591 #: kdecore/kcalendarsystemindiannational.cpp:344 5592 #, kde-format 5593 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5594 msgid "Gur" 5595 msgstr "" 5596 5597 #: kdecore/kcalendarsystemindiannational.cpp:346 5598 #, kde-format 5599 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5600 msgid "Suk" 5601 msgstr "" 5602 5603 #: kdecore/kcalendarsystemindiannational.cpp:348 5604 #, fuzzy, kde-format 5605 #| msgctxt "" 5606 #| "Boolean AND keyword in desktop search strings. You can add several " 5607 #| "variants separated by spaces, e.g. retain the English one alongside the " 5608 #| "translation; keywords are not case sensitive. Make sure there is no " 5609 #| "conflict with the OR keyword." 5610 #| msgid "and" 5611 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5612 msgid "San" 5613 msgstr "и" 5614 5615 #: kdecore/kcalendarsystemindiannational.cpp:350 5616 #, kde-format 5617 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5618 msgid "Rav" 5619 msgstr "" 5620 5621 #: kdecore/kcalendarsystemindiannational.cpp:357 5622 #, kde-format 5623 msgctxt "Indian National weekday 1 - KLocale::LongName" 5624 msgid "Somavãra" 5625 msgstr "" 5626 5627 #: kdecore/kcalendarsystemindiannational.cpp:359 5628 #, kde-format 5629 msgctxt "Indian National weekday 2 - KLocale::LongName" 5630 msgid "Mañgalvã" 5631 msgstr "" 5632 5633 #: kdecore/kcalendarsystemindiannational.cpp:361 5634 #, kde-format 5635 msgctxt "Indian National weekday 3 - KLocale::LongName" 5636 msgid "Budhavãra" 5637 msgstr "" 5638 5639 #: kdecore/kcalendarsystemindiannational.cpp:363 5640 #, kde-format 5641 msgctxt "Indian National weekday 4 - KLocale::LongName" 5642 msgid "Guruvãra" 5643 msgstr "" 5644 5645 #: kdecore/kcalendarsystemindiannational.cpp:365 5646 #, kde-format 5647 msgctxt "Indian National weekday 5 - KLocale::LongName" 5648 msgid "Sukravãra" 5649 msgstr "" 5650 5651 #: kdecore/kcalendarsystemindiannational.cpp:367 5652 #, kde-format 5653 msgctxt "Indian National weekday 6 - KLocale::LongName" 5654 msgid "Sanivãra" 5655 msgstr "" 5656 5657 #: kdecore/kcalendarsystemindiannational.cpp:369 5658 #, kde-format 5659 msgctxt "Indian National weekday 7 - KLocale::LongName" 5660 msgid "Raviãra" 5661 msgstr "" 5662 5663 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5664 #, kde-format 5665 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5666 msgid "Anno Hegirae" 5667 msgstr "" 5668 5669 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5670 #, fuzzy, kde-format 5671 #| msgctxt "Before Noon KLocale::NarrowName" 5672 #| msgid "A" 5673 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5674 msgid "AH" 5675 msgstr "К" 5676 5677 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5678 #, kde-format 5679 msgctxt "" 5680 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5681 msgid "%Ey %EC" 5682 msgstr "" 5683 5684 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5685 #, fuzzy, kde-format 5686 #| msgctxt "Before Noon KLocale::ShortName" 5687 #| msgid "AM" 5688 msgctxt "Hijri month 1 - KLocale::NarrowName" 5689 msgid "M" 5690 msgstr "ТК" 5691 5692 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5693 #, kde-format 5694 msgctxt "Hijri month 2 - KLocale::NarrowName" 5695 msgid "S" 5696 msgstr "" 5697 5698 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5699 #, fuzzy, kde-format 5700 #| msgctxt "Before Noon KLocale::NarrowName" 5701 #| msgid "A" 5702 msgctxt "Hijri month 3 - KLocale::NarrowName" 5703 msgid "A" 5704 msgstr "К" 5705 5706 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5707 #, kde-format 5708 msgctxt "Hijri month 4 - KLocale::NarrowName" 5709 msgid "T" 5710 msgstr "" 5711 5712 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5713 #, fuzzy, kde-format 5714 #| msgctxt "Before Noon KLocale::NarrowName" 5715 #| msgid "A" 5716 msgctxt "Hijri month 5 - KLocale::NarrowName" 5717 msgid "A" 5718 msgstr "К" 5719 5720 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5721 #, kde-format 5722 msgctxt "Hijri month 6 - KLocale::NarrowName" 5723 msgid "T" 5724 msgstr "" 5725 5726 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5727 #, kde-format 5728 msgctxt "Hijri month 7 - KLocale::NarrowName" 5729 msgid "R" 5730 msgstr "" 5731 5732 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5733 #, kde-format 5734 msgctxt "Hijri month 8 - KLocale::NarrowName" 5735 msgid "S" 5736 msgstr "" 5737 5738 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5739 #, kde-format 5740 msgctxt "Hijri month 9 - KLocale::NarrowName" 5741 msgid "R" 5742 msgstr "" 5743 5744 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5745 #, kde-format 5746 msgctxt "Hijri month 10 - KLocale::NarrowName" 5747 msgid "S" 5748 msgstr "" 5749 5750 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5751 #, fuzzy, kde-format 5752 #| msgid "Qt" 5753 msgctxt "Hijri month 11 - KLocale::NarrowName" 5754 msgid "Q" 5755 msgstr "Qt" 5756 5757 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5758 #, kde-format 5759 msgctxt "Hijri month 12 - KLocale::NarrowName" 5760 msgid "H" 5761 msgstr "" 5762 5763 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5764 #, kde-format 5765 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5766 msgid "of Muh" 5767 msgstr "" 5768 5769 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5770 #, kde-format 5771 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5772 msgid "of Saf" 5773 msgstr "" 5774 5775 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5776 #, kde-format 5777 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5778 msgid "of R.A" 5779 msgstr "" 5780 5781 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5782 #, kde-format 5783 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5784 msgid "of R.T" 5785 msgstr "" 5786 5787 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5788 #, kde-format 5789 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5790 msgid "of J.A" 5791 msgstr "" 5792 5793 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5794 #, kde-format 5795 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5796 msgid "of J.T" 5797 msgstr "" 5798 5799 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5800 #, kde-format 5801 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5802 msgid "of Raj" 5803 msgstr "" 5804 5805 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5806 #, kde-format 5807 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5808 msgid "of Sha" 5809 msgstr "" 5810 5811 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5812 #, kde-format 5813 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5814 msgid "of Ram" 5815 msgstr "" 5816 5817 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5818 #, kde-format 5819 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5820 msgid "of Shw" 5821 msgstr "" 5822 5823 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5824 #, kde-format 5825 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5826 msgid "of Qid" 5827 msgstr "" 5828 5829 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5830 #, kde-format 5831 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5832 msgid "of Hij" 5833 msgstr "" 5834 5835 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5836 #, kde-format 5837 msgctxt "Hijri month 1 - KLocale::ShortName" 5838 msgid "Muh" 5839 msgstr "" 5840 5841 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5842 #, kde-format 5843 msgctxt "Hijri month 2 - KLocale::ShortName" 5844 msgid "Saf" 5845 msgstr "" 5846 5847 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5848 #, kde-format 5849 msgctxt "Hijri month 3 - KLocale::ShortName" 5850 msgid "R.A" 5851 msgstr "" 5852 5853 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5854 #, kde-format 5855 msgctxt "Hijri month 4 - KLocale::ShortName" 5856 msgid "R.T" 5857 msgstr "" 5858 5859 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5860 #, kde-format 5861 msgctxt "Hijri month 5 - KLocale::ShortName" 5862 msgid "J.A" 5863 msgstr "" 5864 5865 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5866 #, kde-format 5867 msgctxt "Hijri month 6 - KLocale::ShortName" 5868 msgid "J.T" 5869 msgstr "" 5870 5871 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5872 #, kde-format 5873 msgctxt "Hijri month 7 - KLocale::ShortName" 5874 msgid "Raj" 5875 msgstr "" 5876 5877 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5878 #, kde-format 5879 msgctxt "Hijri month 8 - KLocale::ShortName" 5880 msgid "Sha" 5881 msgstr "" 5882 5883 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5884 #, fuzzy, kde-format 5885 #| msgid "am" 5886 msgctxt "Hijri month 9 - KLocale::ShortName" 5887 msgid "Ram" 5888 msgstr "am" 5889 5890 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5891 #, fuzzy, kde-format 5892 #| msgid "Show %1" 5893 msgctxt "Hijri month 10 - KLocale::ShortName" 5894 msgid "Shw" 5895 msgstr "%1'не чагылдыру" 5896 5897 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5898 #, kde-format 5899 msgctxt "Hijri month 11 - KLocale::ShortName" 5900 msgid "Qid" 5901 msgstr "" 5902 5903 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5904 #, kde-format 5905 msgctxt "Hijri month 12 - KLocale::ShortName" 5906 msgid "Hij" 5907 msgstr "" 5908 5909 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5910 #, kde-format 5911 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5912 msgid "of Muharram" 5913 msgstr "" 5914 5915 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5916 #, kde-format 5917 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5918 msgid "of Safar" 5919 msgstr "" 5920 5921 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5922 #, kde-format 5923 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5924 msgid "of Rabi` al-Awal" 5925 msgstr "" 5926 5927 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5928 #, kde-format 5929 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5930 msgid "of Rabi` al-Thaani" 5931 msgstr "" 5932 5933 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5934 #, kde-format 5935 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5936 msgid "of Jumaada al-Awal" 5937 msgstr "" 5938 5939 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5940 #, kde-format 5941 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5942 msgid "of Jumaada al-Thaani" 5943 msgstr "" 5944 5945 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5946 #, kde-format 5947 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5948 msgid "of Rajab" 5949 msgstr "" 5950 5951 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5952 #, kde-format 5953 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5954 msgid "of Sha`ban" 5955 msgstr "" 5956 5957 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5958 #, kde-format 5959 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5960 msgid "of Ramadan" 5961 msgstr "" 5962 5963 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5964 #, kde-format 5965 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5966 msgid "of Shawwal" 5967 msgstr "" 5968 5969 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5970 #, kde-format 5971 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5972 msgid "of Thu al-Qi`dah" 5973 msgstr "" 5974 5975 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5976 #, kde-format 5977 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5978 msgid "of Thu al-Hijjah" 5979 msgstr "" 5980 5981 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5982 #, kde-format 5983 msgctxt "Hijri month 1 - KLocale::LongName" 5984 msgid "Muharram" 5985 msgstr "" 5986 5987 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5988 #, kde-format 5989 msgctxt "Hijri month 2 - KLocale::LongName" 5990 msgid "Safar" 5991 msgstr "" 5992 5993 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5994 #, kde-format 5995 msgctxt "Hijri month 3 - KLocale::LongName" 5996 msgid "Rabi` al-Awal" 5997 msgstr "" 5998 5999 #: kdecore/kcalendarsystemislamiccivil.cpp:296 6000 #, kde-format 6001 msgctxt "Hijri month 4 - KLocale::LongName" 6002 msgid "Rabi` al-Thaani" 6003 msgstr "" 6004 6005 #: kdecore/kcalendarsystemislamiccivil.cpp:298 6006 #, kde-format 6007 msgctxt "Hijri month 5 - KLocale::LongName" 6008 msgid "Jumaada al-Awal" 6009 msgstr "" 6010 6011 #: kdecore/kcalendarsystemislamiccivil.cpp:300 6012 #, kde-format 6013 msgctxt "Hijri month 6 - KLocale::LongName" 6014 msgid "Jumaada al-Thaani" 6015 msgstr "" 6016 6017 #: kdecore/kcalendarsystemislamiccivil.cpp:302 6018 #, kde-format 6019 msgctxt "Hijri month 7 - KLocale::LongName" 6020 msgid "Rajab" 6021 msgstr "" 6022 6023 #: kdecore/kcalendarsystemislamiccivil.cpp:304 6024 #, kde-format 6025 msgctxt "Hijri month 8 - KLocale::LongName" 6026 msgid "Sha`ban" 6027 msgstr "" 6028 6029 #: kdecore/kcalendarsystemislamiccivil.cpp:306 6030 #, kde-format 6031 msgctxt "Hijri month 9 - KLocale::LongName" 6032 msgid "Ramadan" 6033 msgstr "" 6034 6035 #: kdecore/kcalendarsystemislamiccivil.cpp:308 6036 #, kde-format 6037 msgctxt "Hijri month 10 - KLocale::LongName" 6038 msgid "Shawwal" 6039 msgstr "" 6040 6041 #: kdecore/kcalendarsystemislamiccivil.cpp:310 6042 #, kde-format 6043 msgctxt "Hijri month 11 - KLocale::LongName" 6044 msgid "Thu al-Qi`dah" 6045 msgstr "" 6046 6047 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6048 #, kde-format 6049 msgctxt "Hijri month 12 - KLocale::LongName" 6050 msgid "Thu al-Hijjah" 6051 msgstr "" 6052 6053 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6054 #, kde-format 6055 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6056 msgid "I" 6057 msgstr "" 6058 6059 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6060 #, kde-format 6061 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6062 msgid "T" 6063 msgstr "" 6064 6065 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6066 #, fuzzy, kde-format 6067 #| msgctxt "Before Noon KLocale::NarrowName" 6068 #| msgid "A" 6069 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6070 msgid "A" 6071 msgstr "К" 6072 6073 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6074 #, kde-format 6075 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6076 msgid "K" 6077 msgstr "" 6078 6079 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6080 #, kde-format 6081 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6082 msgid "J" 6083 msgstr "" 6084 6085 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6086 #, kde-format 6087 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6088 msgid "S" 6089 msgstr "" 6090 6091 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6092 #, fuzzy, kde-format 6093 #| msgctxt "Before Noon KLocale::NarrowName" 6094 #| msgid "A" 6095 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6096 msgid "A" 6097 msgstr "К" 6098 6099 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6100 #, kde-format 6101 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6102 msgid "Ith" 6103 msgstr "" 6104 6105 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6106 #, kde-format 6107 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6108 msgid "Thl" 6109 msgstr "" 6110 6111 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6112 #, fuzzy, kde-format 6113 #| msgctxt "@item Text character set" 6114 #| msgid "Arabic" 6115 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6116 msgid "Arb" 6117 msgstr "Гарәп" 6118 6119 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6120 #, kde-format 6121 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6122 msgid "Kha" 6123 msgstr "" 6124 6125 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6126 #, kde-format 6127 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6128 msgid "Jum" 6129 msgstr "" 6130 6131 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6132 #, fuzzy, kde-format 6133 #| msgctxt "keyboard-key-name" 6134 #| msgid "Tab" 6135 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6136 msgid "Sab" 6137 msgstr "Tab" 6138 6139 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6140 #, fuzzy, kde-format 6141 #| msgid "Add" 6142 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6143 msgid "Ahd" 6144 msgstr "Өстәү" 6145 6146 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6147 #, kde-format 6148 msgctxt "Hijri weekday 1 - KLocale::LongName" 6149 msgid "Yaum al-Ithnain" 6150 msgstr "" 6151 6152 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6153 #, kde-format 6154 msgctxt "Hijri weekday 2 - KLocale::LongName" 6155 msgid "Yau al-Thulatha" 6156 msgstr "" 6157 6158 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6159 #, kde-format 6160 msgctxt "Hijri weekday 3 - KLocale::LongName" 6161 msgid "Yaum al-Arbi'a" 6162 msgstr "" 6163 6164 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6165 #, kde-format 6166 msgctxt "Hijri weekday 4 - KLocale::LongName" 6167 msgid "Yaum al-Khamees" 6168 msgstr "" 6169 6170 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6171 #, kde-format 6172 msgctxt "Hijri weekday 5 - KLocale::LongName" 6173 msgid "Yaum al-Jumma" 6174 msgstr "" 6175 6176 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6177 #, kde-format 6178 msgctxt "Hijri weekday 6 - KLocale::LongName" 6179 msgid "Yaum al-Sabt" 6180 msgstr "" 6181 6182 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6183 #, kde-format 6184 msgctxt "Hijri weekday 7 - KLocale::LongName" 6185 msgid "Yaum al-Ahad" 6186 msgstr "" 6187 6188 #: kdecore/kcalendarsystemjalali.cpp:74 6189 #, kde-format 6190 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6191 msgid "Anno Persico" 6192 msgstr "" 6193 6194 #: kdecore/kcalendarsystemjalali.cpp:75 6195 #, fuzzy, kde-format 6196 #| msgctxt "Before Noon KLocale::NarrowName" 6197 #| msgid "A" 6198 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6199 msgid "AP" 6200 msgstr "К" 6201 6202 #: kdecore/kcalendarsystemjalali.cpp:76 6203 #, kde-format 6204 msgctxt "" 6205 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6206 msgid "%Ey %EC" 6207 msgstr "" 6208 6209 #: kdecore/kcalendarsystemjalali.cpp:172 6210 #, kde-format 6211 msgctxt "Jalali month 1 - KLocale::NarrowName" 6212 msgid "F" 6213 msgstr "" 6214 6215 #: kdecore/kcalendarsystemjalali.cpp:174 6216 #, kde-format 6217 msgctxt "Jalali month 2 - KLocale::NarrowName" 6218 msgid "O" 6219 msgstr "" 6220 6221 #: kdecore/kcalendarsystemjalali.cpp:176 6222 #, kde-format 6223 msgctxt "Jalali month 3 - KLocale::NarrowName" 6224 msgid "K" 6225 msgstr "" 6226 6227 #: kdecore/kcalendarsystemjalali.cpp:178 6228 #, kde-format 6229 msgctxt "Jalali month 4 - KLocale::NarrowName" 6230 msgid "T" 6231 msgstr "" 6232 6233 #: kdecore/kcalendarsystemjalali.cpp:180 6234 #, fuzzy, kde-format 6235 #| msgctxt "Before Noon KLocale::ShortName" 6236 #| msgid "AM" 6237 msgctxt "Jalali month 5 - KLocale::NarrowName" 6238 msgid "M" 6239 msgstr "ТК" 6240 6241 #: kdecore/kcalendarsystemjalali.cpp:182 6242 #, kde-format 6243 msgctxt "Jalali month 6 - KLocale::NarrowName" 6244 msgid "S" 6245 msgstr "" 6246 6247 #: kdecore/kcalendarsystemjalali.cpp:184 6248 #, fuzzy, kde-format 6249 #| msgctxt "Before Noon KLocale::ShortName" 6250 #| msgid "AM" 6251 msgctxt "Jalali month 7 - KLocale::NarrowName" 6252 msgid "M" 6253 msgstr "ТК" 6254 6255 #: kdecore/kcalendarsystemjalali.cpp:186 6256 #, fuzzy, kde-format 6257 #| msgctxt "Before Noon KLocale::NarrowName" 6258 #| msgid "A" 6259 msgctxt "Jalali month 8 - KLocale::NarrowName" 6260 msgid "A" 6261 msgstr "К" 6262 6263 #: kdecore/kcalendarsystemjalali.cpp:188 6264 #, fuzzy, kde-format 6265 #| msgctxt "Before Noon KLocale::NarrowName" 6266 #| msgid "A" 6267 msgctxt "Jalali month 9 - KLocale::NarrowName" 6268 msgid "A" 6269 msgstr "К" 6270 6271 #: kdecore/kcalendarsystemjalali.cpp:190 6272 #, kde-format 6273 msgctxt "Jalali month 10 - KLocale::NarrowName" 6274 msgid "D" 6275 msgstr "" 6276 6277 #: kdecore/kcalendarsystemjalali.cpp:192 6278 #, kde-format 6279 msgctxt "Jalali month 11 - KLocale::NarrowName" 6280 msgid "B" 6281 msgstr "" 6282 6283 #: kdecore/kcalendarsystemjalali.cpp:194 6284 #, kde-format 6285 msgctxt "Jalali month 12 - KLocale::NarrowName" 6286 msgid "E" 6287 msgstr "" 6288 6289 #: kdecore/kcalendarsystemjalali.cpp:203 6290 #, kde-format 6291 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6292 msgid "of Far" 6293 msgstr "" 6294 6295 #: kdecore/kcalendarsystemjalali.cpp:205 6296 #, kde-format 6297 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6298 msgid "of Ord" 6299 msgstr "" 6300 6301 #: kdecore/kcalendarsystemjalali.cpp:207 6302 #, kde-format 6303 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6304 msgid "of Kho" 6305 msgstr "" 6306 6307 #: kdecore/kcalendarsystemjalali.cpp:209 6308 #, kde-format 6309 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6310 msgid "of Tir" 6311 msgstr "" 6312 6313 #: kdecore/kcalendarsystemjalali.cpp:211 6314 #, kde-format 6315 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6316 msgid "of Mor" 6317 msgstr "" 6318 6319 #: kdecore/kcalendarsystemjalali.cpp:213 6320 #, kde-format 6321 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6322 msgid "of Sha" 6323 msgstr "" 6324 6325 #: kdecore/kcalendarsystemjalali.cpp:215 6326 #, kde-format 6327 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6328 msgid "of Meh" 6329 msgstr "" 6330 6331 #: kdecore/kcalendarsystemjalali.cpp:217 6332 #, kde-format 6333 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6334 msgid "of Aba" 6335 msgstr "" 6336 6337 #: kdecore/kcalendarsystemjalali.cpp:219 6338 #, kde-format 6339 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6340 msgid "of Aza" 6341 msgstr "" 6342 6343 #: kdecore/kcalendarsystemjalali.cpp:221 6344 #, kde-format 6345 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6346 msgid "of Dei" 6347 msgstr "" 6348 6349 #: kdecore/kcalendarsystemjalali.cpp:223 6350 #, kde-format 6351 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6352 msgid "of Bah" 6353 msgstr "" 6354 6355 #: kdecore/kcalendarsystemjalali.cpp:225 6356 #, kde-format 6357 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6358 msgid "of Esf" 6359 msgstr "" 6360 6361 #: kdecore/kcalendarsystemjalali.cpp:234 6362 #, kde-format 6363 msgctxt "Jalali month 1 - KLocale::ShortName" 6364 msgid "Far" 6365 msgstr "" 6366 6367 #: kdecore/kcalendarsystemjalali.cpp:236 6368 #, kde-format 6369 msgctxt "Jalali month 2 - KLocale::ShortName" 6370 msgid "Ord" 6371 msgstr "" 6372 6373 #: kdecore/kcalendarsystemjalali.cpp:238 6374 #, fuzzy, kde-format 6375 #| msgctxt "KCharselect unicode block name" 6376 #| msgid "NKo" 6377 msgctxt "Jalali month 3 - KLocale::ShortName" 6378 msgid "Kho" 6379 msgstr "Нко" 6380 6381 #: kdecore/kcalendarsystemjalali.cpp:240 6382 #, kde-format 6383 msgctxt "Jalali month 4 - KLocale::ShortName" 6384 msgid "Tir" 6385 msgstr "" 6386 6387 #: kdecore/kcalendarsystemjalali.cpp:242 6388 #, fuzzy, kde-format 6389 #| msgctxt "" 6390 #| "Boolean OR keyword in desktop search strings. You can add several " 6391 #| "variants separated by spaces, e.g. retain the English one alongside the " 6392 #| "translation; keywords are not case sensitive. Make sure there is no " 6393 #| "conflict with the AND keyword." 6394 #| msgid "or" 6395 msgctxt "Jalali month 5 - KLocale::ShortName" 6396 msgid "Mor" 6397 msgstr "или" 6398 6399 #: kdecore/kcalendarsystemjalali.cpp:244 6400 #, kde-format 6401 msgctxt "Jalali month 6 - KLocale::ShortName" 6402 msgid "Sha" 6403 msgstr "" 6404 6405 #: kdecore/kcalendarsystemjalali.cpp:246 6406 #, kde-format 6407 msgctxt "Jalali month 7 - KLocale::ShortName" 6408 msgid "Meh" 6409 msgstr "" 6410 6411 #: kdecore/kcalendarsystemjalali.cpp:248 6412 #, kde-format 6413 msgctxt "Jalali month 8 - KLocale::ShortName" 6414 msgid "Aba" 6415 msgstr "" 6416 6417 #: kdecore/kcalendarsystemjalali.cpp:250 6418 #, kde-format 6419 msgctxt "Jalali month 9 - KLocale::ShortName" 6420 msgid "Aza" 6421 msgstr "" 6422 6423 #: kdecore/kcalendarsystemjalali.cpp:252 6424 #, fuzzy, kde-format 6425 #| msgctxt "keyboard-key-name" 6426 #| msgid "Del" 6427 msgctxt "Jalali month 10 - KLocale::ShortName" 6428 msgid "Dei" 6429 msgstr "Бетерү" 6430 6431 #: kdecore/kcalendarsystemjalali.cpp:254 6432 #, kde-format 6433 msgctxt "Jalali month 11 - KLocale::ShortName" 6434 msgid "Bah" 6435 msgstr "" 6436 6437 #: kdecore/kcalendarsystemjalali.cpp:256 6438 #, fuzzy, kde-format 6439 #| msgctxt "keyboard-key-name" 6440 #| msgid "Esc" 6441 msgctxt "Jalali month 12 - KLocale::ShortName" 6442 msgid "Esf" 6443 msgstr "Esc" 6444 6445 #: kdecore/kcalendarsystemjalali.cpp:265 6446 #, kde-format 6447 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6448 msgid "of Farvardin" 6449 msgstr "" 6450 6451 #: kdecore/kcalendarsystemjalali.cpp:267 6452 #, kde-format 6453 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6454 msgid "of Ordibehesht" 6455 msgstr "" 6456 6457 #: kdecore/kcalendarsystemjalali.cpp:269 6458 #, kde-format 6459 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6460 msgid "of Khordad" 6461 msgstr "" 6462 6463 #: kdecore/kcalendarsystemjalali.cpp:271 6464 #, kde-format 6465 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6466 msgid "of Tir" 6467 msgstr "" 6468 6469 #: kdecore/kcalendarsystemjalali.cpp:273 6470 #, kde-format 6471 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6472 msgid "of Mordad" 6473 msgstr "" 6474 6475 #: kdecore/kcalendarsystemjalali.cpp:275 6476 #, kde-format 6477 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6478 msgid "of Shahrivar" 6479 msgstr "" 6480 6481 #: kdecore/kcalendarsystemjalali.cpp:277 6482 #, kde-format 6483 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6484 msgid "of Mehr" 6485 msgstr "" 6486 6487 #: kdecore/kcalendarsystemjalali.cpp:279 6488 #, kde-format 6489 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6490 msgid "of Aban" 6491 msgstr "" 6492 6493 #: kdecore/kcalendarsystemjalali.cpp:281 6494 #, kde-format 6495 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6496 msgid "of Azar" 6497 msgstr "" 6498 6499 #: kdecore/kcalendarsystemjalali.cpp:283 6500 #, kde-format 6501 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6502 msgid "of Dei" 6503 msgstr "" 6504 6505 #: kdecore/kcalendarsystemjalali.cpp:285 6506 #, kde-format 6507 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6508 msgid "of Bahman" 6509 msgstr "" 6510 6511 #: kdecore/kcalendarsystemjalali.cpp:287 6512 #, kde-format 6513 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6514 msgid "of Esfand" 6515 msgstr "" 6516 6517 #: kdecore/kcalendarsystemjalali.cpp:296 6518 #, kde-format 6519 msgctxt "Jalali month 1 - KLocale::LongName" 6520 msgid "Farvardin" 6521 msgstr "" 6522 6523 #: kdecore/kcalendarsystemjalali.cpp:298 6524 #, kde-format 6525 msgctxt "Jalali month 2 - KLocale::LongName" 6526 msgid "Ordibehesht" 6527 msgstr "" 6528 6529 #: kdecore/kcalendarsystemjalali.cpp:300 6530 #, kde-format 6531 msgctxt "Jalali month 3 - KLocale::LongName" 6532 msgid "Khordad" 6533 msgstr "" 6534 6535 #: kdecore/kcalendarsystemjalali.cpp:302 6536 #, kde-format 6537 msgctxt "Jalali month 4 - KLocale::LongName" 6538 msgid "Tir" 6539 msgstr "" 6540 6541 #: kdecore/kcalendarsystemjalali.cpp:304 6542 #, kde-format 6543 msgctxt "Jalali month 5 - KLocale::LongName" 6544 msgid "Mordad" 6545 msgstr "" 6546 6547 #: kdecore/kcalendarsystemjalali.cpp:306 6548 #, kde-format 6549 msgctxt "Jalali month 6 - KLocale::LongName" 6550 msgid "Shahrivar" 6551 msgstr "" 6552 6553 #: kdecore/kcalendarsystemjalali.cpp:308 6554 #, kde-format 6555 msgctxt "Jalali month 7 - KLocale::LongName" 6556 msgid "Mehr" 6557 msgstr "" 6558 6559 #: kdecore/kcalendarsystemjalali.cpp:310 6560 #, kde-format 6561 msgctxt "Jalali month 8 - KLocale::LongName" 6562 msgid "Aban" 6563 msgstr "" 6564 6565 #: kdecore/kcalendarsystemjalali.cpp:312 6566 #, kde-format 6567 msgctxt "Jalali month 9 - KLocale::LongName" 6568 msgid "Azar" 6569 msgstr "" 6570 6571 #: kdecore/kcalendarsystemjalali.cpp:314 6572 #, fuzzy, kde-format 6573 #| msgctxt "keyboard-key-name" 6574 #| msgid "Del" 6575 msgctxt "Jalali month 10 - KLocale::LongName" 6576 msgid "Dei" 6577 msgstr "Бетерү" 6578 6579 #: kdecore/kcalendarsystemjalali.cpp:316 6580 #, kde-format 6581 msgctxt "Jalali month 11 - KLocale::LongName" 6582 msgid "Bahman" 6583 msgstr "" 6584 6585 #: kdecore/kcalendarsystemjalali.cpp:318 6586 #, kde-format 6587 msgctxt "Jalali month 12 - KLocale::LongName" 6588 msgid "Esfand" 6589 msgstr "" 6590 6591 #: kdecore/kcalendarsystemjalali.cpp:331 6592 #, fuzzy, kde-format 6593 #| msgid "2" 6594 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6595 msgid "2" 6596 msgstr "2" 6597 6598 #: kdecore/kcalendarsystemjalali.cpp:333 6599 #, fuzzy, kde-format 6600 #| msgid "3" 6601 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6602 msgid "3" 6603 msgstr "3" 6604 6605 #: kdecore/kcalendarsystemjalali.cpp:335 6606 #, fuzzy, kde-format 6607 #| msgid "4" 6608 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6609 msgid "4" 6610 msgstr "4" 6611 6612 #: kdecore/kcalendarsystemjalali.cpp:337 6613 #, fuzzy, kde-format 6614 #| msgid "5" 6615 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6616 msgid "5" 6617 msgstr "5" 6618 6619 #: kdecore/kcalendarsystemjalali.cpp:339 6620 #, kde-format 6621 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6622 msgid "J" 6623 msgstr "" 6624 6625 #: kdecore/kcalendarsystemjalali.cpp:341 6626 #, kde-format 6627 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6628 msgid "S" 6629 msgstr "" 6630 6631 #: kdecore/kcalendarsystemjalali.cpp:343 6632 #, fuzzy, kde-format 6633 #| msgid "1" 6634 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6635 msgid "1" 6636 msgstr "1" 6637 6638 #: kdecore/kcalendarsystemjalali.cpp:352 6639 #, kde-format 6640 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6641 msgid "2sh" 6642 msgstr "" 6643 6644 #: kdecore/kcalendarsystemjalali.cpp:354 6645 #, kde-format 6646 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6647 msgid "3sh" 6648 msgstr "" 6649 6650 #: kdecore/kcalendarsystemjalali.cpp:356 6651 #, kde-format 6652 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6653 msgid "4sh" 6654 msgstr "" 6655 6656 #: kdecore/kcalendarsystemjalali.cpp:358 6657 #, kde-format 6658 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6659 msgid "5sh" 6660 msgstr "" 6661 6662 #: kdecore/kcalendarsystemjalali.cpp:360 6663 #, fuzzy, kde-format 6664 #| msgid "Job" 6665 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6666 msgid "Jom" 6667 msgstr "Эш" 6668 6669 #: kdecore/kcalendarsystemjalali.cpp:362 6670 #, kde-format 6671 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6672 msgid "Shn" 6673 msgstr "" 6674 6675 #: kdecore/kcalendarsystemjalali.cpp:364 6676 #, kde-format 6677 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6678 msgid "1sh" 6679 msgstr "" 6680 6681 #: kdecore/kcalendarsystemjalali.cpp:371 6682 #, kde-format 6683 msgctxt "Jalali weekday 1 - KLocale::LongName" 6684 msgid "Do shanbe" 6685 msgstr "" 6686 6687 #: kdecore/kcalendarsystemjalali.cpp:373 6688 #, kde-format 6689 msgctxt "Jalali weekday 2 - KLocale::LongName" 6690 msgid "Se shanbe" 6691 msgstr "" 6692 6693 #: kdecore/kcalendarsystemjalali.cpp:375 6694 #, kde-format 6695 msgctxt "Jalali weekday 3 - KLocale::LongName" 6696 msgid "Chahar shanbe" 6697 msgstr "" 6698 6699 #: kdecore/kcalendarsystemjalali.cpp:377 6700 #, kde-format 6701 msgctxt "Jalali weekday 4 - KLocale::LongName" 6702 msgid "Panj shanbe" 6703 msgstr "" 6704 6705 #: kdecore/kcalendarsystemjalali.cpp:379 6706 #, kde-format 6707 msgctxt "Jalali weekday 5 - KLocale::LongName" 6708 msgid "Jumee" 6709 msgstr "" 6710 6711 #: kdecore/kcalendarsystemjalali.cpp:381 6712 #, kde-format 6713 msgctxt "Jalali weekday 6 - KLocale::LongName" 6714 msgid "Shanbe" 6715 msgstr "" 6716 6717 #: kdecore/kcalendarsystemjalali.cpp:383 6718 #, kde-format 6719 msgctxt "Jalali weekday 7 - KLocale::LongName" 6720 msgid "Yek-shanbe" 6721 msgstr "" 6722 6723 #: kdecore/kcalendarsystemjapanese.cpp:62 6724 #, kde-format 6725 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6726 msgid "Meiji" 6727 msgstr "" 6728 6729 #: kdecore/kcalendarsystemjapanese.cpp:64 6730 #, kde-format 6731 msgctxt "" 6732 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6733 "e.g. Meiji 1" 6734 msgid "%EC Gannen" 6735 msgstr "" 6736 6737 #: kdecore/kcalendarsystemjapanese.cpp:66 6738 #, kde-format 6739 msgctxt "" 6740 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6741 "e.g. Meiji 22" 6742 msgid "%EC %Ey" 6743 msgstr "" 6744 6745 #: kdecore/kcalendarsystemjapanese.cpp:69 6746 #, kde-format 6747 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6748 msgid "Taishō" 6749 msgstr "" 6750 6751 #: kdecore/kcalendarsystemjapanese.cpp:71 6752 #, kde-format 6753 msgctxt "" 6754 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6755 "1, e.g. Taishō 1" 6756 msgid "%EC Gannen" 6757 msgstr "" 6758 6759 #: kdecore/kcalendarsystemjapanese.cpp:73 6760 #, kde-format 6761 msgctxt "" 6762 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6763 "1, e.g. Taishō 22" 6764 msgid "%EC %Ey" 6765 msgstr "" 6766 6767 #: kdecore/kcalendarsystemjapanese.cpp:76 6768 #, kde-format 6769 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6770 msgid "Shōwa" 6771 msgstr "" 6772 6773 #: kdecore/kcalendarsystemjapanese.cpp:78 6774 #, kde-format 6775 msgctxt "" 6776 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6777 "e.g. Shōwa 1" 6778 msgid "%EC Gannen" 6779 msgstr "" 6780 6781 #: kdecore/kcalendarsystemjapanese.cpp:80 6782 #, kde-format 6783 msgctxt "" 6784 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6785 "e.g. Shōwa 22" 6786 msgid "%EC %Ey" 6787 msgstr "" 6788 6789 #: kdecore/kcalendarsystemjapanese.cpp:83 6790 #, kde-format 6791 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6792 msgid "Heisei" 6793 msgstr "" 6794 6795 #: kdecore/kcalendarsystemjapanese.cpp:85 6796 #, kde-format 6797 msgctxt "" 6798 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6799 "1, e.g. Heisei 1" 6800 msgid "%EC Gannen" 6801 msgstr "" 6802 6803 #: kdecore/kcalendarsystemjapanese.cpp:87 6804 #, kde-format 6805 msgctxt "" 6806 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6807 "1, e.g. Heisei 22" 6808 msgid "%EC %Ey" 6809 msgstr "" 6810 6811 #: kdecore/kcalendarsystemjapanese.cpp:164 6812 #, kde-format 6813 msgctxt "Japanese year 1 of era" 6814 msgid "Gannen" 6815 msgstr "" 6816 6817 #: kdecore/kcalendarsystemjulian.cpp:73 6818 #, kde-format 6819 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6820 msgid "Before Common Era" 6821 msgstr "" 6822 6823 #: kdecore/kcalendarsystemjulian.cpp:74 6824 #, fuzzy, kde-format 6825 #| msgctxt "@item:inmenu uppercase abc lists" 6826 #| msgid "ABC" 6827 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6828 msgid "BCE" 6829 msgstr "ABC" 6830 6831 #: kdecore/kcalendarsystemjulian.cpp:76 6832 #, fuzzy, kde-format 6833 #| msgid "Before" 6834 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6835 msgid "Before Christ" 6836 msgstr "Моңа кадәр" 6837 6838 #: kdecore/kcalendarsystemjulian.cpp:77 6839 #, fuzzy, kde-format 6840 #| msgctxt "@item:inmenu uppercase abc lists" 6841 #| msgid "ABC" 6842 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6843 msgid "BC" 6844 msgstr "ABC" 6845 6846 #: kdecore/kcalendarsystemjulian.cpp:79 6847 #, kde-format 6848 msgctxt "" 6849 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6850 msgid "%Ey %EC" 6851 msgstr "" 6852 6853 #: kdecore/kcalendarsystemjulian.cpp:83 6854 #, fuzzy, kde-format 6855 #| msgid "Comment on entry" 6856 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6857 msgid "Common Era" 6858 msgstr "Фикер" 6859 6860 #: kdecore/kcalendarsystemjulian.cpp:84 6861 #, kde-format 6862 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6863 msgid "CE" 6864 msgstr "" 6865 6866 #: kdecore/kcalendarsystemjulian.cpp:86 6867 #, kde-format 6868 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6869 msgid "Anno Domini" 6870 msgstr "" 6871 6872 #: kdecore/kcalendarsystemjulian.cpp:87 6873 #, fuzzy, kde-format 6874 #| msgctxt "Before Noon KLocale::NarrowName" 6875 #| msgid "A" 6876 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6877 msgid "AD" 6878 msgstr "К" 6879 6880 #: kdecore/kcalendarsystemjulian.cpp:89 6881 #, kde-format 6882 msgctxt "" 6883 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6884 msgid "%Ey %EC" 6885 msgstr "" 6886 6887 #: kdecore/kcalendarsystemjulian.cpp:172 6888 #, kde-format 6889 msgctxt "Julian month 1 - KLocale::NarrowName" 6890 msgid "J" 6891 msgstr "" 6892 6893 #: kdecore/kcalendarsystemjulian.cpp:174 6894 #, kde-format 6895 msgctxt "Julian month 2 - KLocale::NarrowName" 6896 msgid "F" 6897 msgstr "" 6898 6899 #: kdecore/kcalendarsystemjulian.cpp:176 6900 #, fuzzy, kde-format 6901 #| msgctxt "Before Noon KLocale::ShortName" 6902 #| msgid "AM" 6903 msgctxt "Julian month 3 - KLocale::NarrowName" 6904 msgid "M" 6905 msgstr "ТК" 6906 6907 #: kdecore/kcalendarsystemjulian.cpp:178 6908 #, fuzzy, kde-format 6909 #| msgctxt "Before Noon KLocale::NarrowName" 6910 #| msgid "A" 6911 msgctxt "Julian month 4 - KLocale::NarrowName" 6912 msgid "A" 6913 msgstr "К" 6914 6915 #: kdecore/kcalendarsystemjulian.cpp:180 6916 #, fuzzy, kde-format 6917 #| msgctxt "Before Noon KLocale::ShortName" 6918 #| msgid "AM" 6919 msgctxt "Julian month 5 - KLocale::NarrowName" 6920 msgid "M" 6921 msgstr "ТК" 6922 6923 #: kdecore/kcalendarsystemjulian.cpp:182 6924 #, kde-format 6925 msgctxt "Julian month 6 - KLocale::NarrowName" 6926 msgid "J" 6927 msgstr "" 6928 6929 #: kdecore/kcalendarsystemjulian.cpp:184 6930 #, kde-format 6931 msgctxt "Julian month 7 - KLocale::NarrowName" 6932 msgid "J" 6933 msgstr "" 6934 6935 #: kdecore/kcalendarsystemjulian.cpp:186 6936 #, fuzzy, kde-format 6937 #| msgctxt "Before Noon KLocale::NarrowName" 6938 #| msgid "A" 6939 msgctxt "Julian month 8 - KLocale::NarrowName" 6940 msgid "A" 6941 msgstr "К" 6942 6943 #: kdecore/kcalendarsystemjulian.cpp:188 6944 #, kde-format 6945 msgctxt "Julian month 9 - KLocale::NarrowName" 6946 msgid "S" 6947 msgstr "" 6948 6949 #: kdecore/kcalendarsystemjulian.cpp:190 6950 #, kde-format 6951 msgctxt "Julian month 10 - KLocale::NarrowName" 6952 msgid "O" 6953 msgstr "" 6954 6955 #: kdecore/kcalendarsystemjulian.cpp:192 6956 #, fuzzy, kde-format 6957 #| msgid "No" 6958 msgctxt "Julian month 11 - KLocale::NarrowName" 6959 msgid "N" 6960 msgstr "Юк" 6961 6962 #: kdecore/kcalendarsystemjulian.cpp:194 6963 #, kde-format 6964 msgctxt "Julian month 12 - KLocale::NarrowName" 6965 msgid "D" 6966 msgstr "" 6967 6968 #: kdecore/kcalendarsystemjulian.cpp:203 6969 #, kde-format 6970 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6971 msgid "of Jan" 6972 msgstr "" 6973 6974 #: kdecore/kcalendarsystemjulian.cpp:205 6975 #, kde-format 6976 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6977 msgid "of Feb" 6978 msgstr "" 6979 6980 #: kdecore/kcalendarsystemjulian.cpp:207 6981 #, kde-format 6982 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6983 msgid "of Mar" 6984 msgstr "" 6985 6986 #: kdecore/kcalendarsystemjulian.cpp:209 6987 #, kde-format 6988 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 6989 msgid "of Apr" 6990 msgstr "" 6991 6992 #: kdecore/kcalendarsystemjulian.cpp:211 6993 #, kde-format 6994 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 6995 msgid "of May" 6996 msgstr "" 6997 6998 #: kdecore/kcalendarsystemjulian.cpp:213 6999 #, kde-format 7000 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7001 msgid "of Jun" 7002 msgstr "" 7003 7004 #: kdecore/kcalendarsystemjulian.cpp:215 7005 #, kde-format 7006 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7007 msgid "of Jul" 7008 msgstr "" 7009 7010 #: kdecore/kcalendarsystemjulian.cpp:217 7011 #, kde-format 7012 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7013 msgid "of Aug" 7014 msgstr "" 7015 7016 #: kdecore/kcalendarsystemjulian.cpp:219 7017 #, kde-format 7018 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7019 msgid "of Sep" 7020 msgstr "" 7021 7022 #: kdecore/kcalendarsystemjulian.cpp:221 7023 #, kde-format 7024 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7025 msgid "of Oct" 7026 msgstr "" 7027 7028 #: kdecore/kcalendarsystemjulian.cpp:223 7029 #, kde-format 7030 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7031 msgid "of Nov" 7032 msgstr "" 7033 7034 #: kdecore/kcalendarsystemjulian.cpp:225 7035 #, kde-format 7036 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7037 msgid "of Dec" 7038 msgstr "" 7039 7040 #: kdecore/kcalendarsystemjulian.cpp:234 7041 #, fuzzy, kde-format 7042 #| msgctxt "" 7043 #| "Boolean AND keyword in desktop search strings. You can add several " 7044 #| "variants separated by spaces, e.g. retain the English one alongside the " 7045 #| "translation; keywords are not case sensitive. Make sure there is no " 7046 #| "conflict with the OR keyword." 7047 #| msgid "and" 7048 msgctxt "Julian month 1 - KLocale::ShortName" 7049 msgid "Jan" 7050 msgstr "и" 7051 7052 #: kdecore/kcalendarsystemjulian.cpp:236 7053 #, kde-format 7054 msgctxt "Julian month 2 - KLocale::ShortName" 7055 msgid "Feb" 7056 msgstr "" 7057 7058 #: kdecore/kcalendarsystemjulian.cpp:238 7059 #, kde-format 7060 msgctxt "Julian month 3 - KLocale::ShortName" 7061 msgid "Mar" 7062 msgstr "" 7063 7064 #: kdecore/kcalendarsystemjulian.cpp:240 7065 #, kde-format 7066 msgctxt "Julian month 4 - KLocale::ShortName" 7067 msgid "Apr" 7068 msgstr "" 7069 7070 #: kdecore/kcalendarsystemjulian.cpp:242 7071 #, kde-format 7072 msgctxt "Julian month 5 - KLocale::ShortName" 7073 msgid "May" 7074 msgstr "" 7075 7076 #: kdecore/kcalendarsystemjulian.cpp:244 7077 #, fuzzy, kde-format 7078 #| msgid "Run" 7079 msgctxt "Julian month 6 - KLocale::ShortName" 7080 msgid "Jun" 7081 msgstr "Җибәрү" 7082 7083 #: kdecore/kcalendarsystemjulian.cpp:246 7084 #, kde-format 7085 msgctxt "Julian month 7 - KLocale::ShortName" 7086 msgid "Jul" 7087 msgstr "" 7088 7089 #: kdecore/kcalendarsystemjulian.cpp:248 7090 #, kde-format 7091 msgctxt "Julian month 8 - KLocale::ShortName" 7092 msgid "Aug" 7093 msgstr "" 7094 7095 #: kdecore/kcalendarsystemjulian.cpp:250 7096 #, fuzzy, kde-format 7097 #| msgid "Step" 7098 msgctxt "Julian month 9 - KLocale::ShortName" 7099 msgid "Sep" 7100 msgstr "Чик" 7101 7102 #: kdecore/kcalendarsystemjulian.cpp:252 7103 #, kde-format 7104 msgctxt "Julian month 10 - KLocale::ShortName" 7105 msgid "Oct" 7106 msgstr "" 7107 7108 #: kdecore/kcalendarsystemjulian.cpp:254 7109 #, fuzzy, kde-format 7110 #| msgid "No" 7111 msgctxt "Julian month 11 - KLocale::ShortName" 7112 msgid "Nov" 7113 msgstr "Юк" 7114 7115 #: kdecore/kcalendarsystemjulian.cpp:256 7116 #, fuzzy, kde-format 7117 #| msgid "Detach" 7118 msgctxt "Julian month 12 - KLocale::ShortName" 7119 msgid "Dec" 7120 msgstr "Аеру" 7121 7122 #: kdecore/kcalendarsystemjulian.cpp:265 7123 #, kde-format 7124 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7125 msgid "of January" 7126 msgstr "" 7127 7128 #: kdecore/kcalendarsystemjulian.cpp:267 7129 #, kde-format 7130 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7131 msgid "of February" 7132 msgstr "" 7133 7134 #: kdecore/kcalendarsystemjulian.cpp:269 7135 #, kde-format 7136 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7137 msgid "of March" 7138 msgstr "" 7139 7140 #: kdecore/kcalendarsystemjulian.cpp:271 7141 #, kde-format 7142 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7143 msgid "of April" 7144 msgstr "" 7145 7146 #: kdecore/kcalendarsystemjulian.cpp:273 7147 #, kde-format 7148 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7149 msgid "of May" 7150 msgstr "" 7151 7152 #: kdecore/kcalendarsystemjulian.cpp:275 7153 #, kde-format 7154 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7155 msgid "of June" 7156 msgstr "" 7157 7158 #: kdecore/kcalendarsystemjulian.cpp:277 7159 #, kde-format 7160 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7161 msgid "of July" 7162 msgstr "" 7163 7164 #: kdecore/kcalendarsystemjulian.cpp:279 7165 #, kde-format 7166 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7167 msgid "of August" 7168 msgstr "" 7169 7170 #: kdecore/kcalendarsystemjulian.cpp:281 7171 #, kde-format 7172 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7173 msgid "of September" 7174 msgstr "" 7175 7176 #: kdecore/kcalendarsystemjulian.cpp:283 7177 #, kde-format 7178 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7179 msgid "of October" 7180 msgstr "" 7181 7182 #: kdecore/kcalendarsystemjulian.cpp:285 7183 #, kde-format 7184 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7185 msgid "of November" 7186 msgstr "" 7187 7188 #: kdecore/kcalendarsystemjulian.cpp:287 7189 #, kde-format 7190 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7191 msgid "of December" 7192 msgstr "" 7193 7194 #: kdecore/kcalendarsystemjulian.cpp:296 7195 #, fuzzy, kde-format 7196 #| msgctxt "@item:inmenu Text Completion" 7197 #| msgid "Manual" 7198 msgctxt "Julian month 1 - KLocale::LongName" 7199 msgid "January" 7200 msgstr "Кулдан" 7201 7202 #: kdecore/kcalendarsystemjulian.cpp:298 7203 #, kde-format 7204 msgctxt "Julian month 2 - KLocale::LongName" 7205 msgid "February" 7206 msgstr "" 7207 7208 #: kdecore/kcalendarsystemjulian.cpp:300 7209 #, fuzzy, kde-format 7210 #| msgid "Search" 7211 msgctxt "Julian month 3 - KLocale::LongName" 7212 msgid "March" 7213 msgstr "Поиск" 7214 7215 #: kdecore/kcalendarsystemjulian.cpp:302 7216 #, kde-format 7217 msgctxt "Julian month 4 - KLocale::LongName" 7218 msgid "April" 7219 msgstr "" 7220 7221 #: kdecore/kcalendarsystemjulian.cpp:304 7222 #, kde-format 7223 msgctxt "Julian month 5 - KLocale::LongName" 7224 msgid "May" 7225 msgstr "" 7226 7227 #: kdecore/kcalendarsystemjulian.cpp:306 7228 #, kde-format 7229 msgctxt "Julian month 6 - KLocale::LongName" 7230 msgid "June" 7231 msgstr "" 7232 7233 #: kdecore/kcalendarsystemjulian.cpp:308 7234 #, kde-format 7235 msgctxt "Julian month 7 - KLocale::LongName" 7236 msgid "July" 7237 msgstr "" 7238 7239 #: kdecore/kcalendarsystemjulian.cpp:310 7240 #, kde-format 7241 msgctxt "Julian month 8 - KLocale::LongName" 7242 msgid "August" 7243 msgstr "" 7244 7245 #: kdecore/kcalendarsystemjulian.cpp:312 7246 #, kde-format 7247 msgctxt "Julian month 9 - KLocale::LongName" 7248 msgid "September" 7249 msgstr "" 7250 7251 #: kdecore/kcalendarsystemjulian.cpp:314 7252 #, kde-format 7253 msgctxt "Julian month 10 - KLocale::LongName" 7254 msgid "October" 7255 msgstr "" 7256 7257 #: kdecore/kcalendarsystemjulian.cpp:316 7258 #, kde-format 7259 msgctxt "Julian month 11 - KLocale::LongName" 7260 msgid "November" 7261 msgstr "" 7262 7263 #: kdecore/kcalendarsystemjulian.cpp:318 7264 #, kde-format 7265 msgctxt "Julian month 12 - KLocale::LongName" 7266 msgid "December" 7267 msgstr "" 7268 7269 #: kdecore/kcalendarsystemjulian.cpp:331 7270 #, fuzzy, kde-format 7271 #| msgctxt "Before Noon KLocale::ShortName" 7272 #| msgid "AM" 7273 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7274 msgid "M" 7275 msgstr "ТК" 7276 7277 #: kdecore/kcalendarsystemjulian.cpp:333 7278 #, kde-format 7279 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7280 msgid "T" 7281 msgstr "" 7282 7283 #: kdecore/kcalendarsystemjulian.cpp:335 7284 #, kde-format 7285 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7286 msgid "W" 7287 msgstr "" 7288 7289 #: kdecore/kcalendarsystemjulian.cpp:337 7290 #, kde-format 7291 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7292 msgid "T" 7293 msgstr "" 7294 7295 #: kdecore/kcalendarsystemjulian.cpp:339 7296 #, kde-format 7297 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7298 msgid "F" 7299 msgstr "" 7300 7301 #: kdecore/kcalendarsystemjulian.cpp:341 7302 #, kde-format 7303 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7304 msgid "S" 7305 msgstr "" 7306 7307 #: kdecore/kcalendarsystemjulian.cpp:343 7308 #, kde-format 7309 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7310 msgid "S" 7311 msgstr "" 7312 7313 #: kdecore/kcalendarsystemjulian.cpp:352 7314 #, kde-format 7315 msgctxt "Julian weekday 1 - KLocale::ShortName" 7316 msgid "Mon" 7317 msgstr "" 7318 7319 #: kdecore/kcalendarsystemjulian.cpp:354 7320 #, kde-format 7321 msgctxt "Julian weekday 2 - KLocale::ShortName" 7322 msgid "Tue" 7323 msgstr "" 7324 7325 #: kdecore/kcalendarsystemjulian.cpp:356 7326 #, kde-format 7327 msgctxt "Julian weekday 3 - KLocale::ShortName" 7328 msgid "Wed" 7329 msgstr "" 7330 7331 #: kdecore/kcalendarsystemjulian.cpp:358 7332 #, kde-format 7333 msgctxt "Julian weekday 4 - KLocale::ShortName" 7334 msgid "Thu" 7335 msgstr "" 7336 7337 #: kdecore/kcalendarsystemjulian.cpp:360 7338 #, kde-format 7339 msgctxt "Julian weekday 5 - KLocale::ShortName" 7340 msgid "Fri" 7341 msgstr "" 7342 7343 #: kdecore/kcalendarsystemjulian.cpp:362 7344 #, fuzzy, kde-format 7345 #| msgid "Start" 7346 msgctxt "Julian weekday 6 - KLocale::ShortName" 7347 msgid "Sat" 7348 msgstr "Башлау" 7349 7350 #: kdecore/kcalendarsystemjulian.cpp:364 7351 #, fuzzy, kde-format 7352 #| msgid "Run" 7353 msgctxt "Julian weekday 7 - KLocale::ShortName" 7354 msgid "Sun" 7355 msgstr "Җибәрү" 7356 7357 #: kdecore/kcalendarsystemjulian.cpp:371 7358 #, kde-format 7359 msgctxt "Julian weekday 1 - KLocale::LongName" 7360 msgid "Monday" 7361 msgstr "" 7362 7363 #: kdecore/kcalendarsystemjulian.cpp:373 7364 #, kde-format 7365 msgctxt "Julian weekday 2 - KLocale::LongName" 7366 msgid "Tuesday" 7367 msgstr "" 7368 7369 #: kdecore/kcalendarsystemjulian.cpp:375 7370 #, kde-format 7371 msgctxt "Julian weekday 3 - KLocale::LongName" 7372 msgid "Wednesday" 7373 msgstr "" 7374 7375 #: kdecore/kcalendarsystemjulian.cpp:377 7376 #, kde-format 7377 msgctxt "Julian weekday 4 - KLocale::LongName" 7378 msgid "Thursday" 7379 msgstr "" 7380 7381 #: kdecore/kcalendarsystemjulian.cpp:379 7382 #, kde-format 7383 msgctxt "Julian weekday 5 - KLocale::LongName" 7384 msgid "Friday" 7385 msgstr "" 7386 7387 #: kdecore/kcalendarsystemjulian.cpp:381 7388 #, fuzzy, kde-format 7389 #| msgid "Saturation:" 7390 msgctxt "Julian weekday 6 - KLocale::LongName" 7391 msgid "Saturday" 7392 msgstr "Насыщенность:" 7393 7394 #: kdecore/kcalendarsystemjulian.cpp:383 7395 #, fuzzy, kde-format 7396 #| msgctxt "KCharselect unicode block name" 7397 #| msgid "Sundanese" 7398 msgctxt "Julian weekday 7 - KLocale::LongName" 7399 msgid "Sunday" 7400 msgstr "Сунданез" 7401 7402 #: kdecore/kcalendarsystemminguo.cpp:57 7403 #, kde-format 7404 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7405 msgid "Republic of China Era" 7406 msgstr "" 7407 7408 #: kdecore/kcalendarsystemminguo.cpp:58 7409 #, kde-format 7410 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7411 msgid "ROC" 7412 msgstr "" 7413 7414 #: kdecore/kcalendarsystemminguo.cpp:59 7415 #, kde-format 7416 msgctxt "" 7417 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7418 msgid "%EC %Ey" 7419 msgstr "" 7420 7421 #: kdecore/kcalendarsystemthai.cpp:58 7422 #, kde-format 7423 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7424 msgid "Buddhist Era" 7425 msgstr "" 7426 7427 #: kdecore/kcalendarsystemthai.cpp:59 7428 #, kde-format 7429 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7430 msgid "BE" 7431 msgstr "" 7432 7433 #: kdecore/kcalendarsystemthai.cpp:60 7434 #, kde-format 7435 msgctxt "" 7436 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7437 msgid "%Ey %EC" 7438 msgstr "" 7439 7440 #: kdecore/kcmdlineargs.cpp:278 7441 #, kde-format 7442 msgid "Use the X-server display 'displayname'" 7443 msgstr "X серверының «displayname» экранын куллану" 7444 7445 #: kdecore/kcmdlineargs.cpp:281 7446 #, kde-format 7447 msgid "Restore the application for the given 'sessionId'" 7448 msgstr "«sessionId» ачкычы аша кушымтаның сеансын торгызу" 7449 7450 #: kdecore/kcmdlineargs.cpp:282 7451 #, kde-format 7452 msgid "" 7453 "Causes the application to install a private color\n" 7454 "map on an 8-bit display" 7455 msgstr "" 7456 "8-битлы экран очрагында кушымта\n" 7457 "үзенең төсләр җәдвәлен кулланачак" 7458 7459 #: kdecore/kcmdlineargs.cpp:283 7460 #, kde-format 7461 msgid "" 7462 "Limits the number of colors allocated in the color\n" 7463 "cube on an 8-bit display, if the application is\n" 7464 "using the QApplication::ManyColor color\n" 7465 "specification" 7466 msgstr "" 7467 "8 битлы экранда кулланучы төсләрнең\n" 7468 "санын чикләү. Бу параметр \n" 7469 "QApplication::ManyColor \n" 7470 "режимын куллана торган \n" 7471 "кушымталарда гына эшли" 7472 7473 #: kdecore/kcmdlineargs.cpp:284 7474 #, kde-format 7475 msgid "tells Qt to never grab the mouse or the keyboard" 7476 msgstr "qt коралына тычкан һәм клавиатураны тотып алуны тыя" 7477 7478 #: kdecore/kcmdlineargs.cpp:285 7479 #, kde-format 7480 msgid "" 7481 "running under a debugger can cause an implicit\n" 7482 "-nograb, use -dograb to override" 7483 msgstr "" 7484 "көйләүчене -nograb ачкычы белән җибәрү.\n" 7485 "Бу алымны ачыклы рәвештә җибәрү өчен -dograb ачкычы белән кулланыгыз" 7486 7487 #: kdecore/kcmdlineargs.cpp:286 7488 #, kde-format 7489 msgid "switches to synchronous mode for debugging" 7490 msgstr "Көйләү өчен синхрон режимын җибәрә" 7491 7492 #: kdecore/kcmdlineargs.cpp:288 7493 #, kde-format 7494 msgid "defines the application font" 7495 msgstr "кушымтаның хәрефен билгели" 7496 7497 #: kdecore/kcmdlineargs.cpp:290 7498 #, kde-format 7499 msgid "" 7500 "sets the default background color and an\n" 7501 "application palette (light and dark shades are\n" 7502 "calculated)" 7503 msgstr "" 7504 "Кушымтаның стандарт булган җирлек төсен\n" 7505 "һәм палитрасын билгели (ачык һәм кара\n" 7506 "күләгәләр санала)." 7507 7508 #: kdecore/kcmdlineargs.cpp:292 7509 #, kde-format 7510 msgid "sets the default foreground color" 7511 msgstr "текстның стандарт төсен билгели" 7512 7513 #: kdecore/kcmdlineargs.cpp:294 7514 #, kde-format 7515 msgid "sets the default button color" 7516 msgstr "Төймәләрнең стандарт төсен билгели" 7517 7518 #: kdecore/kcmdlineargs.cpp:295 7519 #, kde-format 7520 msgid "sets the application name" 7521 msgstr "кушымтаның исемен билгели" 7522 7523 #: kdecore/kcmdlineargs.cpp:296 7524 #, kde-format 7525 msgid "sets the application title (caption)" 7526 msgstr "кушымтаның баш исемен билгели" 7527 7528 #: kdecore/kcmdlineargs.cpp:297 7529 #, kde-format 7530 msgid "load the testability framework" 7531 msgstr "" 7532 7533 #: kdecore/kcmdlineargs.cpp:299 7534 #, kde-format 7535 msgid "" 7536 "forces the application to use a TrueColor visual on\n" 7537 "an 8-bit display" 7538 msgstr "" 7539 "Кушымта 8-битлы экран белән тулы төсле\n" 7540 "экранда эшләгән кебек эшли." 7541 7542 #: kdecore/kcmdlineargs.cpp:300 7543 #, kde-format 7544 msgid "" 7545 "sets XIM (X Input Method) input style. Possible\n" 7546 "values are onthespot, overthespot, offthespot and\n" 7547 "root" 7548 msgstr "" 7549 "XIM (X Input Method) кертү ысулын урнаштыра.\n" 7550 "Мөмкин булган мәгънәләр: onthespot, overthespot, offthespot һәм\n" 7551 "root." 7552 7553 #: kdecore/kcmdlineargs.cpp:301 7554 #, kde-format 7555 msgid "set XIM server" 7556 msgstr "XIM серверын урнаштыра" 7557 7558 #: kdecore/kcmdlineargs.cpp:302 7559 #, kde-format 7560 msgid "disable XIM" 7561 msgstr "XIM серверын тыю" 7562 7563 #: kdecore/kcmdlineargs.cpp:304 7564 #, kde-format 7565 msgid "mirrors the whole layout of widgets" 7566 msgstr "виджетларның урнашуын кире чагылдыру" 7567 7568 #: kdecore/kcmdlineargs.cpp:305 7569 #, kde-format 7570 msgid "applies the Qt stylesheet to the application widgets" 7571 msgstr "Кушмытаның график элементларын Qt стиленә китерә" 7572 7573 #: kdecore/kcmdlineargs.cpp:306 7574 #, kde-format 7575 msgid "" 7576 "use a different graphics system instead of the default one, options are " 7577 "raster and opengl (experimental)" 7578 msgstr "" 7579 "эффектны җибәрү өчен күрсәтелгән график алымын куллану: raster яки opengl" 7580 7581 #: kdecore/kcmdlineargs.cpp:307 7582 #, kde-format 7583 msgid "" 7584 "QML JS debugger information. Application must be\n" 7585 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7586 "enabled" 7587 msgstr "" 7588 7589 #: kdecore/kcmdlineargs.cpp:308 7590 #, kde-format 7591 msgid "The windowing system platform (e.g. xcb or wayland)" 7592 msgstr "" 7593 7594 #: kdecore/kcmdlineargs.cpp:310 7595 #, kde-format 7596 msgid "Use 'caption' as name in the titlebar" 7597 msgstr "«caption» исемен баш исемдә куллану" 7598 7599 #: kdecore/kcmdlineargs.cpp:311 7600 #, kde-format 7601 msgid "Use 'icon' as the application icon" 7602 msgstr "«icon»ны кушымта билгечеге буларак куллану" 7603 7604 #: kdecore/kcmdlineargs.cpp:312 7605 #, kde-format 7606 msgid "Use alternative configuration file" 7607 msgstr "Альтернатив көйләү файлын куллану" 7608 7609 #: kdecore/kcmdlineargs.cpp:313 7610 #, kde-format 7611 msgid "Disable crash handler, to get core dumps" 7612 msgstr "" 7613 "Тоткарлыклар тикшерүен өзү. Бу көйләү тоткарлык очрагында core dump " 7614 "файлларын алу мөмкинлеген бирә." 7615 7616 #: kdecore/kcmdlineargs.cpp:315 7617 #, kde-format 7618 msgid "Waits for a WM_NET compatible windowmanager" 7619 msgstr "WM_NET белән туры килә торган тәрәзә мөһәррирен җибәрелүен көтү" 7620 7621 #: kdecore/kcmdlineargs.cpp:317 7622 #, kde-format 7623 msgid "sets the application GUI style" 7624 msgstr "кушымтаның график интерфейс стилен урнаштыра" 7625 7626 #: kdecore/kcmdlineargs.cpp:318 7627 #, kde-format 7628 msgid "" 7629 "sets the client geometry of the main widget - see man X for the argument " 7630 "format (usually WidthxHeight+XPos+YPos)" 7631 msgstr "" 7632 "Кушымтаның баш тәрәзә урынын һәм зурлыгын билгели - аргументның рәвешен man " 7633 "X белешмәсе аша белеп була (гадәттә ул КИҢЛЕК×БИЕКЛЕК+X+Y)" 7634 7635 #: kdecore/kcmdlineargs.cpp:436 7636 #, kde-format 7637 msgid "KDE Application" 7638 msgstr "KDE кушымтасы" 7639 7640 #: kdecore/kcmdlineargs.cpp:497 7641 #, kde-format 7642 msgid "Qt" 7643 msgstr "Qt" 7644 7645 #: kdecore/kcmdlineargs.cpp:500 7646 #, kde-format 7647 msgid "KDE" 7648 msgstr "KDE" 7649 7650 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7651 #, kde-format 7652 msgid "Unknown option '%1'." 7653 msgstr "%1 параметры билгесез" 7654 7655 #: kdecore/kcmdlineargs.cpp:841 7656 #, kde-format 7657 msgctxt "@info:shell %1 is cmdoption name" 7658 msgid "'%1' missing." 7659 msgstr "'%1' юк." 7660 7661 #: kdecore/kcmdlineargs.cpp:895 7662 #, fuzzy, kde-format 7663 #| msgctxt "" 7664 #| "@info:shell message on appcmd --version; do not translate 'Development " 7665 #| "Platform'%3 application name, other %n version strings" 7666 #| msgid "" 7667 #| "Qt: %1\n" 7668 #| "KDE Development Platform: %2\n" 7669 #| "%3: %4\n" 7670 msgctxt "" 7671 "@info:shell message on appcmd --version; do not translate 'Development " 7672 "Platform'%3 application name, other %n version strings" 7673 msgid "" 7674 "Qt: %1\n" 7675 "KDE Frameworks: %2\n" 7676 "%3: %4\n" 7677 msgstr "" 7678 "Qt: %1\n" 7679 "KDE Программалаштыру Платформасы: %2\n" 7680 "%3: %4\n" 7681 7682 #: kdecore/kcmdlineargs.cpp:921 7683 #, kde-format 7684 msgctxt "the 2nd argument is a list of name+address, one on each line" 7685 msgid "" 7686 "%1 was written by\n" 7687 "%2" 7688 msgstr "" 7689 "%1 яздылар:\n" 7690 "%2" 7691 7692 #: kdecore/kcmdlineargs.cpp:924 7693 #, kde-format 7694 msgid "This application was written by somebody who wants to remain anonymous." 7695 msgstr "Кушымтаның авторы билгесез булып калырга теләде." 7696 7697 #: kdecore/kcmdlineargs.cpp:929 7698 #, kde-format 7699 msgid "Please use http://bugs.kde.org to report bugs.\n" 7700 msgstr "Хаталар турында хәбәрләр өчен http://bugs.kde.org белән кулланыгыз.\n" 7701 7702 #: kdecore/kcmdlineargs.cpp:931 7703 #, kde-format 7704 msgid "Please report bugs to %1.\n" 7705 msgstr "Хаталар турында хәбәрләр өчен %1 белән кулланыгыз.\n" 7706 7707 #: kdecore/kcmdlineargs.cpp:961 7708 #, kde-format 7709 msgid "Unexpected argument '%1'." 7710 msgstr "'%1' аргументы хаталы." 7711 7712 #: kdecore/kcmdlineargs.cpp:1074 7713 #, kde-format 7714 msgid "Use --help to get a list of available command line options." 7715 msgstr "Рөхсәт булган исемлеген чагылдыру өчен --help ачкычын кулланыгыз." 7716 7717 #: kdecore/kcmdlineargs.cpp:1096 7718 #, kde-format 7719 msgid "[options] " 7720 msgstr "[параметрлар] " 7721 7722 #: kdecore/kcmdlineargs.cpp:1101 7723 #, kde-format 7724 msgid "[%1-options]" 7725 msgstr "[%1 параметрлары]" 7726 7727 #: kdecore/kcmdlineargs.cpp:1122 7728 #, kde-format 7729 msgid "Usage: %1 %2\n" 7730 msgstr "Кулланыш: %1 %2\n" 7731 7732 #: kdecore/kcmdlineargs.cpp:1125 7733 #, kde-format 7734 msgid "" 7735 "\n" 7736 "Generic options:\n" 7737 msgstr "" 7738 "\n" 7739 "Гомумән көйләү:\n" 7740 7741 #: kdecore/kcmdlineargs.cpp:1127 7742 #, kde-format 7743 msgid "Show help about options" 7744 msgstr "Параметрлар турында белешмәне күрсәтү" 7745 7746 #: kdecore/kcmdlineargs.cpp:1133 7747 #, kde-format 7748 msgid "Show %1 specific options" 7749 msgstr "%1 специфик параметрларын күрсәтү" 7750 7751 #: kdecore/kcmdlineargs.cpp:1140 7752 #, kde-format 7753 msgid "Show all options" 7754 msgstr "Бөтен параметрларны күрсәтү" 7755 7756 #: kdecore/kcmdlineargs.cpp:1141 7757 #, kde-format 7758 msgid "Show author information" 7759 msgstr "Автор турында мәгълүматны күрсәтү" 7760 7761 #: kdecore/kcmdlineargs.cpp:1142 7762 #, kde-format 7763 msgid "Show version information" 7764 msgstr "Юрама турында мәгълүматны күрсәтү" 7765 7766 #: kdecore/kcmdlineargs.cpp:1143 7767 #, kde-format 7768 msgid "Show license information" 7769 msgstr "Лицензия турында мәгълүматны күрсәтү" 7770 7771 #: kdecore/kcmdlineargs.cpp:1144 7772 #, kde-format 7773 msgid "End of options" 7774 msgstr "Параметрлар ахыры" 7775 7776 #: kdecore/kcmdlineargs.cpp:1164 7777 #, kde-format 7778 msgid "" 7779 "\n" 7780 "%1 options:\n" 7781 msgstr "" 7782 "\n" 7783 "%1 көйләве:\n" 7784 7785 #: kdecore/kcmdlineargs.cpp:1166 7786 #, kde-format 7787 msgid "" 7788 "\n" 7789 "Options:\n" 7790 msgstr "" 7791 "\n" 7792 "Параметрлар:\n" 7793 7794 #: kdecore/kcmdlineargs.cpp:1219 7795 #, kde-format 7796 msgid "" 7797 "\n" 7798 "Arguments:\n" 7799 msgstr "" 7800 "\n" 7801 "&Аргументлар:\n" 7802 7803 #: kdecore/kcmdlineargs.cpp:1580 7804 #, kde-format 7805 msgid "The files/URLs opened by the application will be deleted after use" 7806 msgstr "Кушымтада ачылган бар файллар яки URL кулланудан соң бетереләчәк" 7807 7808 #: kdecore/kcmdlineargs.cpp:1581 7809 #, kde-format 7810 msgid "KDE-tempfile" 7811 msgstr "KDE-tempfile" 7812 7813 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7814 #: kdecore/kdatetime.cpp:2985 7815 #, kde-format 7816 msgid "am" 7817 msgstr "am" 7818 7819 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7820 #: kdecore/kdatetime.cpp:2990 7821 #, kde-format 7822 msgid "pm" 7823 msgstr "pm" 7824 7825 #: kdecore/klibloader.cpp:100 7826 #, kde-format 7827 msgid "Library \"%1\" not found" 7828 msgstr "«%1» китапханәсе табылмады" 7829 7830 #: kdecore/klocale_kde.cpp:785 7831 #, kde-format 7832 msgctxt "digit set" 7833 msgid "Arabic-Indic" 7834 msgstr "Гарәп илләрдә кулланучы гарәп саны" 7835 7836 #: kdecore/klocale_kde.cpp:788 7837 #, kde-format 7838 msgctxt "digit set" 7839 msgid "Bengali" 7840 msgstr "Бенгаль" 7841 7842 #: kdecore/klocale_kde.cpp:791 7843 #, kde-format 7844 msgctxt "digit set" 7845 msgid "Devanagari" 7846 msgstr "Деванагари" 7847 7848 #: kdecore/klocale_kde.cpp:794 7849 #, kde-format 7850 msgctxt "digit set" 7851 msgid "Eastern Arabic-Indic" 7852 msgstr "Фарсы" 7853 7854 #: kdecore/klocale_kde.cpp:797 7855 #, kde-format 7856 msgctxt "digit set" 7857 msgid "Gujarati" 7858 msgstr "Гөҗәрәти" 7859 7860 #: kdecore/klocale_kde.cpp:800 7861 #, kde-format 7862 msgctxt "digit set" 7863 msgid "Gurmukhi" 7864 msgstr "Гурмуки" 7865 7866 #: kdecore/klocale_kde.cpp:803 7867 #, kde-format 7868 msgctxt "digit set" 7869 msgid "Kannada" 7870 msgstr "Каннада" 7871 7872 #: kdecore/klocale_kde.cpp:806 7873 #, kde-format 7874 msgctxt "digit set" 7875 msgid "Khmer" 7876 msgstr "Кхмер" 7877 7878 #: kdecore/klocale_kde.cpp:809 7879 #, kde-format 7880 msgctxt "digit set" 7881 msgid "Malayalam" 7882 msgstr "Малаялам" 7883 7884 #: kdecore/klocale_kde.cpp:812 7885 #, kde-format 7886 msgctxt "digit set" 7887 msgid "Oriya" 7888 msgstr "Ория" 7889 7890 #: kdecore/klocale_kde.cpp:815 7891 #, kde-format 7892 msgctxt "digit set" 7893 msgid "Tamil" 7894 msgstr "Тамиль" 7895 7896 #: kdecore/klocale_kde.cpp:818 7897 #, kde-format 7898 msgctxt "digit set" 7899 msgid "Telugu" 7900 msgstr "Телугу" 7901 7902 #: kdecore/klocale_kde.cpp:821 7903 #, kde-format 7904 msgctxt "digit set" 7905 msgid "Thai" 7906 msgstr "Тай" 7907 7908 #: kdecore/klocale_kde.cpp:824 7909 #, kde-format 7910 msgctxt "digit set" 7911 msgid "Arabic" 7912 msgstr "Гарәп" 7913 7914 #: kdecore/klocale_kde.cpp:829 7915 #, kde-format 7916 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 7917 msgid "%1 (%2)" 7918 msgstr "%1 (%2)" 7919 7920 #. i18n: comments below, they are used by the 7921 #. translators. 7922 #. This prefix is shared by all current dialects. 7923 #. i18n: Dumb message, avoid any markup or scripting. 7924 #: kdecore/klocale_kde.cpp:1327 7925 #, kde-format 7926 msgctxt "size in bytes" 7927 msgid "%1 B" 7928 msgstr "%1 Б" 7929 7930 #. i18n: Dumb message, avoid any markup or scripting. 7931 #: kdecore/klocale_kde.cpp:1332 7932 #, kde-format 7933 msgctxt "size in 1000 bytes" 7934 msgid "%1 kB" 7935 msgstr "%1 кБ" 7936 7937 #. i18n: Dumb message, avoid any markup or scripting. 7938 #: kdecore/klocale_kde.cpp:1334 7939 #, kde-format 7940 msgctxt "size in 10^6 bytes" 7941 msgid "%1 MB" 7942 msgstr "%1 МБ" 7943 7944 #. i18n: Dumb message, avoid any markup or scripting. 7945 #: kdecore/klocale_kde.cpp:1336 7946 #, kde-format 7947 msgctxt "size in 10^9 bytes" 7948 msgid "%1 GB" 7949 msgstr "%1 ГБ" 7950 7951 #. i18n: Dumb message, avoid any markup or scripting. 7952 #: kdecore/klocale_kde.cpp:1338 7953 #, kde-format 7954 msgctxt "size in 10^12 bytes" 7955 msgid "%1 TB" 7956 msgstr "%1 ТБ" 7957 7958 #. i18n: Dumb message, avoid any markup or scripting. 7959 #: kdecore/klocale_kde.cpp:1340 7960 #, kde-format 7961 msgctxt "size in 10^15 bytes" 7962 msgid "%1 PB" 7963 msgstr "%1 ПБ" 7964 7965 #. i18n: Dumb message, avoid any markup or scripting. 7966 #: kdecore/klocale_kde.cpp:1342 7967 #, kde-format 7968 msgctxt "size in 10^18 bytes" 7969 msgid "%1 EB" 7970 msgstr "%1 ЭБ" 7971 7972 #. i18n: Dumb message, avoid any markup or scripting. 7973 #: kdecore/klocale_kde.cpp:1344 7974 #, kde-format 7975 msgctxt "size in 10^21 bytes" 7976 msgid "%1 ZB" 7977 msgstr "%1 ЗБ" 7978 7979 #. i18n: Dumb message, avoid any markup or scripting. 7980 #: kdecore/klocale_kde.cpp:1346 7981 #, kde-format 7982 msgctxt "size in 10^24 bytes" 7983 msgid "%1 YB" 7984 msgstr "%1 ЙБ" 7985 7986 #. i18n: Dumb message, avoid any markup or scripting. 7987 #: kdecore/klocale_kde.cpp:1351 7988 #, kde-format 7989 msgctxt "memory size in 1024 bytes" 7990 msgid "%1 KB" 7991 msgstr "%1 КБ" 7992 7993 #. i18n: Dumb message, avoid any markup or scripting. 7994 #: kdecore/klocale_kde.cpp:1353 7995 #, kde-format 7996 msgctxt "memory size in 2^20 bytes" 7997 msgid "%1 MB" 7998 msgstr "%1 МБ" 7999 8000 #. i18n: Dumb message, avoid any markup or scripting. 8001 #: kdecore/klocale_kde.cpp:1355 8002 #, kde-format 8003 msgctxt "memory size in 2^30 bytes" 8004 msgid "%1 GB" 8005 msgstr "%1 ГБ" 8006 8007 #. i18n: Dumb message, avoid any markup or scripting. 8008 #: kdecore/klocale_kde.cpp:1357 8009 #, kde-format 8010 msgctxt "memory size in 2^40 bytes" 8011 msgid "%1 TB" 8012 msgstr "%1 ТБ" 8013 8014 #. i18n: Dumb message, avoid any markup or scripting. 8015 #: kdecore/klocale_kde.cpp:1359 8016 #, kde-format 8017 msgctxt "memory size in 2^50 bytes" 8018 msgid "%1 PB" 8019 msgstr "%1 ПБ" 8020 8021 #. i18n: Dumb message, avoid any markup or scripting. 8022 #: kdecore/klocale_kde.cpp:1361 8023 #, kde-format 8024 msgctxt "memory size in 2^60 bytes" 8025 msgid "%1 EB" 8026 msgstr "%1 ЭБ" 8027 8028 #. i18n: Dumb message, avoid any markup or scripting. 8029 #: kdecore/klocale_kde.cpp:1363 8030 #, kde-format 8031 msgctxt "memory size in 2^70 bytes" 8032 msgid "%1 ZB" 8033 msgstr "%1 ЗБ" 8034 8035 #. i18n: Dumb message, avoid any markup or scripting. 8036 #: kdecore/klocale_kde.cpp:1365 8037 #, kde-format 8038 msgctxt "memory size in 2^80 bytes" 8039 msgid "%1 YB" 8040 msgstr "%1 ЙБ" 8041 8042 #. i18n: Dumb message, avoid any markup or scripting. 8043 #: kdecore/klocale_kde.cpp:1371 8044 #, kde-format 8045 msgctxt "size in 1024 bytes" 8046 msgid "%1 KiB" 8047 msgstr "%1 КиБ" 8048 8049 #. i18n: Dumb message, avoid any markup or scripting. 8050 #: kdecore/klocale_kde.cpp:1373 8051 #, kde-format 8052 msgctxt "size in 2^20 bytes" 8053 msgid "%1 MiB" 8054 msgstr "%1 МиБ" 8055 8056 #. i18n: Dumb message, avoid any markup or scripting. 8057 #: kdecore/klocale_kde.cpp:1375 8058 #, kde-format 8059 msgctxt "size in 2^30 bytes" 8060 msgid "%1 GiB" 8061 msgstr "%1 ГиБ" 8062 8063 #. i18n: Dumb message, avoid any markup or scripting. 8064 #: kdecore/klocale_kde.cpp:1377 8065 #, kde-format 8066 msgctxt "size in 2^40 bytes" 8067 msgid "%1 TiB" 8068 msgstr "%1 ТиБ" 8069 8070 #. i18n: Dumb message, avoid any markup or scripting. 8071 #: kdecore/klocale_kde.cpp:1379 8072 #, kde-format 8073 msgctxt "size in 2^50 bytes" 8074 msgid "%1 PiB" 8075 msgstr "%1 ПиБ" 8076 8077 #. i18n: Dumb message, avoid any markup or scripting. 8078 #: kdecore/klocale_kde.cpp:1381 8079 #, kde-format 8080 msgctxt "size in 2^60 bytes" 8081 msgid "%1 EiB" 8082 msgstr "%1 ЭиБ" 8083 8084 #. i18n: Dumb message, avoid any markup or scripting. 8085 #: kdecore/klocale_kde.cpp:1383 8086 #, kde-format 8087 msgctxt "size in 2^70 bytes" 8088 msgid "%1 ZiB" 8089 msgstr "%1 ЗиБ" 8090 8091 #. i18n: Dumb message, avoid any markup or scripting. 8092 #: kdecore/klocale_kde.cpp:1385 8093 #, kde-format 8094 msgctxt "size in 2^80 bytes" 8095 msgid "%1 YiB" 8096 msgstr "%1 ЙиБ" 8097 8098 #: kdecore/klocale_kde.cpp:1472 8099 #, kde-format 8100 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8101 msgid "%1 days" 8102 msgstr "%1 көн" 8103 8104 #: kdecore/klocale_kde.cpp:1475 8105 #, kde-format 8106 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8107 msgid "%1 hours" 8108 msgstr "%1 сәгать" 8109 8110 #: kdecore/klocale_kde.cpp:1478 8111 #, kde-format 8112 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8113 msgid "%1 minutes" 8114 msgstr "%1 минут" 8115 8116 #: kdecore/klocale_kde.cpp:1481 8117 #, kde-format 8118 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8119 msgid "%1 seconds" 8120 msgstr "%1 секунд" 8121 8122 #: kdecore/klocale_kde.cpp:1484 8123 #, kde-format 8124 msgctxt "@item:intext" 8125 msgid "%1 millisecond" 8126 msgid_plural "%1 milliseconds" 8127 msgstr[0] "%1 миллисекунд" 8128 msgstr[1] "%1 миллисекунд" 8129 8130 #: kdecore/klocale_kde.cpp:1491 8131 #, kde-format 8132 msgctxt "@item:intext" 8133 msgid "1 day" 8134 msgid_plural "%1 days" 8135 msgstr[0] "1 көн" 8136 msgstr[1] "%1 көн" 8137 8138 #: kdecore/klocale_kde.cpp:1493 8139 #, kde-format 8140 msgctxt "@item:intext" 8141 msgid "1 hour" 8142 msgid_plural "%1 hours" 8143 msgstr[0] "1 сәгать" 8144 msgstr[1] "%1 сәгать" 8145 8146 #: kdecore/klocale_kde.cpp:1495 8147 #, kde-format 8148 msgctxt "@item:intext" 8149 msgid "1 minute" 8150 msgid_plural "%1 minutes" 8151 msgstr[0] "1 минут" 8152 msgstr[1] "%1 минут" 8153 8154 #: kdecore/klocale_kde.cpp:1497 8155 #, kde-format 8156 msgctxt "@item:intext" 8157 msgid "1 second" 8158 msgid_plural "%1 seconds" 8159 msgstr[0] "1 секунд" 8160 msgstr[1] "%1 секунд" 8161 8162 #: kdecore/klocale_kde.cpp:1521 8163 #, kde-format 8164 msgctxt "" 8165 "@item:intext days and hours. This uses the previous item:intext messages. If " 8166 "this does not fit the grammar of your language please contact the i18n team " 8167 "to solve the problem" 8168 msgid "%1 and %2" 8169 msgstr "%1 %2" 8170 8171 #: kdecore/klocale_kde.cpp:1527 8172 #, kde-format 8173 msgctxt "" 8174 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8175 "If this does not fit the grammar of your language please contact the i18n " 8176 "team to solve the problem" 8177 msgid "%1 and %2" 8178 msgstr "%1 %2" 8179 8180 #: kdecore/klocale_kde.cpp:1534 8181 #, kde-format 8182 msgctxt "" 8183 "@item:intext minutes and seconds. This uses the previous item:intext " 8184 "messages. If this does not fit the grammar of your language please contact " 8185 "the i18n team to solve the problem" 8186 msgid "%1 and %2" 8187 msgstr "%1 %2" 8188 8189 #: kdecore/klocale_kde.cpp:2153 8190 #, kde-format 8191 msgctxt "Before Noon KLocale::LongName" 8192 msgid "Ante Meridiem" 8193 msgstr "Төшкә кадәр" 8194 8195 #: kdecore/klocale_kde.cpp:2154 8196 #, kde-format 8197 msgctxt "Before Noon KLocale::ShortName" 8198 msgid "AM" 8199 msgstr "ТК" 8200 8201 #: kdecore/klocale_kde.cpp:2155 8202 #, kde-format 8203 msgctxt "Before Noon KLocale::NarrowName" 8204 msgid "A" 8205 msgstr "К" 8206 8207 #: kdecore/klocale_kde.cpp:2158 8208 #, kde-format 8209 msgctxt "After Noon KLocale::LongName" 8210 msgid "Post Meridiem" 8211 msgstr "Төштән соң" 8212 8213 #: kdecore/klocale_kde.cpp:2159 8214 #, kde-format 8215 msgctxt "After Noon KLocale::ShortName" 8216 msgid "PM" 8217 msgstr "ТС" 8218 8219 #: kdecore/klocale_kde.cpp:2160 8220 #, kde-format 8221 msgctxt "After Noon KLocale::NarrowName" 8222 msgid "P" 8223 msgstr "С" 8224 8225 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8226 #, kde-format 8227 msgctxt "concatenation of dates and time" 8228 msgid "%1 %2" 8229 msgstr "%1 %2" 8230 8231 #: kdecore/klocale_kde.cpp:2267 8232 #, kde-format 8233 msgctxt "concatenation of date/time and time zone" 8234 msgid "%1 %2" 8235 msgstr "%1 %2" 8236 8237 #: kdecore/ksavefile.cpp:99 8238 #, kde-format 8239 msgid "No target filename has been given." 8240 msgstr "Максатлы файл күрсәтелмәгән." 8241 8242 #: kdecore/ksavefile.cpp:106 8243 #, kde-format 8244 msgid "Already opened." 8245 msgstr "Файл инде ачылган." 8246 8247 #: kdecore/ksavefile.cpp:135 8248 #, kde-format 8249 msgid "Insufficient permissions in target directory." 8250 msgstr "Максатлы каталогка язу рөхсәте юк." 8251 8252 #: kdecore/ksavefile.cpp:139 8253 #, fuzzy, kde-format 8254 #| msgid "Unable to open temporary file." 8255 msgid "Unable to open temporary file." 8256 msgstr "Вакытлы файлны ачып булмады." 8257 8258 #: kdecore/ksavefile.cpp:249 8259 #, kde-format 8260 msgid "Synchronization to disk failed" 8261 msgstr "Дискка сихронизлаштырылган вакытта хата килеп чыкты" 8262 8263 #: kdecore/ksavefile.cpp:280 8264 #, kde-format 8265 msgid "Error during rename." 8266 msgstr "Исемне узгәрткәндә хата киелп чыкты." 8267 8268 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8269 #, kde-format 8270 msgid "Timed out trying to connect to remote host" 8271 msgstr "Ерактагы үзәктән җавапны көтү вакыты үтте" 8272 8273 #: kdecore/netsupp.cpp:866 8274 #, kde-format 8275 msgid "address family for nodename not supported" 8276 msgstr "бу nodename өчен адреслар гаиләлеге туры килми" 8277 8278 #: kdecore/netsupp.cpp:868 8279 #, kde-format 8280 msgid "invalid value for 'ai_flags'" 8281 msgstr "«ai_flags» өчен дөрес булмаган мәгънә" 8282 8283 #: kdecore/netsupp.cpp:870 8284 #, kde-format 8285 msgid "'ai_family' not supported" 8286 msgstr "«ai_family» гаиләләге тотылмый" 8287 8288 #: kdecore/netsupp.cpp:872 8289 #, kde-format 8290 msgid "no address associated with nodename" 8291 msgstr "бу үзәк белән (nodename) бер адрес та бәйләнмәгән" 8292 8293 #: kdecore/netsupp.cpp:874 8294 #, kde-format 8295 msgid "servname not supported for ai_socktype" 8296 msgstr "ai_socktype төренең servname тотылмый" 8297 8298 #: kdecore/netsupp.cpp:875 8299 #, kde-format 8300 msgid "'ai_socktype' not supported" 8301 msgstr "«ai_socktype» төре тотылмый" 8302 8303 #: kdecore/netsupp.cpp:876 8304 #, kde-format 8305 msgid "system error" 8306 msgstr "системалы хата" 8307 8308 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8309 #, kde-format 8310 msgid "KDE Test Program" 8311 msgstr "Тестовая программа KDE" 8312 8313 #: kdecore/TIMEZONES:1 8314 #, kde-format 8315 msgid "Africa/Abidjan" 8316 msgstr "" 8317 8318 #: kdecore/TIMEZONES:2 8319 #, kde-format 8320 msgid "Africa/Accra" 8321 msgstr "" 8322 8323 #: kdecore/TIMEZONES:3 8324 #, kde-format 8325 msgid "Africa/Addis_Ababa" 8326 msgstr "" 8327 8328 #: kdecore/TIMEZONES:4 8329 #, kde-format 8330 msgid "Africa/Algiers" 8331 msgstr "" 8332 8333 #: kdecore/TIMEZONES:5 8334 #, kde-format 8335 msgid "Africa/Asmara" 8336 msgstr "" 8337 8338 #: kdecore/TIMEZONES:6 8339 #, kde-format 8340 msgid "Africa/Asmera" 8341 msgstr "" 8342 8343 #: kdecore/TIMEZONES:7 8344 #, kde-format 8345 msgid "Africa/Bamako" 8346 msgstr "" 8347 8348 #: kdecore/TIMEZONES:8 8349 #, kde-format 8350 msgid "Africa/Bangui" 8351 msgstr "" 8352 8353 #: kdecore/TIMEZONES:9 8354 #, kde-format 8355 msgid "Africa/Banjul" 8356 msgstr "" 8357 8358 #: kdecore/TIMEZONES:10 8359 #, kde-format 8360 msgid "Africa/Bissau" 8361 msgstr "" 8362 8363 #: kdecore/TIMEZONES:11 8364 #, kde-format 8365 msgid "Africa/Blantyre" 8366 msgstr "" 8367 8368 #: kdecore/TIMEZONES:12 8369 #, kde-format 8370 msgid "Africa/Brazzaville" 8371 msgstr "" 8372 8373 #: kdecore/TIMEZONES:13 8374 #, kde-format 8375 msgid "Africa/Bujumbura" 8376 msgstr "" 8377 8378 #: kdecore/TIMEZONES:14 8379 #, kde-format 8380 msgid "Africa/Cairo" 8381 msgstr "" 8382 8383 #: kdecore/TIMEZONES:15 8384 #, kde-format 8385 msgid "Africa/Casablanca" 8386 msgstr "" 8387 8388 #: kdecore/TIMEZONES:16 8389 #, kde-format 8390 msgid "Africa/Ceuta" 8391 msgstr "" 8392 8393 #. i18n: comment to the previous timezone 8394 #: kdecore/TIMEZONES:18 8395 #, kde-format 8396 msgid "Ceuta & Melilla" 8397 msgstr "" 8398 8399 #. i18n: comment to the previous timezone 8400 #: kdecore/TIMEZONES:20 8401 #, kde-format 8402 msgid "Ceuta, Melilla" 8403 msgstr "" 8404 8405 #: kdecore/TIMEZONES:21 8406 #, kde-format 8407 msgid "Africa/Conakry" 8408 msgstr "" 8409 8410 #: kdecore/TIMEZONES:22 8411 #, kde-format 8412 msgid "Africa/Dakar" 8413 msgstr "" 8414 8415 #: kdecore/TIMEZONES:23 8416 #, kde-format 8417 msgid "Africa/Dar_es_Salaam" 8418 msgstr "" 8419 8420 #: kdecore/TIMEZONES:24 8421 #, kde-format 8422 msgid "Africa/Djibouti" 8423 msgstr "" 8424 8425 #: kdecore/TIMEZONES:25 8426 #, kde-format 8427 msgid "Africa/Douala" 8428 msgstr "" 8429 8430 #: kdecore/TIMEZONES:26 8431 #, kde-format 8432 msgid "Africa/El_Aaiun" 8433 msgstr "" 8434 8435 #: kdecore/TIMEZONES:27 8436 #, kde-format 8437 msgid "Africa/Freetown" 8438 msgstr "" 8439 8440 #: kdecore/TIMEZONES:28 8441 #, kde-format 8442 msgid "Africa/Gaborone" 8443 msgstr "" 8444 8445 #: kdecore/TIMEZONES:29 8446 #, kde-format 8447 msgid "Africa/Harare" 8448 msgstr "" 8449 8450 #: kdecore/TIMEZONES:30 8451 #, kde-format 8452 msgid "Africa/Johannesburg" 8453 msgstr "" 8454 8455 #: kdecore/TIMEZONES:31 8456 #, kde-format 8457 msgid "Africa/Juba" 8458 msgstr "" 8459 8460 #: kdecore/TIMEZONES:32 8461 #, kde-format 8462 msgid "Africa/Kampala" 8463 msgstr "" 8464 8465 #: kdecore/TIMEZONES:33 8466 #, kde-format 8467 msgid "Africa/Khartoum" 8468 msgstr "" 8469 8470 #: kdecore/TIMEZONES:34 8471 #, kde-format 8472 msgid "Africa/Kigali" 8473 msgstr "" 8474 8475 #: kdecore/TIMEZONES:35 8476 #, kde-format 8477 msgid "Africa/Kinshasa" 8478 msgstr "" 8479 8480 #. i18n: comment to the previous timezone 8481 #: kdecore/TIMEZONES:37 8482 #, kde-format 8483 msgid "west Dem. Rep. of Congo" 8484 msgstr "" 8485 8486 #. i18n: comment to the previous timezone 8487 #: kdecore/TIMEZONES:39 8488 #, kde-format 8489 msgid "Dem. Rep. of Congo (west)" 8490 msgstr "" 8491 8492 #: kdecore/TIMEZONES:40 8493 #, kde-format 8494 msgid "Africa/Lagos" 8495 msgstr "" 8496 8497 #: kdecore/TIMEZONES:41 8498 #, kde-format 8499 msgid "Africa/Libreville" 8500 msgstr "" 8501 8502 #: kdecore/TIMEZONES:42 8503 #, kde-format 8504 msgid "Africa/Lome" 8505 msgstr "" 8506 8507 #: kdecore/TIMEZONES:43 8508 #, kde-format 8509 msgid "Africa/Luanda" 8510 msgstr "" 8511 8512 #: kdecore/TIMEZONES:44 8513 #, kde-format 8514 msgid "Africa/Lubumbashi" 8515 msgstr "" 8516 8517 #. i18n: comment to the previous timezone 8518 #: kdecore/TIMEZONES:46 8519 #, kde-format 8520 msgid "east Dem. Rep. of Congo" 8521 msgstr "" 8522 8523 #. i18n: comment to the previous timezone 8524 #: kdecore/TIMEZONES:48 8525 #, kde-format 8526 msgid "Dem. Rep. of Congo (east)" 8527 msgstr "" 8528 8529 #: kdecore/TIMEZONES:49 8530 #, kde-format 8531 msgid "Africa/Lusaka" 8532 msgstr "" 8533 8534 #: kdecore/TIMEZONES:50 8535 #, kde-format 8536 msgid "Africa/Malabo" 8537 msgstr "" 8538 8539 #: kdecore/TIMEZONES:51 8540 #, kde-format 8541 msgid "Africa/Maputo" 8542 msgstr "" 8543 8544 #: kdecore/TIMEZONES:52 8545 #, kde-format 8546 msgid "Africa/Maseru" 8547 msgstr "" 8548 8549 #: kdecore/TIMEZONES:53 8550 #, kde-format 8551 msgid "Africa/Mbabane" 8552 msgstr "" 8553 8554 #: kdecore/TIMEZONES:54 8555 #, kde-format 8556 msgid "Africa/Mogadishu" 8557 msgstr "" 8558 8559 #: kdecore/TIMEZONES:55 8560 #, kde-format 8561 msgid "Africa/Monrovia" 8562 msgstr "" 8563 8564 #: kdecore/TIMEZONES:56 8565 #, kde-format 8566 msgid "Africa/Nairobi" 8567 msgstr "" 8568 8569 #: kdecore/TIMEZONES:57 8570 #, kde-format 8571 msgid "Africa/Ndjamena" 8572 msgstr "" 8573 8574 #: kdecore/TIMEZONES:58 8575 #, kde-format 8576 msgid "Africa/Niamey" 8577 msgstr "" 8578 8579 #: kdecore/TIMEZONES:59 8580 #, kde-format 8581 msgid "Africa/Nouakchott" 8582 msgstr "" 8583 8584 #: kdecore/TIMEZONES:60 8585 #, kde-format 8586 msgid "Africa/Ouagadougou" 8587 msgstr "" 8588 8589 #: kdecore/TIMEZONES:61 8590 #, kde-format 8591 msgid "Africa/Porto-Novo" 8592 msgstr "" 8593 8594 #: kdecore/TIMEZONES:62 8595 #, kde-format 8596 msgid "Africa/Pretoria" 8597 msgstr "" 8598 8599 #: kdecore/TIMEZONES:63 8600 #, kde-format 8601 msgid "Africa/Sao_Tome" 8602 msgstr "" 8603 8604 #: kdecore/TIMEZONES:64 8605 #, kde-format 8606 msgid "Africa/Timbuktu" 8607 msgstr "" 8608 8609 #: kdecore/TIMEZONES:65 8610 #, fuzzy, kde-format 8611 #| msgctxt "KCharSelect section name" 8612 #| msgid "African Scripts" 8613 msgid "Africa/Tripoli" 8614 msgstr "Африка" 8615 8616 #: kdecore/TIMEZONES:66 8617 #, fuzzy, kde-format 8618 #| msgctxt "KCharSelect section name" 8619 #| msgid "African Scripts" 8620 msgid "Africa/Tunis" 8621 msgstr "Африка" 8622 8623 #: kdecore/TIMEZONES:67 8624 #, kde-format 8625 msgid "Africa/Windhoek" 8626 msgstr "" 8627 8628 #: kdecore/TIMEZONES:68 8629 #, kde-format 8630 msgid "America/Adak" 8631 msgstr "" 8632 8633 #. i18n: comment to the previous timezone 8634 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8635 #, kde-format 8636 msgid "Aleutian Islands" 8637 msgstr "" 8638 8639 #: kdecore/TIMEZONES:71 8640 #, kde-format 8641 msgid "America/Anchorage" 8642 msgstr "" 8643 8644 #. i18n: comment to the previous timezone 8645 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8646 #, kde-format 8647 msgid "Alaska Time" 8648 msgstr "" 8649 8650 #. i18n: comment to the previous timezone 8651 #: kdecore/TIMEZONES:75 8652 #, kde-format 8653 msgid "Alaska (most areas)" 8654 msgstr "" 8655 8656 #: kdecore/TIMEZONES:76 8657 #, kde-format 8658 msgid "America/Anguilla" 8659 msgstr "" 8660 8661 #: kdecore/TIMEZONES:77 8662 #, kde-format 8663 msgid "America/Antigua" 8664 msgstr "" 8665 8666 #: kdecore/TIMEZONES:78 8667 #, kde-format 8668 msgid "America/Araguaina" 8669 msgstr "" 8670 8671 #. i18n: comment to the previous timezone 8672 #: kdecore/TIMEZONES:80 8673 #, kde-format 8674 msgid "Tocantins" 8675 msgstr "" 8676 8677 #: kdecore/TIMEZONES:81 8678 #, kde-format 8679 msgid "America/Argentina/Buenos_Aires" 8680 msgstr "" 8681 8682 #. i18n: comment to the previous timezone 8683 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8684 #, kde-format 8685 msgid "Buenos Aires (BA, CF)" 8686 msgstr "" 8687 8688 #: kdecore/TIMEZONES:84 8689 #, kde-format 8690 msgid "America/Argentina/Catamarca" 8691 msgstr "" 8692 8693 #. i18n: comment to the previous timezone 8694 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8695 #, kde-format 8696 msgid "Catamarca (CT), Chubut (CH)" 8697 msgstr "" 8698 8699 #. i18n: comment to the previous timezone 8700 #: kdecore/TIMEZONES:88 8701 #, kde-format 8702 msgid "Catamarca (CT); Chubut (CH)" 8703 msgstr "" 8704 8705 #: kdecore/TIMEZONES:89 8706 #, kde-format 8707 msgid "America/Argentina/ComodRivadavia" 8708 msgstr "" 8709 8710 #: kdecore/TIMEZONES:92 8711 #, kde-format 8712 msgid "America/Argentina/Cordoba" 8713 msgstr "" 8714 8715 #. i18n: comment to the previous timezone 8716 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8717 #, kde-format 8718 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8719 msgstr "" 8720 8721 #. i18n: comment to the previous timezone 8722 #: kdecore/TIMEZONES:96 8723 #, kde-format 8724 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8725 msgstr "" 8726 8727 #. i18n: comment to the previous timezone 8728 #: kdecore/TIMEZONES:98 8729 #, kde-format 8730 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8731 msgstr "" 8732 8733 #: kdecore/TIMEZONES:99 8734 #, kde-format 8735 msgid "America/Argentina/Jujuy" 8736 msgstr "" 8737 8738 #. i18n: comment to the previous timezone 8739 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8740 #, kde-format 8741 msgid "Jujuy (JY)" 8742 msgstr "" 8743 8744 #: kdecore/TIMEZONES:102 8745 #, kde-format 8746 msgid "America/Argentina/La_Rioja" 8747 msgstr "" 8748 8749 #. i18n: comment to the previous timezone 8750 #: kdecore/TIMEZONES:104 8751 #, kde-format 8752 msgid "La Rioja (LR)" 8753 msgstr "" 8754 8755 #: kdecore/TIMEZONES:105 8756 #, kde-format 8757 msgid "America/Argentina/Mendoza" 8758 msgstr "" 8759 8760 #. i18n: comment to the previous timezone 8761 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8762 #, kde-format 8763 msgid "Mendoza (MZ)" 8764 msgstr "" 8765 8766 #: kdecore/TIMEZONES:108 8767 #, kde-format 8768 msgid "America/Argentina/Rio_Gallegos" 8769 msgstr "" 8770 8771 #. i18n: comment to the previous timezone 8772 #: kdecore/TIMEZONES:110 8773 #, kde-format 8774 msgid "Santa Cruz (SC)" 8775 msgstr "" 8776 8777 #: kdecore/TIMEZONES:111 8778 #, kde-format 8779 msgid "America/Argentina/Salta" 8780 msgstr "" 8781 8782 #. i18n: comment to the previous timezone 8783 #: kdecore/TIMEZONES:113 8784 #, kde-format 8785 msgid "(SA, LP, NQ, RN)" 8786 msgstr "" 8787 8788 #. i18n: comment to the previous timezone 8789 #: kdecore/TIMEZONES:115 8790 #, kde-format 8791 msgid "Salta (SA, LP, NQ, RN)" 8792 msgstr "" 8793 8794 #: kdecore/TIMEZONES:116 8795 #, kde-format 8796 msgid "America/Argentina/San_Juan" 8797 msgstr "" 8798 8799 #. i18n: comment to the previous timezone 8800 #: kdecore/TIMEZONES:118 8801 #, kde-format 8802 msgid "San Juan (SJ)" 8803 msgstr "" 8804 8805 #: kdecore/TIMEZONES:119 8806 #, kde-format 8807 msgid "America/Argentina/San_Luis" 8808 msgstr "" 8809 8810 #. i18n: comment to the previous timezone 8811 #: kdecore/TIMEZONES:121 8812 #, kde-format 8813 msgid "San Luis (SL)" 8814 msgstr "" 8815 8816 #: kdecore/TIMEZONES:122 8817 #, kde-format 8818 msgid "America/Argentina/Tucuman" 8819 msgstr "" 8820 8821 #. i18n: comment to the previous timezone 8822 #: kdecore/TIMEZONES:124 8823 #, kde-format 8824 msgid "Tucuman (TM)" 8825 msgstr "" 8826 8827 #: kdecore/TIMEZONES:125 8828 #, kde-format 8829 msgid "America/Argentina/Ushuaia" 8830 msgstr "" 8831 8832 #. i18n: comment to the previous timezone 8833 #: kdecore/TIMEZONES:127 8834 #, kde-format 8835 msgid "Tierra del Fuego (TF)" 8836 msgstr "" 8837 8838 #: kdecore/TIMEZONES:128 8839 #, kde-format 8840 msgid "America/Aruba" 8841 msgstr "" 8842 8843 #: kdecore/TIMEZONES:129 8844 #, kde-format 8845 msgid "America/Asuncion" 8846 msgstr "" 8847 8848 #: kdecore/TIMEZONES:130 8849 #, kde-format 8850 msgid "America/Atikokan" 8851 msgstr "" 8852 8853 #. i18n: comment to the previous timezone 8854 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8855 #, kde-format 8856 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8857 msgstr "" 8858 8859 #. i18n: comment to the previous timezone 8860 #: kdecore/TIMEZONES:134 8861 #, kde-format 8862 msgid "EST - ON (Atikokan); NU (Coral H)" 8863 msgstr "" 8864 8865 #: kdecore/TIMEZONES:135 8866 #, kde-format 8867 msgid "America/Atka" 8868 msgstr "" 8869 8870 #: kdecore/TIMEZONES:138 8871 #, kde-format 8872 msgid "America/Bahia" 8873 msgstr "" 8874 8875 #. i18n: comment to the previous timezone 8876 #: kdecore/TIMEZONES:140 8877 #, kde-format 8878 msgid "Bahia" 8879 msgstr "" 8880 8881 #: kdecore/TIMEZONES:141 8882 #, kde-format 8883 msgid "America/Bahia_Banderas" 8884 msgstr "" 8885 8886 #. i18n: comment to the previous timezone 8887 #: kdecore/TIMEZONES:143 8888 #, kde-format 8889 msgid "Mexican Central Time - Bahia de Banderas" 8890 msgstr "" 8891 8892 #. i18n: comment to the previous timezone 8893 #: kdecore/TIMEZONES:145 8894 #, kde-format 8895 msgid "Central Time - Bahia de Banderas" 8896 msgstr "" 8897 8898 #: kdecore/TIMEZONES:146 8899 #, kde-format 8900 msgid "America/Barbados" 8901 msgstr "" 8902 8903 #: kdecore/TIMEZONES:147 8904 #, kde-format 8905 msgid "America/Belem" 8906 msgstr "" 8907 8908 #. i18n: comment to the previous timezone 8909 #: kdecore/TIMEZONES:149 8910 #, kde-format 8911 msgid "Amapa, E Para" 8912 msgstr "" 8913 8914 #. i18n: comment to the previous timezone 8915 #: kdecore/TIMEZONES:151 8916 #, kde-format 8917 msgid "Para (east); Amapa" 8918 msgstr "" 8919 8920 #: kdecore/TIMEZONES:152 8921 #, kde-format 8922 msgid "America/Belize" 8923 msgstr "" 8924 8925 #: kdecore/TIMEZONES:153 8926 #, kde-format 8927 msgid "America/Blanc-Sablon" 8928 msgstr "" 8929 8930 #. i18n: comment to the previous timezone 8931 #: kdecore/TIMEZONES:155 8932 #, kde-format 8933 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 8934 msgstr "" 8935 8936 #. i18n: comment to the previous timezone 8937 #: kdecore/TIMEZONES:157 8938 #, kde-format 8939 msgid "AST - QC (Lower North Shore)" 8940 msgstr "" 8941 8942 #: kdecore/TIMEZONES:158 8943 #, kde-format 8944 msgid "America/Boa_Vista" 8945 msgstr "" 8946 8947 #. i18n: comment to the previous timezone 8948 #: kdecore/TIMEZONES:160 8949 #, kde-format 8950 msgid "Roraima" 8951 msgstr "" 8952 8953 #: kdecore/TIMEZONES:161 8954 #, kde-format 8955 msgid "America/Bogota" 8956 msgstr "" 8957 8958 #: kdecore/TIMEZONES:162 8959 #, kde-format 8960 msgid "America/Boise" 8961 msgstr "" 8962 8963 #. i18n: comment to the previous timezone 8964 #: kdecore/TIMEZONES:164 8965 #, kde-format 8966 msgid "Mountain Time - south Idaho & east Oregon" 8967 msgstr "" 8968 8969 #. i18n: comment to the previous timezone 8970 #: kdecore/TIMEZONES:166 8971 #, kde-format 8972 msgid "Mountain - ID (south); OR (east)" 8973 msgstr "" 8974 8975 #: kdecore/TIMEZONES:167 8976 #, kde-format 8977 msgid "America/Buenos_Aires" 8978 msgstr "" 8979 8980 #: kdecore/TIMEZONES:170 8981 #, kde-format 8982 msgid "America/Calgary" 8983 msgstr "" 8984 8985 #. i18n: comment to the previous timezone 8986 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 8987 #, kde-format 8988 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 8989 msgstr "" 8990 8991 #: kdecore/TIMEZONES:173 8992 #, kde-format 8993 msgid "America/Cambridge_Bay" 8994 msgstr "" 8995 8996 #. i18n: comment to the previous timezone 8997 #: kdecore/TIMEZONES:175 8998 #, kde-format 8999 msgid "Mountain Time - west Nunavut" 9000 msgstr "" 9001 9002 #. i18n: comment to the previous timezone 9003 #: kdecore/TIMEZONES:177 9004 #, fuzzy, kde-format 9005 #| msgid "Maintainer" 9006 msgid "Mountain - NU (west)" 9007 msgstr "Алып баручы" 9008 9009 #: kdecore/TIMEZONES:178 9010 #, kde-format 9011 msgid "America/Campo_Grande" 9012 msgstr "" 9013 9014 #. i18n: comment to the previous timezone 9015 #: kdecore/TIMEZONES:180 9016 #, kde-format 9017 msgid "Mato Grosso do Sul" 9018 msgstr "" 9019 9020 #: kdecore/TIMEZONES:181 9021 #, kde-format 9022 msgid "America/Cancun" 9023 msgstr "" 9024 9025 #. i18n: comment to the previous timezone 9026 #: kdecore/TIMEZONES:183 9027 #, kde-format 9028 msgid "Central Time - Quintana Roo" 9029 msgstr "" 9030 9031 #. i18n: comment to the previous timezone 9032 #: kdecore/TIMEZONES:185 9033 #, kde-format 9034 msgid "Eastern Standard Time - Quintana Roo" 9035 msgstr "" 9036 9037 #: kdecore/TIMEZONES:186 9038 #, kde-format 9039 msgid "America/Caracas" 9040 msgstr "" 9041 9042 #: kdecore/TIMEZONES:187 9043 #, kde-format 9044 msgid "America/Catamarca" 9045 msgstr "" 9046 9047 #: kdecore/TIMEZONES:190 9048 #, kde-format 9049 msgid "America/Cayenne" 9050 msgstr "" 9051 9052 #: kdecore/TIMEZONES:191 9053 #, kde-format 9054 msgid "America/Cayman" 9055 msgstr "" 9056 9057 #: kdecore/TIMEZONES:192 9058 #, kde-format 9059 msgid "America/Chicago" 9060 msgstr "" 9061 9062 #. i18n: comment to the previous timezone 9063 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9064 #, fuzzy, kde-format 9065 #| msgctxt "@item Text character set" 9066 #| msgid "Central European" 9067 msgid "Central Time" 9068 msgstr "Үзәк Аурупа" 9069 9070 #. i18n: comment to the previous timezone 9071 #: kdecore/TIMEZONES:196 9072 #, fuzzy, kde-format 9073 #| msgctxt "@item Text character set" 9074 #| msgid "Central European" 9075 msgid "Central (most areas)" 9076 msgstr "Үзәк Аурупа" 9077 9078 #: kdecore/TIMEZONES:197 9079 #, kde-format 9080 msgid "America/Chihuahua" 9081 msgstr "" 9082 9083 #. i18n: comment to the previous timezone 9084 #: kdecore/TIMEZONES:199 9085 #, kde-format 9086 msgid "Mountain Time - Chihuahua" 9087 msgstr "" 9088 9089 #. i18n: comment to the previous timezone 9090 #: kdecore/TIMEZONES:201 9091 #, kde-format 9092 msgid "Mexican Mountain Time - Chihuahua away from US border" 9093 msgstr "" 9094 9095 #. i18n: comment to the previous timezone 9096 #: kdecore/TIMEZONES:203 9097 #, kde-format 9098 msgid "Mountain Time - Chihuahua (most areas)" 9099 msgstr "" 9100 9101 #: kdecore/TIMEZONES:204 9102 #, kde-format 9103 msgid "America/Coral_Harbour" 9104 msgstr "" 9105 9106 #: kdecore/TIMEZONES:207 9107 #, kde-format 9108 msgid "America/Cordoba" 9109 msgstr "" 9110 9111 #: kdecore/TIMEZONES:210 9112 #, kde-format 9113 msgid "America/Costa_Rica" 9114 msgstr "" 9115 9116 #: kdecore/TIMEZONES:211 9117 #, kde-format 9118 msgid "America/Creston" 9119 msgstr "" 9120 9121 #. i18n: comment to the previous timezone 9122 #: kdecore/TIMEZONES:213 9123 #, kde-format 9124 msgid "Mountain Standard Time - Creston, British Columbia" 9125 msgstr "" 9126 9127 #. i18n: comment to the previous timezone 9128 #: kdecore/TIMEZONES:215 9129 #, kde-format 9130 msgid "MST - BC (Creston)" 9131 msgstr "" 9132 9133 #: kdecore/TIMEZONES:216 9134 #, kde-format 9135 msgid "America/Cuiaba" 9136 msgstr "" 9137 9138 #. i18n: comment to the previous timezone 9139 #: kdecore/TIMEZONES:218 9140 #, kde-format 9141 msgid "Mato Grosso" 9142 msgstr "" 9143 9144 #: kdecore/TIMEZONES:219 9145 #, kde-format 9146 msgid "America/Curacao" 9147 msgstr "" 9148 9149 #: kdecore/TIMEZONES:220 9150 #, kde-format 9151 msgid "America/Danmarkshavn" 9152 msgstr "" 9153 9154 #. i18n: comment to the previous timezone 9155 #: kdecore/TIMEZONES:222 9156 #, kde-format 9157 msgid "east coast, north of Scoresbysund" 9158 msgstr "" 9159 9160 #. i18n: comment to the previous timezone 9161 #: kdecore/TIMEZONES:224 9162 #, kde-format 9163 msgid "National Park (east coast)" 9164 msgstr "" 9165 9166 #: kdecore/TIMEZONES:225 9167 #, kde-format 9168 msgid "America/Dawson" 9169 msgstr "" 9170 9171 #. i18n: comment to the previous timezone 9172 #: kdecore/TIMEZONES:227 9173 #, kde-format 9174 msgid "Pacific Time - north Yukon" 9175 msgstr "" 9176 9177 #. i18n: comment to the previous timezone 9178 #: kdecore/TIMEZONES:229 9179 #, kde-format 9180 msgid "MST - Yukon (west)" 9181 msgstr "" 9182 9183 #: kdecore/TIMEZONES:230 9184 #, kde-format 9185 msgid "America/Dawson_Creek" 9186 msgstr "" 9187 9188 #. i18n: comment to the previous timezone 9189 #: kdecore/TIMEZONES:232 9190 #, kde-format 9191 msgid "" 9192 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9193 msgstr "" 9194 9195 #. i18n: comment to the previous timezone 9196 #: kdecore/TIMEZONES:234 9197 #, kde-format 9198 msgid "MST - BC (Dawson Cr, Ft St John)" 9199 msgstr "" 9200 9201 #: kdecore/TIMEZONES:235 9202 #, kde-format 9203 msgid "America/Denver" 9204 msgstr "" 9205 9206 #. i18n: comment to the previous timezone 9207 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9208 #, fuzzy, kde-format 9209 #| msgid "Maintainer" 9210 msgid "Mountain Time" 9211 msgstr "Алып баручы" 9212 9213 #. i18n: comment to the previous timezone 9214 #: kdecore/TIMEZONES:239 9215 #, fuzzy, kde-format 9216 #| msgid "Maintainer" 9217 msgid "Mountain (most areas)" 9218 msgstr "Алып баручы" 9219 9220 #: kdecore/TIMEZONES:240 9221 #, kde-format 9222 msgid "America/Detroit" 9223 msgstr "" 9224 9225 #. i18n: comment to the previous timezone 9226 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9227 #, kde-format 9228 msgid "Eastern Time - Michigan - most locations" 9229 msgstr "" 9230 9231 #. i18n: comment to the previous timezone 9232 #: kdecore/TIMEZONES:244 9233 #, kde-format 9234 msgid "Eastern - MI (most areas)" 9235 msgstr "" 9236 9237 #: kdecore/TIMEZONES:245 9238 #, kde-format 9239 msgid "America/Dominica" 9240 msgstr "" 9241 9242 #: kdecore/TIMEZONES:246 9243 #, kde-format 9244 msgid "America/Edmonton" 9245 msgstr "" 9246 9247 #. i18n: comment to the previous timezone 9248 #: kdecore/TIMEZONES:250 9249 #, kde-format 9250 msgid "Mountain - AB; BC (E); SK (W)" 9251 msgstr "" 9252 9253 #: kdecore/TIMEZONES:251 9254 #, kde-format 9255 msgid "America/Eirunepe" 9256 msgstr "" 9257 9258 #. i18n: comment to the previous timezone 9259 #: kdecore/TIMEZONES:253 9260 #, kde-format 9261 msgid "W Amazonas" 9262 msgstr "" 9263 9264 #. i18n: comment to the previous timezone 9265 #: kdecore/TIMEZONES:255 9266 #, kde-format 9267 msgid "Amazonas (west)" 9268 msgstr "" 9269 9270 #: kdecore/TIMEZONES:256 9271 #, kde-format 9272 msgid "America/El_Salvador" 9273 msgstr "" 9274 9275 #: kdecore/TIMEZONES:257 9276 #, kde-format 9277 msgid "America/Ensenada" 9278 msgstr "" 9279 9280 #. i18n: comment to the previous timezone 9281 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9282 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9283 #, fuzzy, kde-format 9284 #| msgid "Specific Time" 9285 msgid "Pacific Time" 9286 msgstr "Билгеләнгән вакытта" 9287 9288 #: kdecore/TIMEZONES:260 9289 #, kde-format 9290 msgid "America/Fort_Nelson" 9291 msgstr "" 9292 9293 #. i18n: comment to the previous timezone 9294 #: kdecore/TIMEZONES:262 9295 #, kde-format 9296 msgid "MST - BC (Ft Nelson)" 9297 msgstr "" 9298 9299 #: kdecore/TIMEZONES:263 9300 #, kde-format 9301 msgid "America/Fort_Wayne" 9302 msgstr "" 9303 9304 #. i18n: comment to the previous timezone 9305 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9306 #: kdecore/TIMEZONES:1419 9307 #, kde-format 9308 msgid "Eastern Time - Indiana - most locations" 9309 msgstr "" 9310 9311 #: kdecore/TIMEZONES:266 9312 #, kde-format 9313 msgid "America/Fortaleza" 9314 msgstr "" 9315 9316 #. i18n: comment to the previous timezone 9317 #: kdecore/TIMEZONES:268 9318 #, kde-format 9319 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9320 msgstr "" 9321 9322 #. i18n: comment to the previous timezone 9323 #: kdecore/TIMEZONES:270 9324 #, kde-format 9325 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9326 msgstr "" 9327 9328 #: kdecore/TIMEZONES:271 9329 #, kde-format 9330 msgid "America/Fredericton" 9331 msgstr "" 9332 9333 #. i18n: comment to the previous timezone 9334 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9335 #, kde-format 9336 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9337 msgstr "" 9338 9339 #: kdecore/TIMEZONES:274 9340 #, kde-format 9341 msgid "America/Glace_Bay" 9342 msgstr "" 9343 9344 #. i18n: comment to the previous timezone 9345 #: kdecore/TIMEZONES:276 9346 #, kde-format 9347 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9348 msgstr "" 9349 9350 #. i18n: comment to the previous timezone 9351 #: kdecore/TIMEZONES:278 9352 #, kde-format 9353 msgid "Atlantic - NS (Cape Breton)" 9354 msgstr "" 9355 9356 #: kdecore/TIMEZONES:279 9357 #, kde-format 9358 msgid "America/Godthab" 9359 msgstr "" 9360 9361 #. i18n: comment to the previous timezone 9362 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9363 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9364 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9365 #: kdecore/TIMEZONES:1350 9366 #, fuzzy, kde-format 9367 #| msgctxt "@action" 9368 #| msgid "About Application" 9369 msgid "most locations" 9370 msgstr "Кушымта турында" 9371 9372 #: kdecore/TIMEZONES:282 9373 #, kde-format 9374 msgid "America/Goose_Bay" 9375 msgstr "" 9376 9377 #. i18n: comment to the previous timezone 9378 #: kdecore/TIMEZONES:284 9379 #, kde-format 9380 msgid "Atlantic Time - Labrador - most locations" 9381 msgstr "" 9382 9383 #. i18n: comment to the previous timezone 9384 #: kdecore/TIMEZONES:286 9385 #, kde-format 9386 msgid "Atlantic - Labrador (most areas)" 9387 msgstr "" 9388 9389 #: kdecore/TIMEZONES:287 9390 #, kde-format 9391 msgid "America/Grand_Turk" 9392 msgstr "" 9393 9394 #: kdecore/TIMEZONES:288 9395 #, kde-format 9396 msgid "America/Grenada" 9397 msgstr "" 9398 9399 #: kdecore/TIMEZONES:289 9400 #, kde-format 9401 msgid "America/Guadeloupe" 9402 msgstr "" 9403 9404 #: kdecore/TIMEZONES:290 9405 #, kde-format 9406 msgid "America/Guatemala" 9407 msgstr "" 9408 9409 #: kdecore/TIMEZONES:291 9410 #, kde-format 9411 msgid "America/Guayaquil" 9412 msgstr "" 9413 9414 #. i18n: comment to the previous timezone 9415 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9416 #: kdecore/TIMEZONES:1400 9417 #, kde-format 9418 msgid "mainland" 9419 msgstr "" 9420 9421 #. i18n: comment to the previous timezone 9422 #: kdecore/TIMEZONES:295 9423 #, kde-format 9424 msgid "Ecuador (mainland)" 9425 msgstr "" 9426 9427 #: kdecore/TIMEZONES:296 9428 #, kde-format 9429 msgid "America/Guyana" 9430 msgstr "" 9431 9432 #: kdecore/TIMEZONES:297 9433 #, kde-format 9434 msgid "America/Halifax" 9435 msgstr "" 9436 9437 #. i18n: comment to the previous timezone 9438 #: kdecore/TIMEZONES:301 9439 #, kde-format 9440 msgid "Atlantic - NS (most areas); PE" 9441 msgstr "" 9442 9443 #: kdecore/TIMEZONES:302 9444 #, kde-format 9445 msgid "America/Havana" 9446 msgstr "" 9447 9448 #: kdecore/TIMEZONES:303 9449 #, kde-format 9450 msgid "America/Hermosillo" 9451 msgstr "" 9452 9453 #. i18n: comment to the previous timezone 9454 #: kdecore/TIMEZONES:305 9455 #, kde-format 9456 msgid "Mountain Standard Time - Sonora" 9457 msgstr "" 9458 9459 #: kdecore/TIMEZONES:306 9460 #, kde-format 9461 msgid "America/Indiana/Indianapolis" 9462 msgstr "" 9463 9464 #. i18n: comment to the previous timezone 9465 #: kdecore/TIMEZONES:310 9466 #, kde-format 9467 msgid "Eastern - IN (most areas)" 9468 msgstr "" 9469 9470 #: kdecore/TIMEZONES:311 9471 #, kde-format 9472 msgid "America/Indiana/Knox" 9473 msgstr "" 9474 9475 #. i18n: comment to the previous timezone 9476 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9477 #, kde-format 9478 msgid "Eastern Time - Indiana - Starke County" 9479 msgstr "" 9480 9481 #. i18n: comment to the previous timezone 9482 #: kdecore/TIMEZONES:315 9483 #, kde-format 9484 msgid "Central Time - Indiana - Starke County" 9485 msgstr "" 9486 9487 #. i18n: comment to the previous timezone 9488 #: kdecore/TIMEZONES:317 9489 #, kde-format 9490 msgid "Central - IN (Starke)" 9491 msgstr "" 9492 9493 #: kdecore/TIMEZONES:318 9494 #, kde-format 9495 msgid "America/Indiana/Marengo" 9496 msgstr "" 9497 9498 #. i18n: comment to the previous timezone 9499 #: kdecore/TIMEZONES:320 9500 #, kde-format 9501 msgid "Eastern Time - Indiana - Crawford County" 9502 msgstr "" 9503 9504 #. i18n: comment to the previous timezone 9505 #: kdecore/TIMEZONES:322 9506 #, kde-format 9507 msgid "Eastern - IN (Crawford)" 9508 msgstr "" 9509 9510 #: kdecore/TIMEZONES:323 9511 #, kde-format 9512 msgid "America/Indiana/Petersburg" 9513 msgstr "" 9514 9515 #. i18n: comment to the previous timezone 9516 #: kdecore/TIMEZONES:325 9517 #, kde-format 9518 msgid "Central Time - Indiana - Pike County" 9519 msgstr "" 9520 9521 #. i18n: comment to the previous timezone 9522 #: kdecore/TIMEZONES:327 9523 #, kde-format 9524 msgid "Eastern Time - Indiana - Pike County" 9525 msgstr "" 9526 9527 #. i18n: comment to the previous timezone 9528 #: kdecore/TIMEZONES:329 9529 #, fuzzy, kde-format 9530 #| msgid "Date and Time: %1" 9531 msgid "Eastern - IN (Pike)" 9532 msgstr "Дата һәм вакыт: %1" 9533 9534 #: kdecore/TIMEZONES:330 9535 #, kde-format 9536 msgid "America/Indiana/Tell_City" 9537 msgstr "" 9538 9539 #. i18n: comment to the previous timezone 9540 #: kdecore/TIMEZONES:332 9541 #, kde-format 9542 msgid "Central Time - Indiana - Perry County" 9543 msgstr "" 9544 9545 #. i18n: comment to the previous timezone 9546 #: kdecore/TIMEZONES:334 9547 #, kde-format 9548 msgid "Central - IN (Perry)" 9549 msgstr "" 9550 9551 #: kdecore/TIMEZONES:335 9552 #, kde-format 9553 msgid "America/Indiana/Vevay" 9554 msgstr "" 9555 9556 #. i18n: comment to the previous timezone 9557 #: kdecore/TIMEZONES:337 9558 #, kde-format 9559 msgid "Eastern Time - Indiana - Switzerland County" 9560 msgstr "" 9561 9562 #. i18n: comment to the previous timezone 9563 #: kdecore/TIMEZONES:339 9564 #, kde-format 9565 msgid "Eastern - IN (Switzerland)" 9566 msgstr "" 9567 9568 #: kdecore/TIMEZONES:340 9569 #, kde-format 9570 msgid "America/Indiana/Vincennes" 9571 msgstr "" 9572 9573 #. i18n: comment to the previous timezone 9574 #: kdecore/TIMEZONES:342 9575 #, kde-format 9576 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9577 msgstr "" 9578 9579 #. i18n: comment to the previous timezone 9580 #: kdecore/TIMEZONES:344 9581 #, kde-format 9582 msgid "Eastern - IN (Da, Du, K, Mn)" 9583 msgstr "" 9584 9585 #: kdecore/TIMEZONES:345 9586 #, kde-format 9587 msgid "America/Indiana/Winamac" 9588 msgstr "" 9589 9590 #. i18n: comment to the previous timezone 9591 #: kdecore/TIMEZONES:347 9592 #, kde-format 9593 msgid "Eastern Time - Indiana - Pulaski County" 9594 msgstr "" 9595 9596 #. i18n: comment to the previous timezone 9597 #: kdecore/TIMEZONES:349 9598 #, kde-format 9599 msgid "Eastern - IN (Pulaski)" 9600 msgstr "" 9601 9602 #: kdecore/TIMEZONES:350 9603 #, kde-format 9604 msgid "America/Indianapolis" 9605 msgstr "" 9606 9607 #: kdecore/TIMEZONES:353 9608 #, kde-format 9609 msgid "America/Inuvik" 9610 msgstr "" 9611 9612 #. i18n: comment to the previous timezone 9613 #: kdecore/TIMEZONES:355 9614 #, kde-format 9615 msgid "Mountain Time - west Northwest Territories" 9616 msgstr "" 9617 9618 #. i18n: comment to the previous timezone 9619 #: kdecore/TIMEZONES:357 9620 #, fuzzy, kde-format 9621 #| msgid "Maintainer" 9622 msgid "Mountain - NT (west)" 9623 msgstr "Алып баручы" 9624 9625 #: kdecore/TIMEZONES:358 9626 #, kde-format 9627 msgid "America/Iqaluit" 9628 msgstr "" 9629 9630 #. i18n: comment to the previous timezone 9631 #: kdecore/TIMEZONES:360 9632 #, kde-format 9633 msgid "Eastern Time - east Nunavut - most locations" 9634 msgstr "" 9635 9636 #. i18n: comment to the previous timezone 9637 #: kdecore/TIMEZONES:362 9638 #, kde-format 9639 msgid "Eastern - NU (most east areas)" 9640 msgstr "" 9641 9642 #: kdecore/TIMEZONES:363 9643 #, kde-format 9644 msgid "America/Jamaica" 9645 msgstr "" 9646 9647 #: kdecore/TIMEZONES:364 9648 #, kde-format 9649 msgid "America/Jujuy" 9650 msgstr "" 9651 9652 #: kdecore/TIMEZONES:367 9653 #, kde-format 9654 msgid "America/Juneau" 9655 msgstr "" 9656 9657 #. i18n: comment to the previous timezone 9658 #: kdecore/TIMEZONES:369 9659 #, kde-format 9660 msgid "Alaska Time - Alaska panhandle" 9661 msgstr "" 9662 9663 #. i18n: comment to the previous timezone 9664 #: kdecore/TIMEZONES:371 9665 #, kde-format 9666 msgid "Alaska - Juneau area" 9667 msgstr "" 9668 9669 #: kdecore/TIMEZONES:372 9670 #, kde-format 9671 msgid "America/Kentucky/Louisville" 9672 msgstr "" 9673 9674 #. i18n: comment to the previous timezone 9675 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9676 #, kde-format 9677 msgid "Eastern Time - Kentucky - Louisville area" 9678 msgstr "" 9679 9680 #. i18n: comment to the previous timezone 9681 #: kdecore/TIMEZONES:376 9682 #, kde-format 9683 msgid "Eastern - KY (Louisville area)" 9684 msgstr "" 9685 9686 #: kdecore/TIMEZONES:377 9687 #, kde-format 9688 msgid "America/Kentucky/Monticello" 9689 msgstr "" 9690 9691 #. i18n: comment to the previous timezone 9692 #: kdecore/TIMEZONES:379 9693 #, kde-format 9694 msgid "Eastern Time - Kentucky - Wayne County" 9695 msgstr "" 9696 9697 #. i18n: comment to the previous timezone 9698 #: kdecore/TIMEZONES:381 9699 #, kde-format 9700 msgid "Eastern - KY (Wayne)" 9701 msgstr "" 9702 9703 #: kdecore/TIMEZONES:382 9704 #, kde-format 9705 msgid "America/Knox_IN" 9706 msgstr "" 9707 9708 #: kdecore/TIMEZONES:385 9709 #, kde-format 9710 msgid "America/Kralendijk" 9711 msgstr "" 9712 9713 #: kdecore/TIMEZONES:386 9714 #, kde-format 9715 msgid "America/La_Paz" 9716 msgstr "" 9717 9718 #: kdecore/TIMEZONES:387 9719 #, kde-format 9720 msgid "America/Lima" 9721 msgstr "" 9722 9723 #: kdecore/TIMEZONES:388 9724 #, kde-format 9725 msgid "America/Los_Angeles" 9726 msgstr "" 9727 9728 #. i18n: comment to the previous timezone 9729 #: kdecore/TIMEZONES:392 9730 #, fuzzy, kde-format 9731 #| msgid "Specific Time" 9732 msgid "Pacific" 9733 msgstr "Билгеләнгән вакытта" 9734 9735 #: kdecore/TIMEZONES:393 9736 #, kde-format 9737 msgid "America/Louisville" 9738 msgstr "" 9739 9740 #: kdecore/TIMEZONES:396 9741 #, kde-format 9742 msgid "America/Lower_Princes" 9743 msgstr "" 9744 9745 #: kdecore/TIMEZONES:397 9746 #, kde-format 9747 msgid "America/Maceio" 9748 msgstr "" 9749 9750 #. i18n: comment to the previous timezone 9751 #: kdecore/TIMEZONES:399 9752 #, kde-format 9753 msgid "Alagoas, Sergipe" 9754 msgstr "" 9755 9756 #: kdecore/TIMEZONES:400 9757 #, kde-format 9758 msgid "America/Managua" 9759 msgstr "" 9760 9761 #: kdecore/TIMEZONES:401 9762 #, kde-format 9763 msgid "America/Manaus" 9764 msgstr "" 9765 9766 #. i18n: comment to the previous timezone 9767 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9768 #, kde-format 9769 msgid "E Amazonas" 9770 msgstr "" 9771 9772 #. i18n: comment to the previous timezone 9773 #: kdecore/TIMEZONES:405 9774 #, kde-format 9775 msgid "Amazonas (east)" 9776 msgstr "" 9777 9778 #: kdecore/TIMEZONES:406 9779 #, kde-format 9780 msgid "America/Marigot" 9781 msgstr "" 9782 9783 #: kdecore/TIMEZONES:407 9784 #, kde-format 9785 msgid "America/Martinique" 9786 msgstr "" 9787 9788 #: kdecore/TIMEZONES:408 9789 #, kde-format 9790 msgid "America/Matamoros" 9791 msgstr "" 9792 9793 #. i18n: comment to the previous timezone 9794 #: kdecore/TIMEZONES:410 9795 #, kde-format 9796 msgid "" 9797 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9798 msgstr "" 9799 9800 #. i18n: comment to the previous timezone 9801 #: kdecore/TIMEZONES:412 9802 #, kde-format 9803 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9804 msgstr "" 9805 9806 #: kdecore/TIMEZONES:413 9807 #, kde-format 9808 msgid "America/Mazatlan" 9809 msgstr "" 9810 9811 #. i18n: comment to the previous timezone 9812 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9813 #, kde-format 9814 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9815 msgstr "" 9816 9817 #. i18n: comment to the previous timezone 9818 #: kdecore/TIMEZONES:417 9819 #, kde-format 9820 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9821 msgstr "" 9822 9823 #: kdecore/TIMEZONES:418 9824 #, kde-format 9825 msgid "America/Mendoza" 9826 msgstr "" 9827 9828 #: kdecore/TIMEZONES:421 9829 #, kde-format 9830 msgid "America/Menominee" 9831 msgstr "" 9832 9833 #. i18n: comment to the previous timezone 9834 #: kdecore/TIMEZONES:423 9835 #, kde-format 9836 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9837 msgstr "" 9838 9839 #. i18n: comment to the previous timezone 9840 #: kdecore/TIMEZONES:425 9841 #, kde-format 9842 msgid "Central - MI (Wisconsin border)" 9843 msgstr "" 9844 9845 #: kdecore/TIMEZONES:426 9846 #, kde-format 9847 msgid "America/Merida" 9848 msgstr "" 9849 9850 #. i18n: comment to the previous timezone 9851 #: kdecore/TIMEZONES:428 9852 #, kde-format 9853 msgid "Central Time - Campeche, Yucatan" 9854 msgstr "" 9855 9856 #: kdecore/TIMEZONES:429 9857 #, kde-format 9858 msgid "America/Metlakatla" 9859 msgstr "" 9860 9861 #. i18n: comment to the previous timezone 9862 #: kdecore/TIMEZONES:431 9863 #, kde-format 9864 msgid "Metlakatla Time - Annette Island" 9865 msgstr "" 9866 9867 #. i18n: comment to the previous timezone 9868 #: kdecore/TIMEZONES:433 9869 #, kde-format 9870 msgid "Alaska - Annette Island" 9871 msgstr "" 9872 9873 #: kdecore/TIMEZONES:434 9874 #, kde-format 9875 msgid "America/Mexico_City" 9876 msgstr "" 9877 9878 #. i18n: comment to the previous timezone 9879 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9880 #, kde-format 9881 msgid "Central Time - most locations" 9882 msgstr "" 9883 9884 #: kdecore/TIMEZONES:439 9885 #, kde-format 9886 msgid "America/Miquelon" 9887 msgstr "" 9888 9889 #: kdecore/TIMEZONES:440 9890 #, kde-format 9891 msgid "America/Moncton" 9892 msgstr "" 9893 9894 #. i18n: comment to the previous timezone 9895 #: kdecore/TIMEZONES:442 9896 #, kde-format 9897 msgid "Atlantic Time - New Brunswick" 9898 msgstr "" 9899 9900 #. i18n: comment to the previous timezone 9901 #: kdecore/TIMEZONES:444 9902 #, kde-format 9903 msgid "Atlantic - New Brunswick" 9904 msgstr "" 9905 9906 #: kdecore/TIMEZONES:445 9907 #, kde-format 9908 msgid "America/Monterrey" 9909 msgstr "" 9910 9911 #. i18n: comment to the previous timezone 9912 #: kdecore/TIMEZONES:447 9913 #, kde-format 9914 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 9915 msgstr "" 9916 9917 #. i18n: comment to the previous timezone 9918 #: kdecore/TIMEZONES:449 9919 #, kde-format 9920 msgid "" 9921 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 9922 "US border" 9923 msgstr "" 9924 9925 #. i18n: comment to the previous timezone 9926 #: kdecore/TIMEZONES:451 9927 #, kde-format 9928 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 9929 msgstr "" 9930 9931 #: kdecore/TIMEZONES:452 9932 #, kde-format 9933 msgid "America/Montevideo" 9934 msgstr "" 9935 9936 #: kdecore/TIMEZONES:453 9937 #, kde-format 9938 msgid "America/Montreal" 9939 msgstr "" 9940 9941 #. i18n: comment to the previous timezone 9942 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 9943 #, kde-format 9944 msgid "Eastern Time - Quebec - most locations" 9945 msgstr "" 9946 9947 #: kdecore/TIMEZONES:456 9948 #, kde-format 9949 msgid "America/Montserrat" 9950 msgstr "" 9951 9952 #: kdecore/TIMEZONES:457 9953 #, kde-format 9954 msgid "America/Nassau" 9955 msgstr "" 9956 9957 #: kdecore/TIMEZONES:458 9958 #, kde-format 9959 msgid "America/New_York" 9960 msgstr "" 9961 9962 #. i18n: comment to the previous timezone 9963 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 9964 #, fuzzy, kde-format 9965 #| msgid "Date and Time: %1" 9966 msgid "Eastern Time" 9967 msgstr "Дата һәм вакыт: %1" 9968 9969 #. i18n: comment to the previous timezone 9970 #: kdecore/TIMEZONES:462 9971 #, fuzzy, kde-format 9972 #| msgid "Date and Time: %1" 9973 msgid "Eastern (most areas)" 9974 msgstr "Дата һәм вакыт: %1" 9975 9976 #: kdecore/TIMEZONES:463 9977 #, kde-format 9978 msgid "America/Nipigon" 9979 msgstr "" 9980 9981 #. i18n: comment to the previous timezone 9982 #: kdecore/TIMEZONES:465 9983 #, kde-format 9984 msgid "" 9985 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 9986 msgstr "" 9987 9988 #. i18n: comment to the previous timezone 9989 #: kdecore/TIMEZONES:467 9990 #, kde-format 9991 msgid "Eastern - ON, QC (no DST 1967-73)" 9992 msgstr "" 9993 9994 #: kdecore/TIMEZONES:468 9995 #, kde-format 9996 msgid "America/Nome" 9997 msgstr "" 9998 9999 #. i18n: comment to the previous timezone 10000 #: kdecore/TIMEZONES:470 10001 #, kde-format 10002 msgid "Alaska Time - west Alaska" 10003 msgstr "" 10004 10005 #. i18n: comment to the previous timezone 10006 #: kdecore/TIMEZONES:472 10007 #, kde-format 10008 msgid "Alaska (west)" 10009 msgstr "" 10010 10011 #: kdecore/TIMEZONES:473 10012 #, kde-format 10013 msgid "America/Noronha" 10014 msgstr "" 10015 10016 #. i18n: comment to the previous timezone 10017 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10018 #, kde-format 10019 msgid "Atlantic islands" 10020 msgstr "" 10021 10022 #: kdecore/TIMEZONES:476 10023 #, kde-format 10024 msgid "America/North_Dakota/Beulah" 10025 msgstr "" 10026 10027 #. i18n: comment to the previous timezone 10028 #: kdecore/TIMEZONES:478 10029 #, kde-format 10030 msgid "Central Time - North Dakota - Mercer County" 10031 msgstr "" 10032 10033 #. i18n: comment to the previous timezone 10034 #: kdecore/TIMEZONES:480 10035 #, kde-format 10036 msgid "Central - ND (Mercer)" 10037 msgstr "" 10038 10039 #: kdecore/TIMEZONES:481 10040 #, kde-format 10041 msgid "America/North_Dakota/Center" 10042 msgstr "" 10043 10044 #. i18n: comment to the previous timezone 10045 #: kdecore/TIMEZONES:483 10046 #, kde-format 10047 msgid "Central Time - North Dakota - Oliver County" 10048 msgstr "" 10049 10050 #. i18n: comment to the previous timezone 10051 #: kdecore/TIMEZONES:485 10052 #, fuzzy, kde-format 10053 #| msgctxt "@item Text character set" 10054 #| msgid "Central European" 10055 msgid "Central - ND (Oliver)" 10056 msgstr "Үзәк Аурупа" 10057 10058 #: kdecore/TIMEZONES:486 10059 #, kde-format 10060 msgid "America/North_Dakota/New_Salem" 10061 msgstr "" 10062 10063 #. i18n: comment to the previous timezone 10064 #: kdecore/TIMEZONES:488 10065 #, kde-format 10066 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10067 msgstr "" 10068 10069 #. i18n: comment to the previous timezone 10070 #: kdecore/TIMEZONES:490 10071 #, kde-format 10072 msgid "Central - ND (Morton rural)" 10073 msgstr "" 10074 10075 #: kdecore/TIMEZONES:491 10076 #, kde-format 10077 msgid "America/Nuuk" 10078 msgstr "" 10079 10080 #. i18n: comment to the previous timezone 10081 #: kdecore/TIMEZONES:493 10082 #, kde-format 10083 msgid "Greenland (most areas)" 10084 msgstr "" 10085 10086 #: kdecore/TIMEZONES:494 10087 #, kde-format 10088 msgid "America/Ojinaga" 10089 msgstr "" 10090 10091 #. i18n: comment to the previous timezone 10092 #: kdecore/TIMEZONES:496 10093 #, kde-format 10094 msgid "US Mountain Time - Chihuahua near US border" 10095 msgstr "" 10096 10097 #. i18n: comment to the previous timezone 10098 #: kdecore/TIMEZONES:498 10099 #, kde-format 10100 msgid "Mountain Time US - Chihuahua (US border)" 10101 msgstr "" 10102 10103 #: kdecore/TIMEZONES:499 10104 #, kde-format 10105 msgid "America/Ontario" 10106 msgstr "" 10107 10108 #: kdecore/TIMEZONES:502 10109 #, kde-format 10110 msgid "America/Panama" 10111 msgstr "" 10112 10113 #: kdecore/TIMEZONES:503 10114 #, kde-format 10115 msgid "America/Pangnirtung" 10116 msgstr "" 10117 10118 #. i18n: comment to the previous timezone 10119 #: kdecore/TIMEZONES:505 10120 #, kde-format 10121 msgid "Eastern Time - Pangnirtung, Nunavut" 10122 msgstr "" 10123 10124 #. i18n: comment to the previous timezone 10125 #: kdecore/TIMEZONES:507 10126 #, kde-format 10127 msgid "Eastern - NU (Pangnirtung)" 10128 msgstr "" 10129 10130 #: kdecore/TIMEZONES:508 10131 #, kde-format 10132 msgid "America/Paramaribo" 10133 msgstr "" 10134 10135 #: kdecore/TIMEZONES:509 10136 #, kde-format 10137 msgid "America/Phoenix" 10138 msgstr "" 10139 10140 #. i18n: comment to the previous timezone 10141 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10142 #, kde-format 10143 msgid "Mountain Standard Time - Arizona" 10144 msgstr "" 10145 10146 #. i18n: comment to the previous timezone 10147 #: kdecore/TIMEZONES:513 10148 #, kde-format 10149 msgid "MST - Arizona (except Navajo)" 10150 msgstr "" 10151 10152 #: kdecore/TIMEZONES:514 10153 #, kde-format 10154 msgid "America/Port-au-Prince" 10155 msgstr "" 10156 10157 #: kdecore/TIMEZONES:515 10158 #, kde-format 10159 msgid "America/Port_of_Spain" 10160 msgstr "" 10161 10162 #: kdecore/TIMEZONES:516 10163 #, kde-format 10164 msgid "America/Porto_Acre" 10165 msgstr "" 10166 10167 #. i18n: comment to the previous timezone 10168 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10169 #, kde-format 10170 msgid "Acre" 10171 msgstr "" 10172 10173 #: kdecore/TIMEZONES:519 10174 #, kde-format 10175 msgid "America/Porto_Velho" 10176 msgstr "" 10177 10178 #. i18n: comment to the previous timezone 10179 #: kdecore/TIMEZONES:521 10180 #, kde-format 10181 msgid "Rondonia" 10182 msgstr "" 10183 10184 #: kdecore/TIMEZONES:522 10185 #, kde-format 10186 msgid "America/Puerto_Rico" 10187 msgstr "" 10188 10189 #: kdecore/TIMEZONES:523 10190 #, kde-format 10191 msgid "America/Punta_Arenas" 10192 msgstr "" 10193 10194 #. i18n: comment to the previous timezone 10195 #: kdecore/TIMEZONES:525 10196 #, fuzzy, kde-format 10197 #| msgid "Select Region of Image" 10198 msgid "Region of Magallanes" 10199 msgstr "Сурәт өлкәсен сайлау" 10200 10201 #: kdecore/TIMEZONES:526 10202 #, kde-format 10203 msgid "America/Rainy_River" 10204 msgstr "" 10205 10206 #. i18n: comment to the previous timezone 10207 #: kdecore/TIMEZONES:528 10208 #, kde-format 10209 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10210 msgstr "" 10211 10212 #. i18n: comment to the previous timezone 10213 #: kdecore/TIMEZONES:530 10214 #, kde-format 10215 msgid "Central - ON (Rainy R, Ft Frances)" 10216 msgstr "" 10217 10218 #: kdecore/TIMEZONES:531 10219 #, kde-format 10220 msgid "America/Rankin_Inlet" 10221 msgstr "" 10222 10223 #. i18n: comment to the previous timezone 10224 #: kdecore/TIMEZONES:533 10225 #, kde-format 10226 msgid "Central Time - central Nunavut" 10227 msgstr "" 10228 10229 #. i18n: comment to the previous timezone 10230 #: kdecore/TIMEZONES:535 10231 #, kde-format 10232 msgid "Central - NU (central)" 10233 msgstr "" 10234 10235 #: kdecore/TIMEZONES:536 10236 #, kde-format 10237 msgid "America/Recife" 10238 msgstr "" 10239 10240 #. i18n: comment to the previous timezone 10241 #: kdecore/TIMEZONES:538 10242 #, kde-format 10243 msgid "Pernambuco" 10244 msgstr "" 10245 10246 #: kdecore/TIMEZONES:539 10247 #, kde-format 10248 msgid "America/Regina" 10249 msgstr "" 10250 10251 #. i18n: comment to the previous timezone 10252 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10253 #: kdecore/TIMEZONES:1123 10254 #, kde-format 10255 msgid "Central Standard Time - Saskatchewan - most locations" 10256 msgstr "" 10257 10258 #. i18n: comment to the previous timezone 10259 #: kdecore/TIMEZONES:543 10260 #, kde-format 10261 msgid "CST - SK (most areas)" 10262 msgstr "" 10263 10264 #: kdecore/TIMEZONES:544 10265 #, kde-format 10266 msgid "America/Resolute" 10267 msgstr "" 10268 10269 #. i18n: comment to the previous timezone 10270 #: kdecore/TIMEZONES:546 10271 #, kde-format 10272 msgid "Eastern Time - Resolute, Nunavut" 10273 msgstr "" 10274 10275 #. i18n: comment to the previous timezone 10276 #: kdecore/TIMEZONES:548 10277 #, kde-format 10278 msgid "Central Standard Time - Resolute, Nunavut" 10279 msgstr "" 10280 10281 #. i18n: comment to the previous timezone 10282 #: kdecore/TIMEZONES:550 10283 #, kde-format 10284 msgid "Central - NU (Resolute)" 10285 msgstr "" 10286 10287 #: kdecore/TIMEZONES:551 10288 #, kde-format 10289 msgid "America/Rio_Branco" 10290 msgstr "" 10291 10292 #: kdecore/TIMEZONES:554 10293 #, kde-format 10294 msgid "America/Rosario" 10295 msgstr "" 10296 10297 #: kdecore/TIMEZONES:557 10298 #, kde-format 10299 msgid "America/Santa_Isabel" 10300 msgstr "" 10301 10302 #. i18n: comment to the previous timezone 10303 #: kdecore/TIMEZONES:559 10304 #, kde-format 10305 msgid "Mexican Pacific Time - Baja California away from US border" 10306 msgstr "" 10307 10308 #: kdecore/TIMEZONES:560 10309 #, kde-format 10310 msgid "America/Santarem" 10311 msgstr "" 10312 10313 #. i18n: comment to the previous timezone 10314 #: kdecore/TIMEZONES:562 10315 #, kde-format 10316 msgid "W Para" 10317 msgstr "" 10318 10319 #. i18n: comment to the previous timezone 10320 #: kdecore/TIMEZONES:564 10321 #, fuzzy, kde-format 10322 #| msgid "Parameter" 10323 msgid "Para (west)" 10324 msgstr "Көйләү" 10325 10326 #: kdecore/TIMEZONES:565 10327 #, kde-format 10328 msgid "America/Santiago" 10329 msgstr "" 10330 10331 #. i18n: comment to the previous timezone 10332 #: kdecore/TIMEZONES:569 10333 #, kde-format 10334 msgid "Chile (most areas)" 10335 msgstr "" 10336 10337 #: kdecore/TIMEZONES:570 10338 #, kde-format 10339 msgid "America/Santo_Domingo" 10340 msgstr "" 10341 10342 #: kdecore/TIMEZONES:571 10343 #, kde-format 10344 msgid "America/Sao_Paulo" 10345 msgstr "" 10346 10347 #. i18n: comment to the previous timezone 10348 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10349 #, kde-format 10350 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10351 msgstr "" 10352 10353 #. i18n: comment to the previous timezone 10354 #: kdecore/TIMEZONES:575 10355 #, kde-format 10356 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10357 msgstr "" 10358 10359 #: kdecore/TIMEZONES:576 10360 #, kde-format 10361 msgid "America/Saskatoon" 10362 msgstr "" 10363 10364 #: kdecore/TIMEZONES:579 10365 #, kde-format 10366 msgid "America/Scoresbysund" 10367 msgstr "" 10368 10369 #. i18n: comment to the previous timezone 10370 #: kdecore/TIMEZONES:581 10371 #, kde-format 10372 msgid "Scoresbysund / Ittoqqortoormiit" 10373 msgstr "" 10374 10375 #. i18n: comment to the previous timezone 10376 #: kdecore/TIMEZONES:583 10377 #, kde-format 10378 msgid "Scoresbysund/Ittoqqortoormiit" 10379 msgstr "" 10380 10381 #: kdecore/TIMEZONES:584 10382 #, kde-format 10383 msgid "America/Shiprock" 10384 msgstr "" 10385 10386 #. i18n: comment to the previous timezone 10387 #: kdecore/TIMEZONES:586 10388 #, kde-format 10389 msgid "Mountain Time - Navajo" 10390 msgstr "" 10391 10392 #: kdecore/TIMEZONES:587 10393 #, kde-format 10394 msgid "America/Sitka" 10395 msgstr "" 10396 10397 #. i18n: comment to the previous timezone 10398 #: kdecore/TIMEZONES:589 10399 #, kde-format 10400 msgid "Alaska Time - southeast Alaska panhandle" 10401 msgstr "" 10402 10403 #. i18n: comment to the previous timezone 10404 #: kdecore/TIMEZONES:591 10405 #, kde-format 10406 msgid "Alaska - Sitka area" 10407 msgstr "" 10408 10409 #: kdecore/TIMEZONES:592 10410 #, kde-format 10411 msgid "America/St_Barthelemy" 10412 msgstr "" 10413 10414 #: kdecore/TIMEZONES:593 10415 #, kde-format 10416 msgid "America/St_Johns" 10417 msgstr "" 10418 10419 #. i18n: comment to the previous timezone 10420 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10421 #, kde-format 10422 msgid "Newfoundland Time, including SE Labrador" 10423 msgstr "" 10424 10425 #. i18n: comment to the previous timezone 10426 #: kdecore/TIMEZONES:597 10427 #, kde-format 10428 msgid "Newfoundland; Labrador (southeast)" 10429 msgstr "" 10430 10431 #: kdecore/TIMEZONES:598 10432 #, kde-format 10433 msgid "America/St_Kitts" 10434 msgstr "" 10435 10436 #: kdecore/TIMEZONES:599 10437 #, kde-format 10438 msgid "America/St_Lucia" 10439 msgstr "" 10440 10441 #: kdecore/TIMEZONES:600 10442 #, kde-format 10443 msgid "America/St_Thomas" 10444 msgstr "" 10445 10446 #: kdecore/TIMEZONES:601 10447 #, kde-format 10448 msgid "America/St_Vincent" 10449 msgstr "" 10450 10451 #: kdecore/TIMEZONES:602 10452 #, kde-format 10453 msgid "America/Swift_Current" 10454 msgstr "" 10455 10456 #. i18n: comment to the previous timezone 10457 #: kdecore/TIMEZONES:604 10458 #, kde-format 10459 msgid "Central Standard Time - Saskatchewan - midwest" 10460 msgstr "" 10461 10462 #. i18n: comment to the previous timezone 10463 #: kdecore/TIMEZONES:606 10464 #, kde-format 10465 msgid "CST - SK (midwest)" 10466 msgstr "" 10467 10468 #: kdecore/TIMEZONES:607 10469 #, kde-format 10470 msgid "America/Tegucigalpa" 10471 msgstr "" 10472 10473 #: kdecore/TIMEZONES:608 10474 #, kde-format 10475 msgid "America/Thule" 10476 msgstr "" 10477 10478 #. i18n: comment to the previous timezone 10479 #: kdecore/TIMEZONES:610 10480 #, kde-format 10481 msgid "Thule / Pituffik" 10482 msgstr "" 10483 10484 #. i18n: comment to the previous timezone 10485 #: kdecore/TIMEZONES:612 10486 #, kde-format 10487 msgid "Thule/Pituffik" 10488 msgstr "" 10489 10490 #: kdecore/TIMEZONES:613 10491 #, kde-format 10492 msgid "America/Thunder_Bay" 10493 msgstr "" 10494 10495 #. i18n: comment to the previous timezone 10496 #: kdecore/TIMEZONES:615 10497 #, kde-format 10498 msgid "Eastern Time - Thunder Bay, Ontario" 10499 msgstr "" 10500 10501 #. i18n: comment to the previous timezone 10502 #: kdecore/TIMEZONES:617 10503 #, kde-format 10504 msgid "Eastern - ON (Thunder Bay)" 10505 msgstr "" 10506 10507 #: kdecore/TIMEZONES:618 10508 #, kde-format 10509 msgid "America/Tijuana" 10510 msgstr "" 10511 10512 #. i18n: comment to the previous timezone 10513 #: kdecore/TIMEZONES:622 10514 #, kde-format 10515 msgid "US Pacific Time - Baja California near US border" 10516 msgstr "" 10517 10518 #. i18n: comment to the previous timezone 10519 #: kdecore/TIMEZONES:624 10520 #, kde-format 10521 msgid "Pacific Time US - Baja California" 10522 msgstr "" 10523 10524 #: kdecore/TIMEZONES:625 10525 #, kde-format 10526 msgid "America/Toronto" 10527 msgstr "" 10528 10529 #. i18n: comment to the previous timezone 10530 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10531 #, kde-format 10532 msgid "Eastern Time - Ontario - most locations" 10533 msgstr "" 10534 10535 #. i18n: comment to the previous timezone 10536 #: kdecore/TIMEZONES:629 10537 #, kde-format 10538 msgid "Eastern - ON, QC (most areas)" 10539 msgstr "" 10540 10541 #: kdecore/TIMEZONES:630 10542 #, kde-format 10543 msgid "America/Tortola" 10544 msgstr "" 10545 10546 #: kdecore/TIMEZONES:631 10547 #, kde-format 10548 msgid "America/Vancouver" 10549 msgstr "" 10550 10551 #. i18n: comment to the previous timezone 10552 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10553 #, kde-format 10554 msgid "Pacific Time - west British Columbia" 10555 msgstr "" 10556 10557 #. i18n: comment to the previous timezone 10558 #: kdecore/TIMEZONES:635 10559 #, kde-format 10560 msgid "Pacific - BC (most areas)" 10561 msgstr "" 10562 10563 #: kdecore/TIMEZONES:636 10564 #, kde-format 10565 msgid "America/Virgin" 10566 msgstr "" 10567 10568 #: kdecore/TIMEZONES:637 10569 #, kde-format 10570 msgid "America/Whitehorse" 10571 msgstr "" 10572 10573 #. i18n: comment to the previous timezone 10574 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10575 #, kde-format 10576 msgid "Pacific Time - south Yukon" 10577 msgstr "" 10578 10579 #. i18n: comment to the previous timezone 10580 #: kdecore/TIMEZONES:641 10581 #, kde-format 10582 msgid "MST - Yukon (east)" 10583 msgstr "" 10584 10585 #: kdecore/TIMEZONES:642 10586 #, kde-format 10587 msgid "America/Winnipeg" 10588 msgstr "" 10589 10590 #. i18n: comment to the previous timezone 10591 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10592 #, kde-format 10593 msgid "Central Time - Manitoba & west Ontario" 10594 msgstr "" 10595 10596 #. i18n: comment to the previous timezone 10597 #: kdecore/TIMEZONES:646 10598 #, kde-format 10599 msgid "Central - ON (west); Manitoba" 10600 msgstr "" 10601 10602 #: kdecore/TIMEZONES:647 10603 #, kde-format 10604 msgid "America/Yakutat" 10605 msgstr "" 10606 10607 #. i18n: comment to the previous timezone 10608 #: kdecore/TIMEZONES:649 10609 #, kde-format 10610 msgid "Alaska Time - Alaska panhandle neck" 10611 msgstr "" 10612 10613 #. i18n: comment to the previous timezone 10614 #: kdecore/TIMEZONES:651 10615 #, kde-format 10616 msgid "Alaska - Yakutat" 10617 msgstr "" 10618 10619 #: kdecore/TIMEZONES:652 10620 #, kde-format 10621 msgid "America/Yellowknife" 10622 msgstr "" 10623 10624 #. i18n: comment to the previous timezone 10625 #: kdecore/TIMEZONES:654 10626 #, kde-format 10627 msgid "Mountain Time - central Northwest Territories" 10628 msgstr "" 10629 10630 #. i18n: comment to the previous timezone 10631 #: kdecore/TIMEZONES:656 10632 #, fuzzy, kde-format 10633 #| msgid "Maintainer" 10634 msgid "Mountain - NT (central)" 10635 msgstr "Алып баручы" 10636 10637 #: kdecore/TIMEZONES:657 10638 #, kde-format 10639 msgid "Antarctica/Casey" 10640 msgstr "" 10641 10642 #. i18n: comment to the previous timezone 10643 #: kdecore/TIMEZONES:659 10644 #, kde-format 10645 msgid "Casey Station, Bailey Peninsula" 10646 msgstr "" 10647 10648 #. i18n: comment to the previous timezone 10649 #: kdecore/TIMEZONES:661 10650 #, kde-format 10651 msgid "Casey" 10652 msgstr "" 10653 10654 #: kdecore/TIMEZONES:662 10655 #, kde-format 10656 msgid "Antarctica/Davis" 10657 msgstr "" 10658 10659 #. i18n: comment to the previous timezone 10660 #: kdecore/TIMEZONES:664 10661 #, kde-format 10662 msgid "Davis Station, Vestfold Hills" 10663 msgstr "" 10664 10665 #. i18n: comment to the previous timezone 10666 #: kdecore/TIMEZONES:666 10667 #, kde-format 10668 msgid "Davis" 10669 msgstr "" 10670 10671 #: kdecore/TIMEZONES:667 10672 #, kde-format 10673 msgid "Antarctica/DumontDUrville" 10674 msgstr "" 10675 10676 #. i18n: comment to the previous timezone 10677 #: kdecore/TIMEZONES:669 10678 #, kde-format 10679 msgid "Dumont-d'Urville Station, Terre Adelie" 10680 msgstr "" 10681 10682 #. i18n: comment to the previous timezone 10683 #: kdecore/TIMEZONES:671 10684 #, kde-format 10685 msgid "Dumont-d'Urville" 10686 msgstr "" 10687 10688 #: kdecore/TIMEZONES:672 10689 #, kde-format 10690 msgid "Antarctica/Macquarie" 10691 msgstr "" 10692 10693 #. i18n: comment to the previous timezone 10694 #: kdecore/TIMEZONES:674 10695 #, kde-format 10696 msgid "Macquarie Island Station, Macquarie Island" 10697 msgstr "" 10698 10699 #. i18n: comment to the previous timezone 10700 #: kdecore/TIMEZONES:676 10701 #, kde-format 10702 msgid "Macquarie Island" 10703 msgstr "" 10704 10705 #: kdecore/TIMEZONES:677 10706 #, kde-format 10707 msgid "Antarctica/Mawson" 10708 msgstr "" 10709 10710 #. i18n: comment to the previous timezone 10711 #: kdecore/TIMEZONES:679 10712 #, kde-format 10713 msgid "Mawson Station, Holme Bay" 10714 msgstr "" 10715 10716 #. i18n: comment to the previous timezone 10717 #: kdecore/TIMEZONES:681 10718 #, kde-format 10719 msgid "Mawson" 10720 msgstr "" 10721 10722 #: kdecore/TIMEZONES:682 10723 #, kde-format 10724 msgid "Antarctica/McMurdo" 10725 msgstr "" 10726 10727 #. i18n: comment to the previous timezone 10728 #: kdecore/TIMEZONES:684 10729 #, kde-format 10730 msgid "McMurdo Station, Ross Island" 10731 msgstr "" 10732 10733 #. i18n: comment to the previous timezone 10734 #: kdecore/TIMEZONES:686 10735 #, kde-format 10736 msgid "New Zealand time - McMurdo, South Pole" 10737 msgstr "" 10738 10739 #: kdecore/TIMEZONES:687 10740 #, kde-format 10741 msgid "Antarctica/Palmer" 10742 msgstr "" 10743 10744 #. i18n: comment to the previous timezone 10745 #: kdecore/TIMEZONES:689 10746 #, kde-format 10747 msgid "Palmer Station, Anvers Island" 10748 msgstr "" 10749 10750 #. i18n: comment to the previous timezone 10751 #: kdecore/TIMEZONES:691 10752 #, kde-format 10753 msgid "Palmer" 10754 msgstr "" 10755 10756 #: kdecore/TIMEZONES:692 10757 #, kde-format 10758 msgid "Antarctica/Rothera" 10759 msgstr "" 10760 10761 #. i18n: comment to the previous timezone 10762 #: kdecore/TIMEZONES:694 10763 #, kde-format 10764 msgid "Rothera Station, Adelaide Island" 10765 msgstr "" 10766 10767 #. i18n: comment to the previous timezone 10768 #: kdecore/TIMEZONES:696 10769 #, fuzzy, kde-format 10770 #| msgctxt "@item Text character set" 10771 #| msgid "Other" 10772 msgid "Rothera" 10773 msgstr "Башкалар" 10774 10775 #: kdecore/TIMEZONES:697 10776 #, kde-format 10777 msgid "Antarctica/South_Pole" 10778 msgstr "" 10779 10780 #. i18n: comment to the previous timezone 10781 #: kdecore/TIMEZONES:699 10782 #, kde-format 10783 msgid "Amundsen-Scott Station, South Pole" 10784 msgstr "" 10785 10786 #: kdecore/TIMEZONES:700 10787 #, kde-format 10788 msgid "Antarctica/Syowa" 10789 msgstr "" 10790 10791 #. i18n: comment to the previous timezone 10792 #: kdecore/TIMEZONES:702 10793 #, kde-format 10794 msgid "Syowa Station, E Ongul I" 10795 msgstr "" 10796 10797 #. i18n: comment to the previous timezone 10798 #: kdecore/TIMEZONES:704 10799 #, kde-format 10800 msgid "Syowa" 10801 msgstr "" 10802 10803 #: kdecore/TIMEZONES:705 10804 #, fuzzy, kde-format 10805 #| msgctxt "KCharSelect section name" 10806 #| msgid "African Scripts" 10807 msgid "Antarctica/Troll" 10808 msgstr "Африка" 10809 10810 #. i18n: comment to the previous timezone 10811 #: kdecore/TIMEZONES:707 10812 #, kde-format 10813 msgid "Troll" 10814 msgstr "" 10815 10816 #: kdecore/TIMEZONES:708 10817 #, kde-format 10818 msgid "Antarctica/Vostok" 10819 msgstr "" 10820 10821 #. i18n: comment to the previous timezone 10822 #: kdecore/TIMEZONES:710 10823 #, kde-format 10824 msgid "Vostok Station, S Magnetic Pole" 10825 msgstr "" 10826 10827 #. i18n: comment to the previous timezone 10828 #: kdecore/TIMEZONES:712 10829 #, kde-format 10830 msgid "Vostok Station, Lake Vostok" 10831 msgstr "" 10832 10833 #. i18n: comment to the previous timezone 10834 #: kdecore/TIMEZONES:714 10835 #, kde-format 10836 msgid "Vostok" 10837 msgstr "" 10838 10839 #: kdecore/TIMEZONES:715 10840 #, kde-format 10841 msgid "Arctic/Longyearbyen" 10842 msgstr "" 10843 10844 #: kdecore/TIMEZONES:716 10845 #, kde-format 10846 msgid "Asia/Aden" 10847 msgstr "" 10848 10849 #: kdecore/TIMEZONES:717 10850 #, kde-format 10851 msgid "Asia/Almaty" 10852 msgstr "" 10853 10854 #. i18n: comment to the previous timezone 10855 #: kdecore/TIMEZONES:721 10856 #, kde-format 10857 msgid "Kazakhstan (most areas)" 10858 msgstr "" 10859 10860 #: kdecore/TIMEZONES:722 10861 #, kde-format 10862 msgid "Asia/Amman" 10863 msgstr "" 10864 10865 #: kdecore/TIMEZONES:723 10866 #, kde-format 10867 msgid "Asia/Anadyr" 10868 msgstr "" 10869 10870 #. i18n: comment to the previous timezone 10871 #: kdecore/TIMEZONES:725 10872 #, kde-format 10873 msgid "Moscow+10 - Bering Sea" 10874 msgstr "" 10875 10876 #. i18n: comment to the previous timezone 10877 #: kdecore/TIMEZONES:727 10878 #, kde-format 10879 msgid "Moscow+08 - Bering Sea" 10880 msgstr "" 10881 10882 #. i18n: comment to the previous timezone 10883 #: kdecore/TIMEZONES:729 10884 #, kde-format 10885 msgid "MSK+09 - Bering Sea" 10886 msgstr "" 10887 10888 #: kdecore/TIMEZONES:730 10889 #, kde-format 10890 msgid "Asia/Aqtau" 10891 msgstr "" 10892 10893 #. i18n: comment to the previous timezone 10894 #: kdecore/TIMEZONES:732 10895 #, kde-format 10896 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 10897 msgstr "" 10898 10899 #. i18n: comment to the previous timezone 10900 #: kdecore/TIMEZONES:734 10901 #, kde-format 10902 msgid "Mangghystau/Mankistau" 10903 msgstr "" 10904 10905 #: kdecore/TIMEZONES:735 10906 #, kde-format 10907 msgid "Asia/Aqtobe" 10908 msgstr "" 10909 10910 #. i18n: comment to the previous timezone 10911 #: kdecore/TIMEZONES:737 10912 #, kde-format 10913 msgid "Aqtobe (Aktobe)" 10914 msgstr "" 10915 10916 #. i18n: comment to the previous timezone 10917 #: kdecore/TIMEZONES:739 10918 #, kde-format 10919 msgid "Aqtobe/Aktobe" 10920 msgstr "" 10921 10922 #: kdecore/TIMEZONES:740 10923 #, kde-format 10924 msgid "Asia/Ashgabat" 10925 msgstr "" 10926 10927 #: kdecore/TIMEZONES:741 10928 #, kde-format 10929 msgid "Asia/Ashkhabad" 10930 msgstr "" 10931 10932 #: kdecore/TIMEZONES:742 10933 #, kde-format 10934 msgid "Asia/Atyrau" 10935 msgstr "" 10936 10937 #. i18n: comment to the previous timezone 10938 #: kdecore/TIMEZONES:744 10939 #, kde-format 10940 msgid "Atyrau/Atirau/Gur'yev" 10941 msgstr "" 10942 10943 #: kdecore/TIMEZONES:745 10944 #, kde-format 10945 msgid "Asia/Baghdad" 10946 msgstr "" 10947 10948 #: kdecore/TIMEZONES:746 10949 #, kde-format 10950 msgid "Asia/Bahrain" 10951 msgstr "" 10952 10953 #: kdecore/TIMEZONES:747 10954 #, kde-format 10955 msgid "Asia/Baku" 10956 msgstr "" 10957 10958 #: kdecore/TIMEZONES:748 10959 #, kde-format 10960 msgid "Asia/Bangkok" 10961 msgstr "" 10962 10963 #: kdecore/TIMEZONES:749 10964 #, fuzzy, kde-format 10965 #| msgctxt "KCharselect unicode block name" 10966 #| msgid "Samaritan" 10967 msgid "Asia/Barnaul" 10968 msgstr "Самаритян язмасы" 10969 10970 #. i18n: comment to the previous timezone 10971 #: kdecore/TIMEZONES:751 10972 #, kde-format 10973 msgid "MSK+04 - Altai" 10974 msgstr "" 10975 10976 #: kdecore/TIMEZONES:752 10977 #, kde-format 10978 msgid "Asia/Beijing" 10979 msgstr "" 10980 10981 #. i18n: comment to the previous timezone 10982 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 10983 #, kde-format 10984 msgid "east China - Beijing, Guangdong, Shanghai, etc." 10985 msgstr "" 10986 10987 #. i18n: comment to the previous timezone 10988 #: kdecore/TIMEZONES:756 10989 #, kde-format 10990 msgid "China Standard Time" 10991 msgstr "" 10992 10993 #: kdecore/TIMEZONES:757 10994 #, kde-format 10995 msgid "Asia/Beirut" 10996 msgstr "" 10997 10998 #: kdecore/TIMEZONES:758 10999 #, kde-format 11000 msgid "Asia/Bishkek" 11001 msgstr "" 11002 11003 #: kdecore/TIMEZONES:759 11004 #, kde-format 11005 msgid "Asia/Brunei" 11006 msgstr "" 11007 11008 #: kdecore/TIMEZONES:760 11009 #, kde-format 11010 msgid "Asia/Calcutta" 11011 msgstr "" 11012 11013 #: kdecore/TIMEZONES:761 11014 #, kde-format 11015 msgid "Asia/Chita" 11016 msgstr "" 11017 11018 #. i18n: comment to the previous timezone 11019 #: kdecore/TIMEZONES:763 11020 #, kde-format 11021 msgid "MSK+06 - Zabaykalsky" 11022 msgstr "" 11023 11024 #: kdecore/TIMEZONES:764 11025 #, kde-format 11026 msgid "Asia/Choibalsan" 11027 msgstr "" 11028 11029 #. i18n: comment to the previous timezone 11030 #: kdecore/TIMEZONES:766 11031 #, kde-format 11032 msgid "Dornod, Sukhbaatar" 11033 msgstr "" 11034 11035 #: kdecore/TIMEZONES:767 11036 #, kde-format 11037 msgid "Asia/Chongqing" 11038 msgstr "" 11039 11040 #. i18n: comment to the previous timezone 11041 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11042 #, kde-format 11043 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11044 msgstr "" 11045 11046 #. i18n: comment to the previous timezone 11047 #: kdecore/TIMEZONES:771 11048 #, kde-format 11049 msgid "China mountains" 11050 msgstr "" 11051 11052 #: kdecore/TIMEZONES:772 11053 #, kde-format 11054 msgid "Asia/Chungking" 11055 msgstr "" 11056 11057 #: kdecore/TIMEZONES:775 11058 #, kde-format 11059 msgid "Asia/Colombo" 11060 msgstr "" 11061 11062 #: kdecore/TIMEZONES:776 11063 #, kde-format 11064 msgid "Asia/Dacca" 11065 msgstr "" 11066 11067 #: kdecore/TIMEZONES:777 11068 #, kde-format 11069 msgid "Asia/Damascus" 11070 msgstr "" 11071 11072 #: kdecore/TIMEZONES:778 11073 #, kde-format 11074 msgid "Asia/Dhaka" 11075 msgstr "" 11076 11077 #: kdecore/TIMEZONES:779 11078 #, kde-format 11079 msgid "Asia/Dili" 11080 msgstr "" 11081 11082 #: kdecore/TIMEZONES:780 11083 #, kde-format 11084 msgid "Asia/Dubai" 11085 msgstr "" 11086 11087 #: kdecore/TIMEZONES:781 11088 #, kde-format 11089 msgid "Asia/Dushanbe" 11090 msgstr "" 11091 11092 #: kdecore/TIMEZONES:782 11093 #, fuzzy, kde-format 11094 #| msgctxt "KCharselect unicode block name" 11095 #| msgid "Samaritan" 11096 msgid "Asia/Famagusta" 11097 msgstr "Самаритян язмасы" 11098 11099 #. i18n: comment to the previous timezone 11100 #: kdecore/TIMEZONES:784 11101 #, fuzzy, kde-format 11102 #| msgctxt "@item Text character set" 11103 #| msgid "Northern Saami" 11104 msgid "Northern Cyprus" 11105 msgstr "Төньяк Саами" 11106 11107 #: kdecore/TIMEZONES:785 11108 #, kde-format 11109 msgid "Asia/Gaza" 11110 msgstr "" 11111 11112 #. i18n: comment to the previous timezone 11113 #: kdecore/TIMEZONES:787 11114 #, kde-format 11115 msgid "Gaza Strip" 11116 msgstr "" 11117 11118 #: kdecore/TIMEZONES:788 11119 #, kde-format 11120 msgid "Asia/Harbin" 11121 msgstr "" 11122 11123 #. i18n: comment to the previous timezone 11124 #: kdecore/TIMEZONES:790 11125 #, kde-format 11126 msgid "Heilongjiang (except Mohe), Jilin" 11127 msgstr "" 11128 11129 #. i18n: comment to the previous timezone 11130 #: kdecore/TIMEZONES:792 11131 #, kde-format 11132 msgid "China north" 11133 msgstr "" 11134 11135 #: kdecore/TIMEZONES:793 11136 #, kde-format 11137 msgid "Asia/Hebron" 11138 msgstr "" 11139 11140 #. i18n: comment to the previous timezone 11141 #: kdecore/TIMEZONES:795 11142 #, kde-format 11143 msgid "West Bank" 11144 msgstr "" 11145 11146 #: kdecore/TIMEZONES:796 11147 #, kde-format 11148 msgid "Asia/Ho_Chi_Minh" 11149 msgstr "" 11150 11151 #: kdecore/TIMEZONES:797 11152 #, kde-format 11153 msgid "Asia/Hong_Kong" 11154 msgstr "" 11155 11156 #: kdecore/TIMEZONES:798 11157 #, kde-format 11158 msgid "Asia/Hovd" 11159 msgstr "" 11160 11161 #. i18n: comment to the previous timezone 11162 #: kdecore/TIMEZONES:800 11163 #, kde-format 11164 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11165 msgstr "" 11166 11167 #: kdecore/TIMEZONES:801 11168 #, kde-format 11169 msgid "Asia/Irkutsk" 11170 msgstr "" 11171 11172 #. i18n: comment to the previous timezone 11173 #: kdecore/TIMEZONES:803 11174 #, kde-format 11175 msgid "Moscow+05 - Lake Baikal" 11176 msgstr "" 11177 11178 #. i18n: comment to the previous timezone 11179 #: kdecore/TIMEZONES:805 11180 #, kde-format 11181 msgid "MSK+05 - Irkutsk, Buryatia" 11182 msgstr "" 11183 11184 #: kdecore/TIMEZONES:806 11185 #, kde-format 11186 msgid "Asia/Jakarta" 11187 msgstr "" 11188 11189 #. i18n: comment to the previous timezone 11190 #: kdecore/TIMEZONES:808 11191 #, kde-format 11192 msgid "Java & Sumatra" 11193 msgstr "" 11194 11195 #. i18n: comment to the previous timezone 11196 #: kdecore/TIMEZONES:810 11197 #, kde-format 11198 msgid "Java, Sumatra" 11199 msgstr "" 11200 11201 #: kdecore/TIMEZONES:811 11202 #, kde-format 11203 msgid "Asia/Jayapura" 11204 msgstr "" 11205 11206 #. i18n: comment to the previous timezone 11207 #: kdecore/TIMEZONES:813 11208 #, kde-format 11209 msgid "Irian Jaya & the Moluccas" 11210 msgstr "" 11211 11212 #. i18n: comment to the previous timezone 11213 #: kdecore/TIMEZONES:815 11214 #, kde-format 11215 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11216 msgstr "" 11217 11218 #. i18n: comment to the previous timezone 11219 #: kdecore/TIMEZONES:817 11220 #, kde-format 11221 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11222 msgstr "" 11223 11224 #: kdecore/TIMEZONES:818 11225 #, kde-format 11226 msgid "Asia/Jerusalem" 11227 msgstr "" 11228 11229 #: kdecore/TIMEZONES:819 11230 #, kde-format 11231 msgid "Asia/Kabul" 11232 msgstr "" 11233 11234 #: kdecore/TIMEZONES:820 11235 #, kde-format 11236 msgid "Asia/Kamchatka" 11237 msgstr "" 11238 11239 #. i18n: comment to the previous timezone 11240 #: kdecore/TIMEZONES:822 11241 #, kde-format 11242 msgid "Moscow+09 - Kamchatka" 11243 msgstr "" 11244 11245 #. i18n: comment to the previous timezone 11246 #: kdecore/TIMEZONES:824 11247 #, kde-format 11248 msgid "Moscow+08 - Kamchatka" 11249 msgstr "" 11250 11251 #. i18n: comment to the previous timezone 11252 #: kdecore/TIMEZONES:826 11253 #, kde-format 11254 msgid "MSK+09 - Kamchatka" 11255 msgstr "" 11256 11257 #: kdecore/TIMEZONES:827 11258 #, kde-format 11259 msgid "Asia/Karachi" 11260 msgstr "" 11261 11262 #: kdecore/TIMEZONES:828 11263 #, kde-format 11264 msgid "Asia/Kashgar" 11265 msgstr "" 11266 11267 #. i18n: comment to the previous timezone 11268 #: kdecore/TIMEZONES:830 11269 #, kde-format 11270 msgid "west Tibet & Xinjiang" 11271 msgstr "" 11272 11273 #. i18n: comment to the previous timezone 11274 #: kdecore/TIMEZONES:832 11275 #, kde-format 11276 msgid "China west Xinjiang" 11277 msgstr "" 11278 11279 #: kdecore/TIMEZONES:833 11280 #, kde-format 11281 msgid "Asia/Kathmandu" 11282 msgstr "" 11283 11284 #: kdecore/TIMEZONES:834 11285 #, kde-format 11286 msgid "Asia/Katmandu" 11287 msgstr "" 11288 11289 #: kdecore/TIMEZONES:835 11290 #, kde-format 11291 msgid "Asia/Khandyga" 11292 msgstr "" 11293 11294 #. i18n: comment to the previous timezone 11295 #: kdecore/TIMEZONES:837 11296 #, kde-format 11297 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11298 msgstr "" 11299 11300 #: kdecore/TIMEZONES:838 11301 #, kde-format 11302 msgid "Asia/Kolkata" 11303 msgstr "" 11304 11305 #: kdecore/TIMEZONES:839 11306 #, kde-format 11307 msgid "Asia/Krasnoyarsk" 11308 msgstr "" 11309 11310 #. i18n: comment to the previous timezone 11311 #: kdecore/TIMEZONES:841 11312 #, kde-format 11313 msgid "Moscow+04 - Yenisei River" 11314 msgstr "" 11315 11316 #. i18n: comment to the previous timezone 11317 #: kdecore/TIMEZONES:843 11318 #, kde-format 11319 msgid "MSK+04 - Krasnoyarsk area" 11320 msgstr "" 11321 11322 #: kdecore/TIMEZONES:844 11323 #, kde-format 11324 msgid "Asia/Kuala_Lumpur" 11325 msgstr "" 11326 11327 #. i18n: comment to the previous timezone 11328 #: kdecore/TIMEZONES:846 11329 #, kde-format 11330 msgid "peninsular Malaysia" 11331 msgstr "" 11332 11333 #. i18n: comment to the previous timezone 11334 #: kdecore/TIMEZONES:848 11335 #, kde-format 11336 msgid "Malaysia (peninsula)" 11337 msgstr "" 11338 11339 #: kdecore/TIMEZONES:849 11340 #, kde-format 11341 msgid "Asia/Kuching" 11342 msgstr "" 11343 11344 #. i18n: comment to the previous timezone 11345 #: kdecore/TIMEZONES:851 11346 #, kde-format 11347 msgid "Sabah & Sarawak" 11348 msgstr "" 11349 11350 #. i18n: comment to the previous timezone 11351 #: kdecore/TIMEZONES:853 11352 #, kde-format 11353 msgid "Sabah, Sarawak" 11354 msgstr "" 11355 11356 #: kdecore/TIMEZONES:854 11357 #, kde-format 11358 msgid "Asia/Kuwait" 11359 msgstr "" 11360 11361 #: kdecore/TIMEZONES:855 11362 #, kde-format 11363 msgid "Asia/Macao" 11364 msgstr "" 11365 11366 #: kdecore/TIMEZONES:856 11367 #, kde-format 11368 msgid "Asia/Macau" 11369 msgstr "" 11370 11371 #: kdecore/TIMEZONES:857 11372 #, kde-format 11373 msgid "Asia/Magadan" 11374 msgstr "" 11375 11376 #. i18n: comment to the previous timezone 11377 #: kdecore/TIMEZONES:859 11378 #, kde-format 11379 msgid "Moscow+08 - Magadan" 11380 msgstr "" 11381 11382 #. i18n: comment to the previous timezone 11383 #: kdecore/TIMEZONES:861 11384 #, kde-format 11385 msgid "MSK+08 - Magadan" 11386 msgstr "" 11387 11388 #: kdecore/TIMEZONES:862 11389 #, kde-format 11390 msgid "Asia/Makassar" 11391 msgstr "" 11392 11393 #. i18n: comment to the previous timezone 11394 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11395 #, kde-format 11396 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11397 msgstr "" 11398 11399 #. i18n: comment to the previous timezone 11400 #: kdecore/TIMEZONES:866 11401 #, kde-format 11402 msgid "" 11403 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11404 msgstr "" 11405 11406 #. i18n: comment to the previous timezone 11407 #: kdecore/TIMEZONES:868 11408 #, kde-format 11409 msgid "" 11410 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11411 msgstr "" 11412 11413 #: kdecore/TIMEZONES:869 11414 #, kde-format 11415 msgid "Asia/Manila" 11416 msgstr "" 11417 11418 #: kdecore/TIMEZONES:870 11419 #, kde-format 11420 msgid "Asia/Muscat" 11421 msgstr "" 11422 11423 #: kdecore/TIMEZONES:871 11424 #, kde-format 11425 msgid "Asia/Nicosia" 11426 msgstr "" 11427 11428 #. i18n: comment to the previous timezone 11429 #: kdecore/TIMEZONES:873 11430 #, kde-format 11431 msgid "Cyprus (most areas)" 11432 msgstr "" 11433 11434 #: kdecore/TIMEZONES:874 11435 #, kde-format 11436 msgid "Asia/Novokuznetsk" 11437 msgstr "" 11438 11439 #. i18n: comment to the previous timezone 11440 #: kdecore/TIMEZONES:876 11441 #, kde-format 11442 msgid "Moscow+03 - Novokuznetsk" 11443 msgstr "" 11444 11445 #. i18n: comment to the previous timezone 11446 #: kdecore/TIMEZONES:878 11447 #, kde-format 11448 msgid "MSK+04 - Kemerovo" 11449 msgstr "" 11450 11451 #: kdecore/TIMEZONES:879 11452 #, kde-format 11453 msgid "Asia/Novosibirsk" 11454 msgstr "" 11455 11456 #. i18n: comment to the previous timezone 11457 #: kdecore/TIMEZONES:881 11458 #, kde-format 11459 msgid "Moscow+03 - Novosibirsk" 11460 msgstr "" 11461 11462 #. i18n: comment to the previous timezone 11463 #: kdecore/TIMEZONES:883 11464 #, kde-format 11465 msgid "MSK+04 - Novosibirsk" 11466 msgstr "" 11467 11468 #: kdecore/TIMEZONES:884 11469 #, kde-format 11470 msgid "Asia/Omsk" 11471 msgstr "" 11472 11473 #. i18n: comment to the previous timezone 11474 #: kdecore/TIMEZONES:886 11475 #, kde-format 11476 msgid "Moscow+03 - west Siberia" 11477 msgstr "" 11478 11479 #. i18n: comment to the previous timezone 11480 #: kdecore/TIMEZONES:888 11481 #, kde-format 11482 msgid "MSK+03 - Omsk" 11483 msgstr "" 11484 11485 #: kdecore/TIMEZONES:889 11486 #, kde-format 11487 msgid "Asia/Oral" 11488 msgstr "" 11489 11490 #. i18n: comment to the previous timezone 11491 #: kdecore/TIMEZONES:891 11492 #, kde-format 11493 msgid "West Kazakhstan" 11494 msgstr "" 11495 11496 #: kdecore/TIMEZONES:892 11497 #, kde-format 11498 msgid "Asia/Phnom_Penh" 11499 msgstr "" 11500 11501 #: kdecore/TIMEZONES:893 11502 #, kde-format 11503 msgid "Asia/Pontianak" 11504 msgstr "" 11505 11506 #. i18n: comment to the previous timezone 11507 #: kdecore/TIMEZONES:895 11508 #, kde-format 11509 msgid "west & central Borneo" 11510 msgstr "" 11511 11512 #. i18n: comment to the previous timezone 11513 #: kdecore/TIMEZONES:897 11514 #, kde-format 11515 msgid "Borneo (west, central)" 11516 msgstr "" 11517 11518 #: kdecore/TIMEZONES:898 11519 #, kde-format 11520 msgid "Asia/Pyongyang" 11521 msgstr "" 11522 11523 #: kdecore/TIMEZONES:899 11524 #, kde-format 11525 msgid "Asia/Qatar" 11526 msgstr "" 11527 11528 #: kdecore/TIMEZONES:900 11529 #, kde-format 11530 msgid "Asia/Qostanay" 11531 msgstr "" 11532 11533 #. i18n: comment to the previous timezone 11534 #: kdecore/TIMEZONES:902 11535 #, kde-format 11536 msgid "Qostanay/Kostanay/Kustanay" 11537 msgstr "" 11538 11539 #: kdecore/TIMEZONES:903 11540 #, kde-format 11541 msgid "Asia/Qyzylorda" 11542 msgstr "" 11543 11544 #. i18n: comment to the previous timezone 11545 #: kdecore/TIMEZONES:905 11546 #, kde-format 11547 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11548 msgstr "" 11549 11550 #. i18n: comment to the previous timezone 11551 #: kdecore/TIMEZONES:907 11552 #, kde-format 11553 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11554 msgstr "" 11555 11556 #: kdecore/TIMEZONES:908 11557 #, kde-format 11558 msgid "Asia/Rangoon" 11559 msgstr "" 11560 11561 #: kdecore/TIMEZONES:909 11562 #, kde-format 11563 msgid "Asia/Riyadh" 11564 msgstr "" 11565 11566 #: kdecore/TIMEZONES:910 11567 #, kde-format 11568 msgid "Asia/Saigon" 11569 msgstr "" 11570 11571 #: kdecore/TIMEZONES:911 11572 #, kde-format 11573 msgid "Asia/Sakhalin" 11574 msgstr "" 11575 11576 #. i18n: comment to the previous timezone 11577 #: kdecore/TIMEZONES:913 11578 #, kde-format 11579 msgid "Moscow+07 - Sakhalin Island" 11580 msgstr "" 11581 11582 #. i18n: comment to the previous timezone 11583 #: kdecore/TIMEZONES:915 11584 #, kde-format 11585 msgid "MSK+08 - Sakhalin Island" 11586 msgstr "" 11587 11588 #: kdecore/TIMEZONES:916 11589 #, fuzzy, kde-format 11590 #| msgctxt "KCharselect unicode block name" 11591 #| msgid "Samaritan" 11592 msgid "Asia/Samarkand" 11593 msgstr "Самаритян язмасы" 11594 11595 #. i18n: comment to the previous timezone 11596 #: kdecore/TIMEZONES:918 11597 #, kde-format 11598 msgid "west Uzbekistan" 11599 msgstr "" 11600 11601 #. i18n: comment to the previous timezone 11602 #: kdecore/TIMEZONES:920 11603 #, kde-format 11604 msgid "Uzbekistan (west)" 11605 msgstr "" 11606 11607 #: kdecore/TIMEZONES:921 11608 #, kde-format 11609 msgid "Asia/Seoul" 11610 msgstr "" 11611 11612 #: kdecore/TIMEZONES:922 11613 #, kde-format 11614 msgid "Asia/Shanghai" 11615 msgstr "" 11616 11617 #. i18n: comment to the previous timezone 11618 #: kdecore/TIMEZONES:926 11619 #, kde-format 11620 msgid "China east" 11621 msgstr "" 11622 11623 #. i18n: comment to the previous timezone 11624 #: kdecore/TIMEZONES:928 11625 #, fuzzy, kde-format 11626 #| msgctxt "@action" 11627 #| msgid "Beginning of Line" 11628 msgid "Beijing Time" 11629 msgstr "Юл башы" 11630 11631 #: kdecore/TIMEZONES:929 11632 #, kde-format 11633 msgid "Asia/Singapore" 11634 msgstr "" 11635 11636 #: kdecore/TIMEZONES:930 11637 #, kde-format 11638 msgid "Asia/Srednekolymsk" 11639 msgstr "" 11640 11641 #. i18n: comment to the previous timezone 11642 #: kdecore/TIMEZONES:932 11643 #, kde-format 11644 msgid "MSK+08 - Sakha (E); North Kuril Is" 11645 msgstr "" 11646 11647 #: kdecore/TIMEZONES:933 11648 #, kde-format 11649 msgid "Asia/Taipei" 11650 msgstr "" 11651 11652 #: kdecore/TIMEZONES:934 11653 #, kde-format 11654 msgid "Asia/Tashkent" 11655 msgstr "" 11656 11657 #. i18n: comment to the previous timezone 11658 #: kdecore/TIMEZONES:936 11659 #, kde-format 11660 msgid "east Uzbekistan" 11661 msgstr "" 11662 11663 #. i18n: comment to the previous timezone 11664 #: kdecore/TIMEZONES:938 11665 #, kde-format 11666 msgid "Uzbekistan (east)" 11667 msgstr "" 11668 11669 #: kdecore/TIMEZONES:939 11670 #, kde-format 11671 msgid "Asia/Tbilisi" 11672 msgstr "" 11673 11674 #: kdecore/TIMEZONES:940 11675 #, kde-format 11676 msgid "Asia/Tehran" 11677 msgstr "" 11678 11679 #: kdecore/TIMEZONES:941 11680 #, kde-format 11681 msgid "Asia/Tel_Aviv" 11682 msgstr "" 11683 11684 #: kdecore/TIMEZONES:942 11685 #, kde-format 11686 msgid "Asia/Thimbu" 11687 msgstr "" 11688 11689 #: kdecore/TIMEZONES:943 11690 #, kde-format 11691 msgid "Asia/Thimphu" 11692 msgstr "" 11693 11694 #: kdecore/TIMEZONES:944 11695 #, kde-format 11696 msgid "Asia/Tokyo" 11697 msgstr "" 11698 11699 #: kdecore/TIMEZONES:945 11700 #, kde-format 11701 msgid "Asia/Tomsk" 11702 msgstr "" 11703 11704 #. i18n: comment to the previous timezone 11705 #: kdecore/TIMEZONES:947 11706 #, kde-format 11707 msgid "MSK+04 - Tomsk" 11708 msgstr "" 11709 11710 #: kdecore/TIMEZONES:948 11711 #, kde-format 11712 msgid "Asia/Ujung_Pandang" 11713 msgstr "" 11714 11715 #: kdecore/TIMEZONES:951 11716 #, kde-format 11717 msgid "Asia/Ulaanbaatar" 11718 msgstr "" 11719 11720 #. i18n: comment to the previous timezone 11721 #: kdecore/TIMEZONES:955 11722 #, kde-format 11723 msgid "Mongolia (most areas)" 11724 msgstr "" 11725 11726 #: kdecore/TIMEZONES:956 11727 #, kde-format 11728 msgid "Asia/Ulan_Bator" 11729 msgstr "" 11730 11731 #: kdecore/TIMEZONES:959 11732 #, kde-format 11733 msgid "Asia/Urumqi" 11734 msgstr "" 11735 11736 #. i18n: comment to the previous timezone 11737 #: kdecore/TIMEZONES:961 11738 #, kde-format 11739 msgid "most of Tibet & Xinjiang" 11740 msgstr "" 11741 11742 #. i18n: comment to the previous timezone 11743 #: kdecore/TIMEZONES:963 11744 #, kde-format 11745 msgid "China Xinjiang-Tibet" 11746 msgstr "" 11747 11748 #. i18n: comment to the previous timezone 11749 #: kdecore/TIMEZONES:965 11750 #, fuzzy, kde-format 11751 #| msgid "Maintainer" 11752 msgid "Xinjiang Time" 11753 msgstr "Алып баручы" 11754 11755 #: kdecore/TIMEZONES:966 11756 #, kde-format 11757 msgid "Asia/Ust-Nera" 11758 msgstr "" 11759 11760 #. i18n: comment to the previous timezone 11761 #: kdecore/TIMEZONES:968 11762 #, kde-format 11763 msgid "MSK+07 - Oymyakonsky" 11764 msgstr "" 11765 11766 #: kdecore/TIMEZONES:969 11767 #, kde-format 11768 msgid "Asia/Vientiane" 11769 msgstr "" 11770 11771 #: kdecore/TIMEZONES:970 11772 #, kde-format 11773 msgid "Asia/Vladivostok" 11774 msgstr "" 11775 11776 #. i18n: comment to the previous timezone 11777 #: kdecore/TIMEZONES:972 11778 #, kde-format 11779 msgid "Moscow+07 - Amur River" 11780 msgstr "" 11781 11782 #. i18n: comment to the previous timezone 11783 #: kdecore/TIMEZONES:974 11784 #, kde-format 11785 msgid "MSK+07 - Amur River" 11786 msgstr "" 11787 11788 #: kdecore/TIMEZONES:975 11789 #, kde-format 11790 msgid "Asia/Yakutsk" 11791 msgstr "" 11792 11793 #. i18n: comment to the previous timezone 11794 #: kdecore/TIMEZONES:977 11795 #, kde-format 11796 msgid "Moscow+06 - Lena River" 11797 msgstr "" 11798 11799 #. i18n: comment to the previous timezone 11800 #: kdecore/TIMEZONES:979 11801 #, kde-format 11802 msgid "MSK+06 - Lena River" 11803 msgstr "" 11804 11805 #: kdecore/TIMEZONES:980 11806 #, kde-format 11807 msgid "Asia/Yangon" 11808 msgstr "" 11809 11810 #: kdecore/TIMEZONES:981 11811 #, kde-format 11812 msgid "Asia/Yekaterinburg" 11813 msgstr "" 11814 11815 #. i18n: comment to the previous timezone 11816 #: kdecore/TIMEZONES:983 11817 #, kde-format 11818 msgid "Moscow+02 - Urals" 11819 msgstr "" 11820 11821 #. i18n: comment to the previous timezone 11822 #: kdecore/TIMEZONES:985 11823 #, kde-format 11824 msgid "MSK+02 - Urals" 11825 msgstr "" 11826 11827 #: kdecore/TIMEZONES:986 11828 #, kde-format 11829 msgid "Asia/Yerevan" 11830 msgstr "" 11831 11832 #: kdecore/TIMEZONES:987 11833 #, kde-format 11834 msgid "Atlantic/Azores" 11835 msgstr "" 11836 11837 #. i18n: comment to the previous timezone 11838 #: kdecore/TIMEZONES:989 11839 #, kde-format 11840 msgid "Azores" 11841 msgstr "" 11842 11843 #: kdecore/TIMEZONES:990 11844 #, kde-format 11845 msgid "Atlantic/Bermuda" 11846 msgstr "" 11847 11848 #: kdecore/TIMEZONES:991 11849 #, kde-format 11850 msgid "Atlantic/Canary" 11851 msgstr "" 11852 11853 #. i18n: comment to the previous timezone 11854 #: kdecore/TIMEZONES:993 11855 #, kde-format 11856 msgid "Canary Islands" 11857 msgstr "" 11858 11859 #: kdecore/TIMEZONES:994 11860 #, kde-format 11861 msgid "Atlantic/Cape_Verde" 11862 msgstr "" 11863 11864 #: kdecore/TIMEZONES:995 11865 #, kde-format 11866 msgid "Atlantic/Faeroe" 11867 msgstr "" 11868 11869 #: kdecore/TIMEZONES:996 11870 #, kde-format 11871 msgid "Atlantic/Faroe" 11872 msgstr "" 11873 11874 #: kdecore/TIMEZONES:997 11875 #, kde-format 11876 msgid "Atlantic/Jan_Mayen" 11877 msgstr "" 11878 11879 #: kdecore/TIMEZONES:998 11880 #, kde-format 11881 msgid "Atlantic/Madeira" 11882 msgstr "" 11883 11884 #. i18n: comment to the previous timezone 11885 #: kdecore/TIMEZONES:1000 11886 #, kde-format 11887 msgid "Madeira Islands" 11888 msgstr "" 11889 11890 #: kdecore/TIMEZONES:1001 11891 #, kde-format 11892 msgid "Atlantic/Reykjavik" 11893 msgstr "" 11894 11895 #: kdecore/TIMEZONES:1002 11896 #, kde-format 11897 msgid "Atlantic/South_Georgia" 11898 msgstr "" 11899 11900 #: kdecore/TIMEZONES:1003 11901 #, kde-format 11902 msgid "Atlantic/St_Helena" 11903 msgstr "" 11904 11905 #: kdecore/TIMEZONES:1004 11906 #, kde-format 11907 msgid "Atlantic/Stanley" 11908 msgstr "" 11909 11910 #: kdecore/TIMEZONES:1005 11911 #, kde-format 11912 msgid "Australia/ACT" 11913 msgstr "" 11914 11915 #. i18n: comment to the previous timezone 11916 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 11917 #: kdecore/TIMEZONES:1073 11918 #, kde-format 11919 msgid "New South Wales - most locations" 11920 msgstr "" 11921 11922 #: kdecore/TIMEZONES:1008 11923 #, kde-format 11924 msgid "Australia/Adelaide" 11925 msgstr "" 11926 11927 #. i18n: comment to the previous timezone 11928 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 11929 #, kde-format 11930 msgid "South Australia" 11931 msgstr "" 11932 11933 #: kdecore/TIMEZONES:1011 11934 #, kde-format 11935 msgid "Australia/Brisbane" 11936 msgstr "" 11937 11938 #. i18n: comment to the previous timezone 11939 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 11940 #, kde-format 11941 msgid "Queensland - most locations" 11942 msgstr "" 11943 11944 #. i18n: comment to the previous timezone 11945 #: kdecore/TIMEZONES:1015 11946 #, kde-format 11947 msgid "Queensland (most areas)" 11948 msgstr "" 11949 11950 #: kdecore/TIMEZONES:1016 11951 #, kde-format 11952 msgid "Australia/Broken_Hill" 11953 msgstr "" 11954 11955 #. i18n: comment to the previous timezone 11956 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 11957 #, kde-format 11958 msgid "New South Wales - Yancowinna" 11959 msgstr "" 11960 11961 #. i18n: comment to the previous timezone 11962 #: kdecore/TIMEZONES:1020 11963 #, kde-format 11964 msgid "New South Wales (Yancowinna)" 11965 msgstr "" 11966 11967 #: kdecore/TIMEZONES:1021 11968 #, kde-format 11969 msgid "Australia/Canberra" 11970 msgstr "" 11971 11972 #: kdecore/TIMEZONES:1024 11973 #, kde-format 11974 msgid "Australia/Currie" 11975 msgstr "" 11976 11977 #. i18n: comment to the previous timezone 11978 #: kdecore/TIMEZONES:1026 11979 #, kde-format 11980 msgid "Tasmania - King Island" 11981 msgstr "" 11982 11983 #: kdecore/TIMEZONES:1027 11984 #, kde-format 11985 msgid "Australia/Darwin" 11986 msgstr "" 11987 11988 #. i18n: comment to the previous timezone 11989 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 11990 #, fuzzy, kde-format 11991 #| msgctxt "@item Text character set" 11992 #| msgid "Northern Saami" 11993 msgid "Northern Territory" 11994 msgstr "Төньяк Саами" 11995 11996 #: kdecore/TIMEZONES:1030 11997 #, kde-format 11998 msgid "Australia/Eucla" 11999 msgstr "" 12000 12001 #. i18n: comment to the previous timezone 12002 #: kdecore/TIMEZONES:1032 12003 #, kde-format 12004 msgid "Western Australia - Eucla area" 12005 msgstr "" 12006 12007 #. i18n: comment to the previous timezone 12008 #: kdecore/TIMEZONES:1034 12009 #, kde-format 12010 msgid "Western Australia (Eucla)" 12011 msgstr "" 12012 12013 #: kdecore/TIMEZONES:1035 12014 #, kde-format 12015 msgid "Australia/Hobart" 12016 msgstr "" 12017 12018 #. i18n: comment to the previous timezone 12019 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12020 #, kde-format 12021 msgid "Tasmania - most locations" 12022 msgstr "" 12023 12024 #. i18n: comment to the previous timezone 12025 #: kdecore/TIMEZONES:1039 12026 #, kde-format 12027 msgid "Tasmania" 12028 msgstr "" 12029 12030 #: kdecore/TIMEZONES:1040 12031 #, kde-format 12032 msgid "Australia/LHI" 12033 msgstr "" 12034 12035 #. i18n: comment to the previous timezone 12036 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12037 #, kde-format 12038 msgid "Lord Howe Island" 12039 msgstr "" 12040 12041 #: kdecore/TIMEZONES:1043 12042 #, kde-format 12043 msgid "Australia/Lindeman" 12044 msgstr "" 12045 12046 #. i18n: comment to the previous timezone 12047 #: kdecore/TIMEZONES:1045 12048 #, kde-format 12049 msgid "Queensland - Holiday Islands" 12050 msgstr "" 12051 12052 #. i18n: comment to the previous timezone 12053 #: kdecore/TIMEZONES:1047 12054 #, kde-format 12055 msgid "Queensland (Whitsunday Islands)" 12056 msgstr "" 12057 12058 #: kdecore/TIMEZONES:1048 12059 #, kde-format 12060 msgid "Australia/Lord_Howe" 12061 msgstr "" 12062 12063 #: kdecore/TIMEZONES:1051 12064 #, kde-format 12065 msgid "Australia/Melbourne" 12066 msgstr "" 12067 12068 #. i18n: comment to the previous timezone 12069 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12070 #, kde-format 12071 msgid "Victoria" 12072 msgstr "" 12073 12074 #: kdecore/TIMEZONES:1054 12075 #, kde-format 12076 msgid "Australia/NSW" 12077 msgstr "" 12078 12079 #: kdecore/TIMEZONES:1057 12080 #, kde-format 12081 msgid "Australia/North" 12082 msgstr "" 12083 12084 #: kdecore/TIMEZONES:1060 12085 #, kde-format 12086 msgid "Australia/Perth" 12087 msgstr "" 12088 12089 #. i18n: comment to the previous timezone 12090 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12091 #, kde-format 12092 msgid "Western Australia - most locations" 12093 msgstr "" 12094 12095 #. i18n: comment to the previous timezone 12096 #: kdecore/TIMEZONES:1064 12097 #, kde-format 12098 msgid "Western Australia (most areas)" 12099 msgstr "" 12100 12101 #: kdecore/TIMEZONES:1065 12102 #, kde-format 12103 msgid "Australia/Queensland" 12104 msgstr "" 12105 12106 #: kdecore/TIMEZONES:1068 12107 #, kde-format 12108 msgid "Australia/South" 12109 msgstr "" 12110 12111 #: kdecore/TIMEZONES:1071 12112 #, kde-format 12113 msgid "Australia/Sydney" 12114 msgstr "" 12115 12116 #. i18n: comment to the previous timezone 12117 #: kdecore/TIMEZONES:1075 12118 #, kde-format 12119 msgid "New South Wales (most areas)" 12120 msgstr "" 12121 12122 #: kdecore/TIMEZONES:1076 12123 #, kde-format 12124 msgid "Australia/Tasmania" 12125 msgstr "" 12126 12127 #: kdecore/TIMEZONES:1079 12128 #, kde-format 12129 msgid "Australia/Victoria" 12130 msgstr "" 12131 12132 #: kdecore/TIMEZONES:1082 12133 #, kde-format 12134 msgid "Australia/West" 12135 msgstr "" 12136 12137 #: kdecore/TIMEZONES:1085 12138 #, kde-format 12139 msgid "Australia/Yancowinna" 12140 msgstr "" 12141 12142 #: kdecore/TIMEZONES:1088 12143 #, kde-format 12144 msgid "Brazil/Acre" 12145 msgstr "" 12146 12147 #: kdecore/TIMEZONES:1091 12148 #, kde-format 12149 msgid "Brazil/DeNoronha" 12150 msgstr "" 12151 12152 #: kdecore/TIMEZONES:1094 12153 #, kde-format 12154 msgid "Brazil/East" 12155 msgstr "" 12156 12157 #: kdecore/TIMEZONES:1097 12158 #, kde-format 12159 msgid "Brazil/West" 12160 msgstr "" 12161 12162 #: kdecore/TIMEZONES:1100 12163 #, kde-format 12164 msgid "Canada/Atlantic" 12165 msgstr "" 12166 12167 #: kdecore/TIMEZONES:1103 12168 #, kde-format 12169 msgid "Canada/Central" 12170 msgstr "" 12171 12172 #: kdecore/TIMEZONES:1106 12173 #, kde-format 12174 msgid "Canada/East-Saskatchewan" 12175 msgstr "" 12176 12177 #: kdecore/TIMEZONES:1109 12178 #, kde-format 12179 msgid "Canada/Eastern" 12180 msgstr "" 12181 12182 #: kdecore/TIMEZONES:1112 12183 #, kde-format 12184 msgid "Canada/Mountain" 12185 msgstr "" 12186 12187 #: kdecore/TIMEZONES:1115 12188 #, kde-format 12189 msgid "Canada/Newfoundland" 12190 msgstr "" 12191 12192 #: kdecore/TIMEZONES:1118 12193 #, kde-format 12194 msgid "Canada/Pacific" 12195 msgstr "" 12196 12197 #: kdecore/TIMEZONES:1121 12198 #, kde-format 12199 msgid "Canada/Saskatchewan" 12200 msgstr "" 12201 12202 #: kdecore/TIMEZONES:1124 12203 #, kde-format 12204 msgid "Canada/Yukon" 12205 msgstr "" 12206 12207 #: kdecore/TIMEZONES:1127 12208 #, kde-format 12209 msgid "Chile/Continental" 12210 msgstr "" 12211 12212 #: kdecore/TIMEZONES:1130 12213 #, kde-format 12214 msgid "Chile/EasterIsland" 12215 msgstr "" 12216 12217 #. i18n: comment to the previous timezone 12218 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12219 #, kde-format 12220 msgid "Easter Island & Sala y Gomez" 12221 msgstr "" 12222 12223 #: kdecore/TIMEZONES:1133 12224 #, kde-format 12225 msgid "Cuba" 12226 msgstr "" 12227 12228 #: kdecore/TIMEZONES:1134 12229 #, kde-format 12230 msgid "Egypt" 12231 msgstr "" 12232 12233 #: kdecore/TIMEZONES:1135 12234 #, kde-format 12235 msgid "Eire" 12236 msgstr "" 12237 12238 #: kdecore/TIMEZONES:1136 12239 #, kde-format 12240 msgid "Europe/Amsterdam" 12241 msgstr "" 12242 12243 #: kdecore/TIMEZONES:1137 12244 #, kde-format 12245 msgid "Europe/Andorra" 12246 msgstr "" 12247 12248 #: kdecore/TIMEZONES:1138 12249 #, fuzzy, kde-format 12250 #| msgctxt "KCharSelect section name" 12251 #| msgid "European Alphabets" 12252 msgid "Europe/Astrakhan" 12253 msgstr "Аурупа" 12254 12255 #. i18n: comment to the previous timezone 12256 #: kdecore/TIMEZONES:1140 12257 #, kde-format 12258 msgid "MSK+01 - Astrakhan" 12259 msgstr "" 12260 12261 #: kdecore/TIMEZONES:1141 12262 #, fuzzy, kde-format 12263 #| msgctxt "KCharSelect section name" 12264 #| msgid "European Alphabets" 12265 msgid "Europe/Athens" 12266 msgstr "Аурупа" 12267 12268 #: kdecore/TIMEZONES:1142 12269 #, kde-format 12270 msgid "Europe/Belfast" 12271 msgstr "" 12272 12273 #: kdecore/TIMEZONES:1143 12274 #, kde-format 12275 msgid "Europe/Belgrade" 12276 msgstr "" 12277 12278 #: kdecore/TIMEZONES:1144 12279 #, kde-format 12280 msgid "Europe/Berlin" 12281 msgstr "" 12282 12283 #. i18n: comment to the previous timezone 12284 #: kdecore/TIMEZONES:1146 12285 #, kde-format 12286 msgid "Germany (most areas)" 12287 msgstr "" 12288 12289 #: kdecore/TIMEZONES:1147 12290 #, kde-format 12291 msgid "Europe/Bratislava" 12292 msgstr "" 12293 12294 #: kdecore/TIMEZONES:1148 12295 #, kde-format 12296 msgid "Europe/Brussels" 12297 msgstr "" 12298 12299 #: kdecore/TIMEZONES:1149 12300 #, kde-format 12301 msgid "Europe/Bucharest" 12302 msgstr "" 12303 12304 #: kdecore/TIMEZONES:1150 12305 #, fuzzy, kde-format 12306 #| msgctxt "KCharSelect section name" 12307 #| msgid "European Alphabets" 12308 msgid "Europe/Budapest" 12309 msgstr "Аурупа" 12310 12311 #: kdecore/TIMEZONES:1151 12312 #, fuzzy, kde-format 12313 #| msgctxt "KCharSelect section name" 12314 #| msgid "European Alphabets" 12315 msgid "Europe/Busingen" 12316 msgstr "Аурупа" 12317 12318 #. i18n: comment to the previous timezone 12319 #: kdecore/TIMEZONES:1153 12320 #, kde-format 12321 msgid "Busingen" 12322 msgstr "" 12323 12324 #: kdecore/TIMEZONES:1154 12325 #, kde-format 12326 msgid "Europe/Chisinau" 12327 msgstr "" 12328 12329 #: kdecore/TIMEZONES:1155 12330 #, kde-format 12331 msgid "Europe/Copenhagen" 12332 msgstr "" 12333 12334 #: kdecore/TIMEZONES:1156 12335 #, kde-format 12336 msgid "Europe/Dublin" 12337 msgstr "" 12338 12339 #: kdecore/TIMEZONES:1157 12340 #, kde-format 12341 msgid "Europe/Gibraltar" 12342 msgstr "" 12343 12344 #: kdecore/TIMEZONES:1158 12345 #, kde-format 12346 msgid "Europe/Guernsey" 12347 msgstr "" 12348 12349 #: kdecore/TIMEZONES:1159 12350 #, kde-format 12351 msgid "Europe/Helsinki" 12352 msgstr "" 12353 12354 #: kdecore/TIMEZONES:1160 12355 #, kde-format 12356 msgid "Europe/Isle_of_Man" 12357 msgstr "" 12358 12359 #: kdecore/TIMEZONES:1161 12360 #, kde-format 12361 msgid "Europe/Istanbul" 12362 msgstr "" 12363 12364 #: kdecore/TIMEZONES:1162 12365 #, kde-format 12366 msgid "Europe/Jersey" 12367 msgstr "" 12368 12369 #: kdecore/TIMEZONES:1163 12370 #, kde-format 12371 msgid "Europe/Kaliningrad" 12372 msgstr "" 12373 12374 #. i18n: comment to the previous timezone 12375 #: kdecore/TIMEZONES:1165 12376 #, kde-format 12377 msgid "Moscow-01 - Kaliningrad" 12378 msgstr "" 12379 12380 #. i18n: comment to the previous timezone 12381 #: kdecore/TIMEZONES:1167 12382 #, kde-format 12383 msgid "MSK-01 - Kaliningrad" 12384 msgstr "" 12385 12386 #: kdecore/TIMEZONES:1168 12387 #, kde-format 12388 msgid "Europe/Kiev" 12389 msgstr "" 12390 12391 #. i18n: comment to the previous timezone 12392 #: kdecore/TIMEZONES:1172 12393 #, kde-format 12394 msgid "Ukraine (most areas)" 12395 msgstr "" 12396 12397 #: kdecore/TIMEZONES:1173 12398 #, fuzzy, kde-format 12399 #| msgid "Properties" 12400 msgid "Europe/Kirov" 12401 msgstr "Сыйфатлар" 12402 12403 #. i18n: comment to the previous timezone 12404 #: kdecore/TIMEZONES:1175 12405 #, kde-format 12406 msgid "MSK+00 - Kirov" 12407 msgstr "" 12408 12409 #: kdecore/TIMEZONES:1176 12410 #, kde-format 12411 msgid "Europe/Lisbon" 12412 msgstr "" 12413 12414 #. i18n: comment to the previous timezone 12415 #: kdecore/TIMEZONES:1180 12416 #, kde-format 12417 msgid "Portugal (mainland)" 12418 msgstr "" 12419 12420 #: kdecore/TIMEZONES:1181 12421 #, kde-format 12422 msgid "Europe/Ljubljana" 12423 msgstr "" 12424 12425 #: kdecore/TIMEZONES:1182 12426 #, kde-format 12427 msgid "Europe/London" 12428 msgstr "" 12429 12430 #: kdecore/TIMEZONES:1183 12431 #, kde-format 12432 msgid "Europe/Luxembourg" 12433 msgstr "" 12434 12435 #: kdecore/TIMEZONES:1184 12436 #, kde-format 12437 msgid "Europe/Madrid" 12438 msgstr "" 12439 12440 #. i18n: comment to the previous timezone 12441 #: kdecore/TIMEZONES:1188 12442 #, kde-format 12443 msgid "Spain (mainland)" 12444 msgstr "" 12445 12446 #: kdecore/TIMEZONES:1189 12447 #, kde-format 12448 msgid "Europe/Malta" 12449 msgstr "" 12450 12451 #: kdecore/TIMEZONES:1190 12452 #, kde-format 12453 msgid "Europe/Mariehamn" 12454 msgstr "" 12455 12456 #: kdecore/TIMEZONES:1191 12457 #, kde-format 12458 msgid "Europe/Minsk" 12459 msgstr "" 12460 12461 #: kdecore/TIMEZONES:1192 12462 #, kde-format 12463 msgid "Europe/Monaco" 12464 msgstr "" 12465 12466 #: kdecore/TIMEZONES:1193 12467 #, kde-format 12468 msgid "Europe/Moscow" 12469 msgstr "" 12470 12471 #. i18n: comment to the previous timezone 12472 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12473 #, kde-format 12474 msgid "Moscow+00 - west Russia" 12475 msgstr "" 12476 12477 #. i18n: comment to the previous timezone 12478 #: kdecore/TIMEZONES:1197 12479 #, kde-format 12480 msgid "MSK+00 - Moscow area" 12481 msgstr "" 12482 12483 #: kdecore/TIMEZONES:1198 12484 #, kde-format 12485 msgid "Europe/Oslo" 12486 msgstr "" 12487 12488 #: kdecore/TIMEZONES:1199 12489 #, fuzzy, kde-format 12490 #| msgid "Properties" 12491 msgid "Europe/Paris" 12492 msgstr "Сыйфатлар" 12493 12494 #: kdecore/TIMEZONES:1200 12495 #, kde-format 12496 msgid "Europe/Podgorica" 12497 msgstr "" 12498 12499 #: kdecore/TIMEZONES:1201 12500 #, kde-format 12501 msgid "Europe/Prague" 12502 msgstr "" 12503 12504 #: kdecore/TIMEZONES:1202 12505 #, kde-format 12506 msgid "Europe/Riga" 12507 msgstr "" 12508 12509 #: kdecore/TIMEZONES:1203 12510 #, kde-format 12511 msgid "Europe/Rome" 12512 msgstr "" 12513 12514 #: kdecore/TIMEZONES:1204 12515 #, kde-format 12516 msgid "Europe/Samara" 12517 msgstr "" 12518 12519 #. i18n: comment to the previous timezone 12520 #: kdecore/TIMEZONES:1206 12521 #, kde-format 12522 msgid "Moscow+01 - Samara, Udmurtia" 12523 msgstr "" 12524 12525 #. i18n: comment to the previous timezone 12526 #: kdecore/TIMEZONES:1208 12527 #, kde-format 12528 msgid "Moscow+00 - Samara, Udmurtia" 12529 msgstr "" 12530 12531 #. i18n: comment to the previous timezone 12532 #: kdecore/TIMEZONES:1210 12533 #, kde-format 12534 msgid "MSK+01 - Samara, Udmurtia" 12535 msgstr "" 12536 12537 #: kdecore/TIMEZONES:1211 12538 #, kde-format 12539 msgid "Europe/San_Marino" 12540 msgstr "" 12541 12542 #: kdecore/TIMEZONES:1212 12543 #, kde-format 12544 msgid "Europe/Sarajevo" 12545 msgstr "" 12546 12547 #: kdecore/TIMEZONES:1213 12548 #, fuzzy, kde-format 12549 #| msgid "Properties" 12550 msgid "Europe/Saratov" 12551 msgstr "Сыйфатлар" 12552 12553 #. i18n: comment to the previous timezone 12554 #: kdecore/TIMEZONES:1215 12555 #, kde-format 12556 msgid "MSK+01 - Saratov" 12557 msgstr "" 12558 12559 #: kdecore/TIMEZONES:1216 12560 #, kde-format 12561 msgid "Europe/Simferopol" 12562 msgstr "" 12563 12564 #. i18n: comment to the previous timezone 12565 #: kdecore/TIMEZONES:1218 12566 #, fuzzy, kde-format 12567 #| msgctxt "@item Text character set" 12568 #| msgid "Central European" 12569 msgid "central Crimea" 12570 msgstr "Үзәк Аурупа" 12571 12572 #. i18n: comment to the previous timezone 12573 #: kdecore/TIMEZONES:1220 12574 #, fuzzy, kde-format 12575 #| msgid "Name: " 12576 msgid "Crimea" 12577 msgstr "Исем: " 12578 12579 #: kdecore/TIMEZONES:1221 12580 #, kde-format 12581 msgid "Europe/Skopje" 12582 msgstr "" 12583 12584 #: kdecore/TIMEZONES:1222 12585 #, kde-format 12586 msgid "Europe/Sofia" 12587 msgstr "" 12588 12589 #: kdecore/TIMEZONES:1223 12590 #, kde-format 12591 msgid "Europe/Stockholm" 12592 msgstr "" 12593 12594 #: kdecore/TIMEZONES:1224 12595 #, kde-format 12596 msgid "Europe/Tallinn" 12597 msgstr "" 12598 12599 #: kdecore/TIMEZONES:1225 12600 #, kde-format 12601 msgid "Europe/Tirane" 12602 msgstr "" 12603 12604 #: kdecore/TIMEZONES:1226 12605 #, kde-format 12606 msgid "Europe/Tiraspol" 12607 msgstr "" 12608 12609 #: kdecore/TIMEZONES:1227 12610 #, fuzzy, kde-format 12611 #| msgid "Properties" 12612 msgid "Europe/Ulyanovsk" 12613 msgstr "Сыйфатлар" 12614 12615 #. i18n: comment to the previous timezone 12616 #: kdecore/TIMEZONES:1229 12617 #, kde-format 12618 msgid "MSK+01 - Ulyanovsk" 12619 msgstr "" 12620 12621 #: kdecore/TIMEZONES:1230 12622 #, kde-format 12623 msgid "Europe/Uzhgorod" 12624 msgstr "" 12625 12626 #. i18n: comment to the previous timezone 12627 #: kdecore/TIMEZONES:1232 12628 #, kde-format 12629 msgid "Ruthenia" 12630 msgstr "" 12631 12632 #. i18n: comment to the previous timezone 12633 #: kdecore/TIMEZONES:1234 12634 #, fuzzy, kde-format 12635 #| msgid "T&ranslation" 12636 msgid "Transcarpathia" 12637 msgstr "&Тәрҗемә итү" 12638 12639 #: kdecore/TIMEZONES:1235 12640 #, kde-format 12641 msgid "Europe/Vaduz" 12642 msgstr "" 12643 12644 #: kdecore/TIMEZONES:1236 12645 #, kde-format 12646 msgid "Europe/Vatican" 12647 msgstr "" 12648 12649 #: kdecore/TIMEZONES:1237 12650 #, kde-format 12651 msgid "Europe/Vienna" 12652 msgstr "" 12653 12654 #: kdecore/TIMEZONES:1238 12655 #, kde-format 12656 msgid "Europe/Vilnius" 12657 msgstr "" 12658 12659 #: kdecore/TIMEZONES:1239 12660 #, kde-format 12661 msgid "Europe/Volgograd" 12662 msgstr "" 12663 12664 #. i18n: comment to the previous timezone 12665 #: kdecore/TIMEZONES:1241 12666 #, kde-format 12667 msgid "Moscow+00 - Caspian Sea" 12668 msgstr "" 12669 12670 #. i18n: comment to the previous timezone 12671 #: kdecore/TIMEZONES:1243 12672 #, kde-format 12673 msgid "MSK+00 - Volgograd" 12674 msgstr "" 12675 12676 #: kdecore/TIMEZONES:1244 12677 #, kde-format 12678 msgid "Europe/Warsaw" 12679 msgstr "" 12680 12681 #: kdecore/TIMEZONES:1245 12682 #, kde-format 12683 msgid "Europe/Zagreb" 12684 msgstr "" 12685 12686 #: kdecore/TIMEZONES:1246 12687 #, kde-format 12688 msgid "Europe/Zaporozhye" 12689 msgstr "" 12690 12691 #. i18n: comment to the previous timezone 12692 #: kdecore/TIMEZONES:1248 12693 #, kde-format 12694 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12695 msgstr "" 12696 12697 #. i18n: comment to the previous timezone 12698 #: kdecore/TIMEZONES:1250 12699 #, kde-format 12700 msgid "Zaporozhye and east Lugansk" 12701 msgstr "" 12702 12703 #: kdecore/TIMEZONES:1251 12704 #, kde-format 12705 msgid "Europe/Zurich" 12706 msgstr "" 12707 12708 #: kdecore/TIMEZONES:1252 12709 #, kde-format 12710 msgid "GB" 12711 msgstr "" 12712 12713 #: kdecore/TIMEZONES:1253 12714 #, kde-format 12715 msgid "GB-Eire" 12716 msgstr "" 12717 12718 #: kdecore/TIMEZONES:1254 12719 #, kde-format 12720 msgid "Hongkong" 12721 msgstr "" 12722 12723 #: kdecore/TIMEZONES:1255 12724 #, kde-format 12725 msgid "Iceland" 12726 msgstr "" 12727 12728 #: kdecore/TIMEZONES:1256 12729 #, kde-format 12730 msgid "Indian/Antananarivo" 12731 msgstr "" 12732 12733 #: kdecore/TIMEZONES:1257 12734 #, kde-format 12735 msgid "Indian/Chagos" 12736 msgstr "" 12737 12738 #: kdecore/TIMEZONES:1258 12739 #, kde-format 12740 msgid "Indian/Christmas" 12741 msgstr "" 12742 12743 #: kdecore/TIMEZONES:1259 12744 #, kde-format 12745 msgid "Indian/Cocos" 12746 msgstr "" 12747 12748 #: kdecore/TIMEZONES:1260 12749 #, kde-format 12750 msgid "Indian/Comoro" 12751 msgstr "" 12752 12753 #: kdecore/TIMEZONES:1261 12754 #, kde-format 12755 msgid "Indian/Kerguelen" 12756 msgstr "" 12757 12758 #: kdecore/TIMEZONES:1262 12759 #, kde-format 12760 msgid "Indian/Mahe" 12761 msgstr "" 12762 12763 #: kdecore/TIMEZONES:1263 12764 #, kde-format 12765 msgid "Indian/Maldives" 12766 msgstr "" 12767 12768 #: kdecore/TIMEZONES:1264 12769 #, kde-format 12770 msgid "Indian/Mauritius" 12771 msgstr "" 12772 12773 #: kdecore/TIMEZONES:1265 12774 #, kde-format 12775 msgid "Indian/Mayotte" 12776 msgstr "" 12777 12778 #: kdecore/TIMEZONES:1266 12779 #, kde-format 12780 msgid "Indian/Reunion" 12781 msgstr "" 12782 12783 #: kdecore/TIMEZONES:1267 12784 #, kde-format 12785 msgid "Iran" 12786 msgstr "" 12787 12788 #: kdecore/TIMEZONES:1268 12789 #, kde-format 12790 msgid "Israel" 12791 msgstr "" 12792 12793 #: kdecore/TIMEZONES:1269 12794 #, kde-format 12795 msgid "Jamaica" 12796 msgstr "" 12797 12798 #: kdecore/TIMEZONES:1270 12799 #, fuzzy, kde-format 12800 #| msgctxt "@item Text character set" 12801 #| msgid "Japanese" 12802 msgid "Japan" 12803 msgstr "Япон" 12804 12805 #. i18n: comment to the previous timezone 12806 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12807 #, kde-format 12808 msgid "Kwajalein" 12809 msgstr "" 12810 12811 #: kdecore/TIMEZONES:1274 12812 #, kde-format 12813 msgid "Libya" 12814 msgstr "" 12815 12816 #: kdecore/TIMEZONES:1275 12817 #, kde-format 12818 msgid "Mexico/BajaNorte" 12819 msgstr "" 12820 12821 #: kdecore/TIMEZONES:1278 12822 #, kde-format 12823 msgid "Mexico/BajaSur" 12824 msgstr "" 12825 12826 #: kdecore/TIMEZONES:1281 12827 #, fuzzy, kde-format 12828 #| msgctxt "@title:group Document information" 12829 #| msgid "General" 12830 msgid "Mexico/General" 12831 msgstr "Төп" 12832 12833 #: kdecore/TIMEZONES:1284 12834 #, kde-format 12835 msgid "NZ" 12836 msgstr "" 12837 12838 #: kdecore/TIMEZONES:1287 12839 #, kde-format 12840 msgid "NZ-CHAT" 12841 msgstr "" 12842 12843 #. i18n: comment to the previous timezone 12844 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12845 #, kde-format 12846 msgid "Chatham Islands" 12847 msgstr "" 12848 12849 #: kdecore/TIMEZONES:1290 12850 #, kde-format 12851 msgid "Navajo" 12852 msgstr "" 12853 12854 #: kdecore/TIMEZONES:1293 12855 #, kde-format 12856 msgid "PRC" 12857 msgstr "" 12858 12859 #: kdecore/TIMEZONES:1296 12860 #, kde-format 12861 msgid "Pacific/Apia" 12862 msgstr "" 12863 12864 #: kdecore/TIMEZONES:1297 12865 #, kde-format 12866 msgid "Pacific/Auckland" 12867 msgstr "" 12868 12869 #. i18n: comment to the previous timezone 12870 #: kdecore/TIMEZONES:1301 12871 #, kde-format 12872 msgid "New Zealand (most areas)" 12873 msgstr "" 12874 12875 #: kdecore/TIMEZONES:1302 12876 #, kde-format 12877 msgid "Pacific/Bougainville" 12878 msgstr "" 12879 12880 #. i18n: comment to the previous timezone 12881 #: kdecore/TIMEZONES:1304 12882 #, kde-format 12883 msgid "Bougainville" 12884 msgstr "" 12885 12886 #: kdecore/TIMEZONES:1305 12887 #, kde-format 12888 msgid "Pacific/Chatham" 12889 msgstr "" 12890 12891 #: kdecore/TIMEZONES:1308 12892 #, kde-format 12893 msgid "Pacific/Chuuk" 12894 msgstr "" 12895 12896 #. i18n: comment to the previous timezone 12897 #: kdecore/TIMEZONES:1310 12898 #, kde-format 12899 msgid "Chuuk (Truk) and Yap" 12900 msgstr "" 12901 12902 #. i18n: comment to the previous timezone 12903 #: kdecore/TIMEZONES:1312 12904 #, kde-format 12905 msgid "Chuuk/Truk, Yap" 12906 msgstr "" 12907 12908 #: kdecore/TIMEZONES:1313 12909 #, kde-format 12910 msgid "Pacific/Easter" 12911 msgstr "" 12912 12913 #. i18n: comment to the previous timezone 12914 #: kdecore/TIMEZONES:1317 12915 #, fuzzy, kde-format 12916 #| msgctxt "digit set" 12917 #| msgid "Eastern Arabic-Indic" 12918 msgid "Easter Island" 12919 msgstr "Фарсы" 12920 12921 #: kdecore/TIMEZONES:1318 12922 #, kde-format 12923 msgid "Pacific/Efate" 12924 msgstr "" 12925 12926 #: kdecore/TIMEZONES:1319 12927 #, kde-format 12928 msgid "Pacific/Enderbury" 12929 msgstr "" 12930 12931 #. i18n: comment to the previous timezone 12932 #: kdecore/TIMEZONES:1321 12933 #, kde-format 12934 msgid "Phoenix Islands" 12935 msgstr "" 12936 12937 #: kdecore/TIMEZONES:1322 12938 #, kde-format 12939 msgid "Pacific/Fakaofo" 12940 msgstr "" 12941 12942 #: kdecore/TIMEZONES:1323 12943 #, kde-format 12944 msgid "Pacific/Fiji" 12945 msgstr "" 12946 12947 #: kdecore/TIMEZONES:1324 12948 #, kde-format 12949 msgid "Pacific/Funafuti" 12950 msgstr "" 12951 12952 #: kdecore/TIMEZONES:1325 12953 #, kde-format 12954 msgid "Pacific/Galapagos" 12955 msgstr "" 12956 12957 #. i18n: comment to the previous timezone 12958 #: kdecore/TIMEZONES:1327 12959 #, kde-format 12960 msgid "Galapagos Islands" 12961 msgstr "" 12962 12963 #: kdecore/TIMEZONES:1328 12964 #, kde-format 12965 msgid "Pacific/Gambier" 12966 msgstr "" 12967 12968 #. i18n: comment to the previous timezone 12969 #: kdecore/TIMEZONES:1330 12970 #, kde-format 12971 msgid "Gambier Islands" 12972 msgstr "" 12973 12974 #: kdecore/TIMEZONES:1331 12975 #, kde-format 12976 msgid "Pacific/Guadalcanal" 12977 msgstr "" 12978 12979 #: kdecore/TIMEZONES:1332 12980 #, kde-format 12981 msgid "Pacific/Guam" 12982 msgstr "" 12983 12984 #: kdecore/TIMEZONES:1333 12985 #, kde-format 12986 msgid "Pacific/Honolulu" 12987 msgstr "" 12988 12989 #. i18n: comment to the previous timezone 12990 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 12991 #, kde-format 12992 msgid "Hawaii" 12993 msgstr "" 12994 12995 #: kdecore/TIMEZONES:1336 12996 #, kde-format 12997 msgid "Pacific/Johnston" 12998 msgstr "" 12999 13000 #. i18n: comment to the previous timezone 13001 #: kdecore/TIMEZONES:1338 13002 #, kde-format 13003 msgid "Johnston Atoll" 13004 msgstr "" 13005 13006 #: kdecore/TIMEZONES:1339 13007 #, kde-format 13008 msgid "Pacific/Kiritimati" 13009 msgstr "" 13010 13011 #. i18n: comment to the previous timezone 13012 #: kdecore/TIMEZONES:1341 13013 #, kde-format 13014 msgid "Line Islands" 13015 msgstr "" 13016 13017 #: kdecore/TIMEZONES:1342 13018 #, kde-format 13019 msgid "Pacific/Kosrae" 13020 msgstr "" 13021 13022 #. i18n: comment to the previous timezone 13023 #: kdecore/TIMEZONES:1344 13024 #, kde-format 13025 msgid "Kosrae" 13026 msgstr "" 13027 13028 #: kdecore/TIMEZONES:1345 13029 #, kde-format 13030 msgid "Pacific/Kwajalein" 13031 msgstr "" 13032 13033 #: kdecore/TIMEZONES:1348 13034 #, kde-format 13035 msgid "Pacific/Majuro" 13036 msgstr "" 13037 13038 #. i18n: comment to the previous timezone 13039 #: kdecore/TIMEZONES:1352 13040 #, kde-format 13041 msgid "Marshall Islands (most areas)" 13042 msgstr "" 13043 13044 #: kdecore/TIMEZONES:1353 13045 #, kde-format 13046 msgid "Pacific/Marquesas" 13047 msgstr "" 13048 13049 #. i18n: comment to the previous timezone 13050 #: kdecore/TIMEZONES:1355 13051 #, kde-format 13052 msgid "Marquesas Islands" 13053 msgstr "" 13054 13055 #: kdecore/TIMEZONES:1356 13056 #, kde-format 13057 msgid "Pacific/Midway" 13058 msgstr "" 13059 13060 #. i18n: comment to the previous timezone 13061 #: kdecore/TIMEZONES:1358 13062 #, kde-format 13063 msgid "Midway Islands" 13064 msgstr "" 13065 13066 #: kdecore/TIMEZONES:1359 13067 #, kde-format 13068 msgid "Pacific/Nauru" 13069 msgstr "" 13070 13071 #: kdecore/TIMEZONES:1360 13072 #, kde-format 13073 msgid "Pacific/Niue" 13074 msgstr "" 13075 13076 #: kdecore/TIMEZONES:1361 13077 #, kde-format 13078 msgid "Pacific/Norfolk" 13079 msgstr "" 13080 13081 #: kdecore/TIMEZONES:1362 13082 #, kde-format 13083 msgid "Pacific/Noumea" 13084 msgstr "" 13085 13086 #: kdecore/TIMEZONES:1363 13087 #, kde-format 13088 msgid "Pacific/Pago_Pago" 13089 msgstr "" 13090 13091 #: kdecore/TIMEZONES:1364 13092 #, kde-format 13093 msgid "Pacific/Palau" 13094 msgstr "" 13095 13096 #: kdecore/TIMEZONES:1365 13097 #, kde-format 13098 msgid "Pacific/Pitcairn" 13099 msgstr "" 13100 13101 #: kdecore/TIMEZONES:1366 13102 #, kde-format 13103 msgid "Pacific/Pohnpei" 13104 msgstr "" 13105 13106 #. i18n: comment to the previous timezone 13107 #: kdecore/TIMEZONES:1368 13108 #, kde-format 13109 msgid "Pohnpei (Ponape)" 13110 msgstr "" 13111 13112 #. i18n: comment to the previous timezone 13113 #: kdecore/TIMEZONES:1370 13114 #, kde-format 13115 msgid "Pohnpei/Ponape" 13116 msgstr "" 13117 13118 #: kdecore/TIMEZONES:1371 13119 #, kde-format 13120 msgid "Pacific/Ponape" 13121 msgstr "" 13122 13123 #. i18n: comment to the previous timezone 13124 #: kdecore/TIMEZONES:1373 13125 #, kde-format 13126 msgid "Ponape (Pohnpei)" 13127 msgstr "" 13128 13129 #: kdecore/TIMEZONES:1374 13130 #, kde-format 13131 msgid "Pacific/Port_Moresby" 13132 msgstr "" 13133 13134 #. i18n: comment to the previous timezone 13135 #: kdecore/TIMEZONES:1376 13136 #, kde-format 13137 msgid "Papua New Guinea (most areas)" 13138 msgstr "" 13139 13140 #: kdecore/TIMEZONES:1377 13141 #, kde-format 13142 msgid "Pacific/Rarotonga" 13143 msgstr "" 13144 13145 #: kdecore/TIMEZONES:1378 13146 #, kde-format 13147 msgid "Pacific/Saipan" 13148 msgstr "" 13149 13150 #: kdecore/TIMEZONES:1379 13151 #, kde-format 13152 msgid "Pacific/Samoa" 13153 msgstr "" 13154 13155 #: kdecore/TIMEZONES:1380 13156 #, kde-format 13157 msgid "Pacific/Tahiti" 13158 msgstr "" 13159 13160 #. i18n: comment to the previous timezone 13161 #: kdecore/TIMEZONES:1382 13162 #, kde-format 13163 msgid "Society Islands" 13164 msgstr "" 13165 13166 #: kdecore/TIMEZONES:1383 13167 #, kde-format 13168 msgid "Pacific/Tarawa" 13169 msgstr "" 13170 13171 #. i18n: comment to the previous timezone 13172 #: kdecore/TIMEZONES:1385 13173 #, kde-format 13174 msgid "Gilbert Islands" 13175 msgstr "" 13176 13177 #: kdecore/TIMEZONES:1386 13178 #, kde-format 13179 msgid "Pacific/Tongatapu" 13180 msgstr "" 13181 13182 #: kdecore/TIMEZONES:1387 13183 #, kde-format 13184 msgid "Pacific/Truk" 13185 msgstr "" 13186 13187 #. i18n: comment to the previous timezone 13188 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13189 #, kde-format 13190 msgid "Truk (Chuuk) and Yap" 13191 msgstr "" 13192 13193 #: kdecore/TIMEZONES:1390 13194 #, kde-format 13195 msgid "Pacific/Wake" 13196 msgstr "" 13197 13198 #. i18n: comment to the previous timezone 13199 #: kdecore/TIMEZONES:1392 13200 #, kde-format 13201 msgid "Wake Island" 13202 msgstr "" 13203 13204 #: kdecore/TIMEZONES:1393 13205 #, kde-format 13206 msgid "Pacific/Wallis" 13207 msgstr "" 13208 13209 #: kdecore/TIMEZONES:1394 13210 #, kde-format 13211 msgid "Pacific/Yap" 13212 msgstr "" 13213 13214 #: kdecore/TIMEZONES:1397 13215 #, kde-format 13216 msgid "Poland" 13217 msgstr "" 13218 13219 #: kdecore/TIMEZONES:1398 13220 #, fuzzy, kde-format 13221 #| msgid "Port" 13222 msgid "Portugal" 13223 msgstr "Порт" 13224 13225 #: kdecore/TIMEZONES:1401 13226 #, kde-format 13227 msgid "ROC" 13228 msgstr "" 13229 13230 #: kdecore/TIMEZONES:1402 13231 #, fuzzy, kde-format 13232 #| msgid "&OK" 13233 msgid "ROK" 13234 msgstr "ОК" 13235 13236 #: kdecore/TIMEZONES:1403 13237 #, kde-format 13238 msgid "Singapore" 13239 msgstr "" 13240 13241 #: kdecore/TIMEZONES:1404 13242 #, fuzzy, kde-format 13243 #| msgctxt "@item Spelling dictionary" 13244 #| msgid "Turkish" 13245 msgid "Turkey" 13246 msgstr "Төрек" 13247 13248 #: kdecore/TIMEZONES:1405 13249 #, kde-format 13250 msgid "US/Alaska" 13251 msgstr "" 13252 13253 #: kdecore/TIMEZONES:1408 13254 #, kde-format 13255 msgid "US/Aleutian" 13256 msgstr "" 13257 13258 #: kdecore/TIMEZONES:1411 13259 #, kde-format 13260 msgid "US/Arizona" 13261 msgstr "" 13262 13263 #: kdecore/TIMEZONES:1414 13264 #, fuzzy, kde-format 13265 #| msgctxt "@label center justify" 13266 #| msgid "Center" 13267 msgid "US/Central" 13268 msgstr "Үзәк буенча" 13269 13270 #: kdecore/TIMEZONES:1417 13271 #, kde-format 13272 msgid "US/East-Indiana" 13273 msgstr "" 13274 13275 #: kdecore/TIMEZONES:1420 13276 #, kde-format 13277 msgid "US/Eastern" 13278 msgstr "" 13279 13280 #: kdecore/TIMEZONES:1423 13281 #, kde-format 13282 msgid "US/Hawaii" 13283 msgstr "" 13284 13285 #: kdecore/TIMEZONES:1426 13286 #, kde-format 13287 msgid "US/Indiana-Starke" 13288 msgstr "" 13289 13290 #: kdecore/TIMEZONES:1429 13291 #, kde-format 13292 msgid "US/Michigan" 13293 msgstr "" 13294 13295 #: kdecore/TIMEZONES:1432 13296 #, kde-format 13297 msgid "US/Mountain" 13298 msgstr "" 13299 13300 #: kdecore/TIMEZONES:1435 13301 #, kde-format 13302 msgid "US/Pacific" 13303 msgstr "" 13304 13305 #: kdecore/TIMEZONES:1438 13306 #, kde-format 13307 msgid "US/Samoa" 13308 msgstr "" 13309 13310 #: kdecore/TIMEZONES:1439 13311 #, kde-format 13312 msgid "W-SU" 13313 msgstr "" 13314 13315 #. i18n: Generic sans serif font presented in font choosers. When selected, 13316 #. the system will choose a real font, mandated by distro settings. 13317 #: kdeui/fonthelpers.cpp:29 13318 #, kde-format 13319 msgctxt "@item Font name" 13320 msgid "Sans Serif" 13321 msgstr "Sans Serif" 13322 13323 #. i18n: Generic serif font presented in font choosers. When selected, 13324 #. the system will choose a real font, mandated by distro settings. 13325 #: kdeui/fonthelpers.cpp:32 13326 #, kde-format 13327 msgctxt "@item Font name" 13328 msgid "Serif" 13329 msgstr "Киртек" 13330 13331 #. i18n: Generic monospace font presented in font choosers. When selected, 13332 #. the system will choose a real font, mandated by distro settings. 13333 #: kdeui/fonthelpers.cpp:35 13334 #, kde-format 13335 msgctxt "@item Font name" 13336 msgid "Monospace" 13337 msgstr "Берара" 13338 13339 #: kdeui/k4timezonewidget.cpp:62 13340 #, kde-format 13341 msgctxt "Define an area in the time zone, like a town area" 13342 msgid "Area" 13343 msgstr "Өлкә" 13344 13345 #: kdeui/k4timezonewidget.cpp:62 13346 #, kde-format 13347 msgctxt "Time zone" 13348 msgid "Region" 13349 msgstr "Өлкә" 13350 13351 #: kdeui/k4timezonewidget.cpp:62 13352 #, kde-format 13353 msgid "Comment" 13354 msgstr "Комментарий" 13355 13356 #: kdeui/kapplication.cpp:741 13357 #, kde-format 13358 msgid "The style '%1' was not found" 13359 msgstr "Стиль «%1» не найден" 13360 13361 #: kdeui/kcolordialog.cpp:102 13362 #, kde-format 13363 msgctxt "palette name" 13364 msgid "* Recent Colors *" 13365 msgstr "* Последние цвета *" 13366 13367 #: kdeui/kcolordialog.cpp:103 13368 #, kde-format 13369 msgctxt "palette name" 13370 msgid "* Custom Colors *" 13371 msgstr "* Кулланучы төсләре *" 13372 13373 #: kdeui/kcolordialog.cpp:104 13374 #, kde-format 13375 msgctxt "palette name" 13376 msgid "Forty Colors" 13377 msgstr "Сорок основных цветов" 13378 13379 #: kdeui/kcolordialog.cpp:105 13380 #, kde-format 13381 msgctxt "palette name" 13382 msgid "Oxygen Colors" 13383 msgstr "Цвета Oxygen" 13384 13385 #: kdeui/kcolordialog.cpp:106 13386 #, kde-format 13387 msgctxt "palette name" 13388 msgid "Rainbow Colors" 13389 msgstr "Салават төсләре" 13390 13391 #: kdeui/kcolordialog.cpp:107 13392 #, kde-format 13393 msgctxt "palette name" 13394 msgid "Royal Colors" 13395 msgstr "Королевские цвета" 13396 13397 #: kdeui/kcolordialog.cpp:108 13398 #, kde-format 13399 msgctxt "palette name" 13400 msgid "Web Colors" 13401 msgstr "Web төсләре" 13402 13403 #: kdeui/kcolordialog.cpp:572 13404 #, kde-format 13405 msgid "Named Colors" 13406 msgstr "Исемләнгән төсләр" 13407 13408 #: kdeui/kcolordialog.cpp:746 13409 #, kde-format 13410 msgctxt "" 13411 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13412 "them)" 13413 msgid "" 13414 "Unable to read X11 RGB color strings. The following file location was " 13415 "examined:\n" 13416 "%2" 13417 msgid_plural "" 13418 "Unable to read X11 RGB color strings. The following file locations were " 13419 "examined:\n" 13420 "%2" 13421 msgstr[0] "" 13422 "Не удалось получить определения цветов X11 ни из одного из следующих " 13423 "расположений:\n" 13424 "%2" 13425 msgstr[1] "" 13426 "Не удалось получить определения цветов X11 ни из одного из следующих " 13427 "расположений:\n" 13428 "%2Не удалось получить определения цветов X11 ни из одного из следующих " 13429 "расположений:\n" 13430 "%2Не удалось получить определения цветов X11 из следующего расположения:\n" 13431 "%2" 13432 13433 #: kdeui/kcolordialog.cpp:997 13434 #, kde-format 13435 msgid "Select Color" 13436 msgstr "Төсне сайлагыз" 13437 13438 #: kdeui/kcolordialog.cpp:1077 13439 #, kde-format 13440 msgid "Hue:" 13441 msgstr "Оттенок:" 13442 13443 #: kdeui/kcolordialog.cpp:1083 13444 #, kde-format 13445 msgctxt "The angular degree unit (for hue)" 13446 msgid "°" 13447 msgstr "°" 13448 13449 #: kdeui/kcolordialog.cpp:1088 13450 #, kde-format 13451 msgid "Saturation:" 13452 msgstr "Насыщенность:" 13453 13454 #: kdeui/kcolordialog.cpp:1098 13455 #, kde-format 13456 msgctxt "This is the V of HSV" 13457 msgid "Value:" 13458 msgstr "Кыйммәт" 13459 13460 #: kdeui/kcolordialog.cpp:1111 13461 #, kde-format 13462 msgid "Red:" 13463 msgstr "Количество красного:" 13464 13465 #: kdeui/kcolordialog.cpp:1121 13466 #, kde-format 13467 msgid "Green:" 13468 msgstr "Количество зелёного:" 13469 13470 #: kdeui/kcolordialog.cpp:1131 13471 #, kde-format 13472 msgid "Blue:" 13473 msgstr "Количество синего:" 13474 13475 #: kdeui/kcolordialog.cpp:1152 13476 #, kde-format 13477 msgid "Alpha:" 13478 msgstr "Альфа:" 13479 13480 #: kdeui/kcolordialog.cpp:1206 13481 #, kde-format 13482 msgid "&Add to Custom Colors" 13483 msgstr "&Үзләренең төсләрегезгә өстәгез" 13484 13485 #: kdeui/kcolordialog.cpp:1234 13486 #, kde-format 13487 msgid "Name:" 13488 msgstr "Исем:" 13489 13490 #: kdeui/kcolordialog.cpp:1241 13491 #, kde-format 13492 msgid "HTML:" 13493 msgstr "HTML:" 13494 13495 #: kdeui/kcolordialog.cpp:1328 13496 #, kde-format 13497 msgid "Default color" 13498 msgstr "Алданук билгеләнгән төс" 13499 13500 #: kdeui/kcolordialog.cpp:1393 13501 #, kde-format 13502 msgid "-default-" 13503 msgstr "-алданук билгеләнгәнчә-" 13504 13505 #: kdeui/kcolordialog.cpp:1668 13506 #, kde-format 13507 msgid "-unnamed-" 13508 msgstr "-исемсез-" 13509 13510 #: kdeui/kdeprintdialog.cpp:40 13511 #, kde-format 13512 msgctxt "@title:window" 13513 msgid "Print" 13514 msgstr "Бастыру" 13515 13516 #: kdeui/kdialog.cpp:271 13517 #, kde-format 13518 msgid "&Try" 13519 msgstr "&Эшләп карау" 13520 13521 #: kdeui/kdialog.cpp:484 13522 #, kde-format 13523 msgid "modified" 13524 msgstr "үзгәргән" 13525 13526 #: kdeui/kdialog.cpp:495 13527 #, kde-format 13528 msgctxt "Document/application separator in titlebar" 13529 msgid " – " 13530 msgstr " — " 13531 13532 #: kdeui/kdialog.cpp:896 13533 #, kde-format 13534 msgid "&Details" 13535 msgstr "&Өстәмәләр" 13536 13537 #: kdeui/kdialog.cpp:1054 13538 #, kde-format 13539 msgid "Get help..." 13540 msgstr "Белешмә алу..." 13541 13542 #: kdeui/keditlistbox.cpp:324 13543 #, kde-format 13544 msgid "&Add" 13545 msgstr "&Өстәү" 13546 13547 #: kdeui/keditlistbox.cpp:336 13548 #, kde-format 13549 msgid "&Remove" 13550 msgstr "&Бетерү" 13551 13552 #: kdeui/keditlistbox.cpp:348 13553 #, kde-format 13554 msgid "Move &Up" 13555 msgstr "Өскәрәк &күчерү" 13556 13557 #: kdeui/keditlistbox.cpp:353 13558 #, kde-format 13559 msgid "Move &Down" 13560 msgstr "Аскарак &күчерү" 13561 13562 #. i18n: A shorter version of the alphabet test phrase translated in 13563 #. another message. It is displayed in the dropdown list of font previews 13564 #. (the font selection combo box), so keep it under the length equivalent 13565 #. to 60 or so proportional Latin characters. 13566 #: kdeui/kfontcombobox.cpp:48 13567 #, kde-format 13568 msgctxt "short" 13569 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13570 msgstr "Җөмһүриятебездәге матурлыкларны үзебез дә яратабыз да без, иптәшләр!" 13571 13572 #. i18n: Integer which indicates the script you used in the sample text 13573 #. for font previews in your language. For the possible values, see 13574 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13575 #. If the sample text contains several scripts, their IDs can be given 13576 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13577 #: kdeui/kfontcombobox.cpp:119 13578 #, kde-format 13579 msgctxt "Numeric IDs of scripts for font previews" 13580 msgid "1" 13581 msgstr "1" 13582 13583 #: kdeui/kfontdialog.cpp:51 13584 #, kde-format 13585 msgid "Select Font" 13586 msgstr "Хәрефне сайлау" 13587 13588 #: kdeui/kprintpreview.cpp:118 13589 #, kde-format 13590 msgid "Could not load print preview part" 13591 msgstr "Не удалось загрузить компонент предварительного просмотра" 13592 13593 #: kdeui/kprintpreview.cpp:135 13594 #, kde-format 13595 msgid "Print Preview" 13596 msgstr "Предварительный просмотр печати" 13597 13598 #: kdeui/ksystemtrayicon.cpp:153 13599 #, kde-format 13600 msgid "Minimize" 13601 msgstr "Төрү" 13602 13603 #: kdeui/ksystemtrayicon.cpp:205 13604 #, kde-format 13605 msgid "&Minimize" 13606 msgstr "&Төрү" 13607 13608 #: kdeui/ksystemtrayicon.cpp:207 13609 #, kde-format 13610 msgid "&Restore" 13611 msgstr "Тор&гызу" 13612 13613 #: kdeui/ksystemtrayicon.cpp:226 13614 #, kde-format 13615 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13616 msgstr "<qt>Сез чыннан да <b>%1</b>' чыгасыгыз киләме?</qt>" 13617 13618 #: kdeui/ksystemtrayicon.cpp:229 13619 #, kde-format 13620 msgid "Confirm Quit From System Tray" 13621 msgstr "Хәбәр итү өлкәсеннән чыгуны раслагыз" 13622 13623 #: kdeui/kundostack.cpp:47 13624 #, kde-format 13625 msgid "Redo" 13626 msgstr "Кабатлау" 13627 13628 #: kdeui/kundostack.cpp:66 13629 #, kde-format 13630 msgid "Undo" 13631 msgstr "Кире кагу" 13632 13633 #: kdeui/kuniqueapplication.cpp:79 13634 #, kde-format 13635 msgid "Do not run in the background." 13636 msgstr "Не запускать в фоновом режиме." 13637 13638 #: kdeui/kuniqueapplication.cpp:81 13639 #, kde-format 13640 msgid "Internally added if launched from Finder" 13641 msgstr "Добавлено изнутри, если запущено из Finder" 13642 13643 #: kio/kcommentwidget.cpp:68 13644 #, fuzzy, kde-format 13645 #| msgid "Add Comment" 13646 msgctxt "@label" 13647 msgid "Add Comment..." 13648 msgstr "Аңлатма өстәргә" 13649 13650 #: kio/kcommentwidget.cpp:74 13651 #, kde-format 13652 msgctxt "@label" 13653 msgid "Change..." 13654 msgstr "Үзгәртү..." 13655 13656 #: kio/kcommentwidget.cpp:128 13657 #, fuzzy, kde-format 13658 #| msgid "Change Text" 13659 msgctxt "@title:window" 13660 msgid "Change Comment" 13661 msgstr "Текстны үзгәртү" 13662 13663 #: kio/kcommentwidget.cpp:129 13664 #, fuzzy, kde-format 13665 #| msgid "Add Comment" 13666 msgctxt "@title:window" 13667 msgid "Add Comment" 13668 msgstr "Аңлатма өстәргә" 13669 13670 #: kio/kdevicelistmodel.cpp:115 13671 #, kde-format 13672 msgid "Device name" 13673 msgstr "" 13674 13675 #: kio/kdirselectdialog.cpp:136 13676 #, fuzzy, kde-format 13677 #| msgid "%1 folder" 13678 #| msgid_plural "%1 folders" 13679 msgctxt "folder name" 13680 msgid "New Folder" 13681 msgstr "%1 каталогы" 13682 13683 #: kio/kdirselectdialog.cpp:141 13684 #, fuzzy, kde-format 13685 #| msgid "%1 folder" 13686 #| msgid_plural "%1 folders" 13687 msgctxt "@title:window" 13688 msgid "New Folder" 13689 msgstr "%1 каталогы" 13690 13691 #: kio/kdirselectdialog.cpp:142 13692 #, fuzzy, kde-format 13693 #| msgctxt "@label" 13694 #| msgid "Create new tag:" 13695 msgctxt "@label:textbox" 13696 msgid "" 13697 "Create new folder in:\n" 13698 "%1" 13699 msgstr "Яңа тег:" 13700 13701 #: kio/kdirselectdialog.cpp:172 13702 #, fuzzy, kde-format 13703 #| msgid "A scheme with this name already exists." 13704 msgid "A file or folder named %1 already exists." 13705 msgstr "Мондый исемле схема инде бар." 13706 13707 #: kio/kdirselectdialog.cpp:175 13708 #, kde-format 13709 msgid "You do not have permission to create that folder." 13710 msgstr "" 13711 13712 #: kio/kdirselectdialog.cpp:290 13713 #, fuzzy, kde-format 13714 #| msgid "Select Color" 13715 msgctxt "@title:window" 13716 msgid "Select Folder" 13717 msgstr "Төсне сайлагыз" 13718 13719 #: kio/kdirselectdialog.cpp:299 13720 #, kde-format 13721 msgctxt "@action:button" 13722 msgid "New Folder..." 13723 msgstr "" 13724 13725 #: kio/kdirselectdialog.cpp:345 13726 #, kde-format 13727 msgctxt "@action:inmenu" 13728 msgid "New Folder..." 13729 msgstr "" 13730 13731 #: kio/kdirselectdialog.cpp:352 13732 #, kde-format 13733 msgctxt "@action:inmenu" 13734 msgid "Move to Trash" 13735 msgstr "" 13736 13737 #: kio/kdirselectdialog.cpp:359 13738 #, fuzzy, kde-format 13739 #| msgid "Delete" 13740 msgctxt "@action:inmenu" 13741 msgid "Delete" 13742 msgstr "Бетерү" 13743 13744 #: kio/kdirselectdialog.cpp:368 13745 #, fuzzy, kde-format 13746 #| msgid "Show hidden files" 13747 msgctxt "@option:check" 13748 msgid "Show Hidden Folders" 13749 msgstr "Качырылган файлларны чагылдыру" 13750 13751 #: kio/kdirselectdialog.cpp:375 13752 #, fuzzy, kde-format 13753 #| msgid "Properties" 13754 msgctxt "@action:inmenu" 13755 msgid "Properties" 13756 msgstr "Сыйфатлар" 13757 13758 #: kio/kfiledialog.cpp:132 13759 #, fuzzy, kde-format 13760 #| msgid "All Pages" 13761 msgid "*|All files" 13762 msgstr "Барлык битләр" 13763 13764 #: kio/kfiledialog.cpp:332 13765 #, kde-format 13766 msgid "All Supported Files" 13767 msgstr "" 13768 13769 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13770 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13771 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13772 #, kde-format 13773 msgid "Open" 13774 msgstr "Ачу" 13775 13776 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13777 #: kio/kfiledialog.cpp:838 13778 #, kde-format 13779 msgid "Save As" 13780 msgstr "... итеп саклау" 13781 13782 #: kio/kfilemetadataprovider.cpp:245 13783 #, kde-format 13784 msgctxt "@item:intable" 13785 msgid "%1 item" 13786 msgid_plural "%1 items" 13787 msgstr[0] "" 13788 msgstr[1] "" 13789 13790 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13791 #, fuzzy, kde-format 13792 #| msgid "Comment" 13793 msgctxt "@label" 13794 msgid "Comment" 13795 msgstr "Комментарий" 13796 13797 #: kio/kfilemetadataprovider.cpp:447 13798 #, fuzzy, kde-format 13799 #| msgid "modified" 13800 msgctxt "@label" 13801 msgid "Modified" 13802 msgstr "үзгәргән" 13803 13804 #: kio/kfilemetadataprovider.cpp:448 13805 #, kde-format 13806 msgctxt "@label" 13807 msgid "Owner" 13808 msgstr "" 13809 13810 #: kio/kfilemetadataprovider.cpp:449 13811 #, fuzzy, kde-format 13812 #| msgid "Permission denied" 13813 msgctxt "@label" 13814 msgid "Permissions" 13815 msgstr "Керү тыела" 13816 13817 #: kio/kfilemetadataprovider.cpp:450 13818 #, fuzzy, kde-format 13819 #| msgid "Rating" 13820 msgctxt "@label" 13821 msgid "Rating" 13822 msgstr "Бәяләү буенча" 13823 13824 #: kio/kfilemetadataprovider.cpp:451 13825 #, fuzzy, kde-format 13826 #| msgctxt "@option:check" 13827 #| msgid "Size" 13828 msgctxt "@label" 13829 msgid "Size" 13830 msgstr "Зурлык" 13831 13832 #: kio/kfilemetadataprovider.cpp:452 13833 #, fuzzy, kde-format 13834 #| msgctxt "@option:check A filter on resource type" 13835 #| msgid "Tags" 13836 msgctxt "@label" 13837 msgid "Tags" 13838 msgstr "Тэги" 13839 13840 #: kio/kfilemetadataprovider.cpp:453 13841 #, fuzzy, kde-format 13842 #| msgctxt "@action" 13843 #| msgid "Actual Size" 13844 msgctxt "@label" 13845 msgid "Total Size" 13846 msgstr "Үз зурлыгы" 13847 13848 #: kio/kfilemetadataprovider.cpp:454 13849 #, fuzzy, kde-format 13850 #| msgctxt "@label Type of file" 13851 #| msgid "Type: %1" 13852 msgctxt "@label" 13853 msgid "Type" 13854 msgstr "Төр: %1" 13855 13856 #: kio/kfilemetadatareaderprocess.cpp:234 13857 #, kde-format 13858 msgid "KFileMetaDataReader" 13859 msgstr "" 13860 13861 #: kio/kfilemetadatareaderprocess.cpp:236 13862 #, kde-format 13863 msgid "KFileMetaDataReader can be used to read metadata from a file" 13864 msgstr "" 13865 13866 #: kio/kfilemetadatareaderprocess.cpp:238 13867 #, kde-format 13868 msgid "(C) 2011, Peter Penz" 13869 msgstr "" 13870 13871 #: kio/kfilemetadatareaderprocess.cpp:239 13872 #, fuzzy, kde-format 13873 #| msgid "Peter Kelly" 13874 msgid "Peter Penz" 13875 msgstr "Peter Kelly" 13876 13877 #: kio/kfilemetadatareaderprocess.cpp:239 13878 #, fuzzy, kde-format 13879 #| msgid "Curr&ent actions:" 13880 msgid "Current maintainer" 13881 msgstr "&Хәзерге гамәлләр:" 13882 13883 #: kio/kfilemetadatareaderprocess.cpp:244 13884 #, kde-format 13885 msgid "Only the meta data that is part of the file is read" 13886 msgstr "" 13887 13888 #: kio/kfilemetadatareaderprocess.cpp:245 13889 #, kde-format 13890 msgid "List of URLs where the meta-data should be read from" 13891 msgstr "" 13892 13893 #: kio/kfilemetainfowidget.cpp:161 13894 #, fuzzy, kde-format 13895 #| msgid "Error" 13896 msgid "<Error>" 13897 msgstr "Хата" 13898 13899 #: kio/kfiletreeview.cpp:192 13900 #, fuzzy, kde-format 13901 #| msgid "Show hidden files" 13902 msgid "Show Hidden Folders" 13903 msgstr "Качырылган файлларны чагылдыру" 13904 13905 #: kio/kimageio.cpp:46 13906 #, fuzzy, kde-format 13907 #| msgctxt "KCharselect unicode block name" 13908 #| msgid "Control Pictures" 13909 msgid "All Pictures" 13910 msgstr "Значки управляющих кодов" 13911 13912 #: kio/kmetaprops.cpp:57 13913 #, fuzzy, kde-format 13914 #| msgid "Configure Shortcuts" 13915 msgctxt "@title:window" 13916 msgid "Configure Shown Data" 13917 msgstr "Төймәләр тезмәсен көйләү" 13918 13919 #: kio/kmetaprops.cpp:60 13920 #, kde-format 13921 msgctxt "@label::textbox" 13922 msgid "Select which data should be shown:" 13923 msgstr "" 13924 13925 #: kio/kmetaprops.cpp:123 13926 #, fuzzy, kde-format 13927 #| msgid "Confi&gure..." 13928 msgctxt "@action:button" 13929 msgid "Configure..." 13930 msgstr "&Көйләү..." 13931 13932 #: kio/kmetaprops.cpp:133 13933 #, fuzzy, kde-format 13934 #| msgid "Information" 13935 msgctxt "@title:tab" 13936 msgid "Information" 13937 msgstr "Мәгълумат" 13938 13939 #: kio/knfotranslator.cpp:40 13940 #, kde-format 13941 msgctxt "@label creation date" 13942 msgid "Created" 13943 msgstr "" 13944 13945 #: kio/knfotranslator.cpp:41 13946 #, fuzzy, kde-format 13947 #| msgctxt "@option:check" 13948 #| msgid "Size" 13949 msgctxt "@label file content size" 13950 msgid "Size" 13951 msgstr "Зурлык" 13952 13953 #: kio/knfotranslator.cpp:42 13954 #, kde-format 13955 msgctxt "@label file depends from" 13956 msgid "Depends" 13957 msgstr "" 13958 13959 #: kio/knfotranslator.cpp:43 13960 #, fuzzy, kde-format 13961 #| msgid "Description" 13962 msgctxt "@label" 13963 msgid "Description" 13964 msgstr "Тасвирлама" 13965 13966 #: kio/knfotranslator.cpp:44 13967 #, fuzzy, kde-format 13968 #| msgid "Key Generator" 13969 msgctxt "@label Software used to generate content" 13970 msgid "Generator" 13971 msgstr "Ачкыч ясаткычы" 13972 13973 #: kio/knfotranslator.cpp:45 13974 #, kde-format 13975 msgctxt "" 13976 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 13977 msgid "Has Part" 13978 msgstr "" 13979 13980 #: kio/knfotranslator.cpp:46 13981 #, kde-format 13982 msgctxt "" 13983 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 13984 "nie#hasLogicalPart" 13985 msgid "Has Logical Part" 13986 msgstr "" 13987 13988 #: kio/knfotranslator.cpp:47 13989 #, fuzzy, kde-format 13990 #| msgid "Start of Line" 13991 msgctxt "@label parent directory" 13992 msgid "Part of" 13993 msgstr "Юлның башы" 13994 13995 #: kio/knfotranslator.cpp:48 13996 #, kde-format 13997 msgctxt "@label" 13998 msgid "Keyword" 13999 msgstr "" 14000 14001 #: kio/knfotranslator.cpp:49 14002 #, fuzzy, kde-format 14003 #| msgid "modified" 14004 msgctxt "@label modified date of file" 14005 msgid "Modified" 14006 msgstr "үзгәргән" 14007 14008 #: kio/knfotranslator.cpp:50 14009 #, kde-format 14010 msgctxt "@label" 14011 msgid "MIME Type" 14012 msgstr "" 14013 14014 #: kio/knfotranslator.cpp:51 14015 #, fuzzy, kde-format 14016 #| msgid "Continue" 14017 msgctxt "@label" 14018 msgid "Content" 14019 msgstr "Дәвам итү" 14020 14021 #: kio/knfotranslator.cpp:52 14022 #, fuzzy, kde-format 14023 #| msgctxt "@item font size" 14024 #| msgid "Relative" 14025 msgctxt "@label" 14026 msgid "Related To" 14027 msgstr "Чагыштырма" 14028 14029 #: kio/knfotranslator.cpp:53 14030 #, fuzzy, kde-format 14031 #| msgid "S&ubject: " 14032 msgctxt "@label" 14033 msgid "Subject" 14034 msgstr "&Тема: " 14035 14036 #: kio/knfotranslator.cpp:54 14037 #, fuzzy, kde-format 14038 #| msgctxt "Title of the notified event" 14039 #| msgid "Title" 14040 msgctxt "@label music title" 14041 msgid "Title" 14042 msgstr "Баш исем" 14043 14044 #: kio/knfotranslator.cpp:55 14045 #, fuzzy, kde-format 14046 #| msgid "Failed to create Action." 14047 msgctxt "@label file URL" 14048 msgid "File Location" 14049 msgstr "Не удалось создать Action." 14050 14051 #: kio/knfotranslator.cpp:56 14052 #, kde-format 14053 msgctxt "@label" 14054 msgid "Creator" 14055 msgstr "" 14056 14057 #: kio/knfotranslator.cpp:57 14058 #, kde-format 14059 msgctxt "@label" 14060 msgid "Average Bitrate" 14061 msgstr "" 14062 14063 #: kio/knfotranslator.cpp:58 14064 #, fuzzy, kde-format 14065 #| msgid "Changelog" 14066 msgctxt "@label" 14067 msgid "Channels" 14068 msgstr "Үзгәрешләр:" 14069 14070 #: kio/knfotranslator.cpp:59 14071 #, fuzzy, kde-format 14072 #| msgid "Character:" 14073 msgctxt "@label number of characters" 14074 msgid "Characters" 14075 msgstr "Тамга:" 14076 14077 #: kio/knfotranslator.cpp:60 14078 #, kde-format 14079 msgctxt "@label" 14080 msgid "Codec" 14081 msgstr "" 14082 14083 #: kio/knfotranslator.cpp:61 14084 #, fuzzy, kde-format 14085 #| msgctxt "@label stroke color" 14086 #| msgid "Color" 14087 msgctxt "@label" 14088 msgid "Color Depth" 14089 msgstr "Төс" 14090 14091 #: kio/knfotranslator.cpp:62 14092 #, fuzzy, kde-format 14093 #| msgid "Saturation:" 14094 msgctxt "@label" 14095 msgid "Duration" 14096 msgstr "Насыщенность:" 14097 14098 #: kio/knfotranslator.cpp:63 14099 #, fuzzy, kde-format 14100 #| msgid "File" 14101 msgctxt "@label" 14102 msgid "Filename" 14103 msgstr "Файл" 14104 14105 #: kio/knfotranslator.cpp:64 14106 #, kde-format 14107 msgctxt "@label" 14108 msgid "Hash" 14109 msgstr "" 14110 14111 #: kio/knfotranslator.cpp:65 14112 #, fuzzy, kde-format 14113 #| msgctxt "keyboard-key-name" 14114 #| msgid "Right" 14115 msgctxt "@label" 14116 msgid "Height" 14117 msgstr "Уң кыры буенча" 14118 14119 #: kio/knfotranslator.cpp:66 14120 #, fuzzy, kde-format 14121 #| msgid "Insert Place&holder" 14122 msgctxt "@label" 14123 msgid "Interlace Mode" 14124 msgstr "Тутыргычны &кертеп кую" 14125 14126 #: kio/knfotranslator.cpp:67 14127 #, fuzzy, kde-format 14128 #| msgid "Line" 14129 msgctxt "@label number of lines" 14130 msgid "Lines" 14131 msgstr "Юл" 14132 14133 #: kio/knfotranslator.cpp:68 14134 #, kde-format 14135 msgctxt "@label" 14136 msgid "Programming Language" 14137 msgstr "" 14138 14139 #: kio/knfotranslator.cpp:69 14140 #, kde-format 14141 msgctxt "@label" 14142 msgid "Sample Rate" 14143 msgstr "" 14144 14145 #: kio/knfotranslator.cpp:70 14146 #, kde-format 14147 msgctxt "@label" 14148 msgid "Width" 14149 msgstr "" 14150 14151 #: kio/knfotranslator.cpp:71 14152 #, kde-format 14153 msgctxt "@label number of words" 14154 msgid "Words" 14155 msgstr "" 14156 14157 #: kio/knfotranslator.cpp:72 14158 #, kde-format 14159 msgctxt "@label EXIF aperture value" 14160 msgid "Aperture" 14161 msgstr "" 14162 14163 #: kio/knfotranslator.cpp:73 14164 #, kde-format 14165 msgctxt "@label EXIF" 14166 msgid "Exposure Bias Value" 14167 msgstr "" 14168 14169 #: kio/knfotranslator.cpp:74 14170 #, kde-format 14171 msgctxt "@label EXIF" 14172 msgid "Exposure Time" 14173 msgstr "" 14174 14175 #: kio/knfotranslator.cpp:75 14176 #, kde-format 14177 msgctxt "@label EXIF" 14178 msgid "Flash" 14179 msgstr "" 14180 14181 #: kio/knfotranslator.cpp:76 14182 #, kde-format 14183 msgctxt "@label EXIF" 14184 msgid "Focal Length" 14185 msgstr "" 14186 14187 #: kio/knfotranslator.cpp:77 14188 #, kde-format 14189 msgctxt "@label EXIF" 14190 msgid "Focal Length 35 mm" 14191 msgstr "" 14192 14193 #: kio/knfotranslator.cpp:78 14194 #, kde-format 14195 msgctxt "@label EXIF" 14196 msgid "ISO Speed Ratings" 14197 msgstr "" 14198 14199 #: kio/knfotranslator.cpp:79 14200 #, kde-format 14201 msgctxt "@label EXIF" 14202 msgid "Make" 14203 msgstr "" 14204 14205 #: kio/knfotranslator.cpp:80 14206 #, fuzzy, kde-format 14207 #| msgid "Rendering mode:" 14208 msgctxt "@label EXIF" 14209 msgid "Metering Mode" 14210 msgstr "Күрсәтү режимы:" 14211 14212 #: kio/knfotranslator.cpp:81 14213 #, kde-format 14214 msgctxt "@label EXIF" 14215 msgid "Model" 14216 msgstr "" 14217 14218 #: kio/knfotranslator.cpp:82 14219 #, fuzzy, kde-format 14220 #| msgid "Orientation" 14221 msgctxt "@label EXIF" 14222 msgid "Orientation" 14223 msgstr "Урнашу" 14224 14225 #: kio/knfotranslator.cpp:83 14226 #, fuzzy, kde-format 14227 #| msgid "White Space" 14228 msgctxt "@label EXIF" 14229 msgid "White Balance" 14230 msgstr "Буш урын" 14231 14232 #: kio/knfotranslator.cpp:84 14233 #, fuzzy, kde-format 14234 #| msgid "Not a directory" 14235 msgctxt "@label video director" 14236 msgid "Director" 14237 msgstr "Каталог түгел" 14238 14239 #: kio/knfotranslator.cpp:85 14240 #, kde-format 14241 msgctxt "@label music genre" 14242 msgid "Genre" 14243 msgstr "" 14244 14245 #: kio/knfotranslator.cpp:86 14246 #, kde-format 14247 msgctxt "@label music album" 14248 msgid "Album" 14249 msgstr "" 14250 14251 #: kio/knfotranslator.cpp:87 14252 #, kde-format 14253 msgctxt "@label" 14254 msgid "Performer" 14255 msgstr "" 14256 14257 #: kio/knfotranslator.cpp:88 14258 #, kde-format 14259 msgctxt "@label" 14260 msgid "Release Date" 14261 msgstr "" 14262 14263 #: kio/knfotranslator.cpp:89 14264 #, kde-format 14265 msgctxt "@label music track number" 14266 msgid "Track" 14267 msgstr "" 14268 14269 #: kio/knfotranslator.cpp:90 14270 #, fuzzy, kde-format 14271 #| msgctxt "@title:column The Nepomuk resource's RDF type" 14272 #| msgid "Resource Type" 14273 msgctxt "@label resource created time" 14274 msgid "Resource Created" 14275 msgstr "Ресурс төре" 14276 14277 #: kio/knfotranslator.cpp:91 14278 #, fuzzy, kde-format 14279 #| msgctxt "@title:column The Nepomuk resource label and icon" 14280 #| msgid "Resource" 14281 msgctxt "@label" 14282 msgid "Sub Resource" 14283 msgstr "Ресурс" 14284 14285 #: kio/knfotranslator.cpp:92 14286 #, fuzzy, kde-format 14287 #| msgctxt "@title:column The Nepomuk resource's RDF type" 14288 #| msgid "Resource Type" 14289 msgctxt "@label resource last modified" 14290 msgid "Resource Modified" 14291 msgstr "Ресурс төре" 14292 14293 #: kio/knfotranslator.cpp:93 14294 #, fuzzy, kde-format 14295 #| msgid "Rating" 14296 msgctxt "@label" 14297 msgid "Numeric Rating" 14298 msgstr "Бәяләү буенча" 14299 14300 #: kio/knfotranslator.cpp:94 14301 #, kde-format 14302 msgctxt "@label" 14303 msgid "Copied From" 14304 msgstr "" 14305 14306 #: kio/knfotranslator.cpp:95 14307 #, fuzzy, kde-format 14308 #| msgid "&First Page" 14309 msgctxt "@label" 14310 msgid "First Usage" 14311 msgstr "Бер&енче бит" 14312 14313 #: kio/knfotranslator.cpp:96 14314 #, fuzzy, kde-format 14315 #| msgid "&Last Page" 14316 msgctxt "@label" 14317 msgid "Last Usage" 14318 msgstr "Соңгы &бит" 14319 14320 #: kio/knfotranslator.cpp:97 14321 #, kde-format 14322 msgctxt "@label" 14323 msgid "Usage Count" 14324 msgstr "" 14325 14326 #: kio/knfotranslator.cpp:98 14327 #, kde-format 14328 msgctxt "@label" 14329 msgid "Unix File Group" 14330 msgstr "" 14331 14332 #: kio/knfotranslator.cpp:99 14333 #, kde-format 14334 msgctxt "@label" 14335 msgid "Unix File Mode" 14336 msgstr "" 14337 14338 #: kio/knfotranslator.cpp:100 14339 #, kde-format 14340 msgctxt "@label" 14341 msgid "Unix File Owner" 14342 msgstr "" 14343 14344 #: kio/knfotranslator.cpp:101 14345 #, fuzzy, kde-format 14346 #| msgctxt "@label Type of file" 14347 #| msgid "Type: %1" 14348 msgctxt "@label file type" 14349 msgid "Type" 14350 msgstr "Төр: %1" 14351 14352 #: kio/knfotranslator.cpp:102 14353 #, fuzzy, kde-format 14354 #| msgid "Translation" 14355 msgctxt "@label Number of fuzzy translations" 14356 msgid "Fuzzy Translations" 14357 msgstr "Тәрҗемә" 14358 14359 #: kio/knfotranslator.cpp:103 14360 #, fuzzy, kde-format 14361 #| msgid "Translation" 14362 msgctxt "@label Name of last translator" 14363 msgid "Last Translator" 14364 msgstr "Тәрҗемә" 14365 14366 #: kio/knfotranslator.cpp:104 14367 #, fuzzy, kde-format 14368 #| msgid "Translation" 14369 msgctxt "@label Number of obsolete translations" 14370 msgid "Obsolete Translations" 14371 msgstr "Тәрҗемә" 14372 14373 #: kio/knfotranslator.cpp:105 14374 #, fuzzy, kde-format 14375 #| msgid "Translation files for KLocale" 14376 msgctxt "@label" 14377 msgid "Translation Source Date" 14378 msgstr "KLocale өчен тәрҗемә итү файллары" 14379 14380 #: kio/knfotranslator.cpp:106 14381 #, fuzzy, kde-format 14382 #| msgid "Translation" 14383 msgctxt "@label Number of total translations" 14384 msgid "Total Translations" 14385 msgstr "Тәрҗемә" 14386 14387 #: kio/knfotranslator.cpp:107 14388 #, fuzzy, kde-format 14389 #| msgid "Translate" 14390 msgctxt "@label Number of translated strings" 14391 msgid "Translated" 14392 msgstr "Тәрҗемә итү" 14393 14394 #: kio/knfotranslator.cpp:108 14395 #, fuzzy, kde-format 14396 #| msgid "Translation" 14397 msgctxt "@label" 14398 msgid "Translation Date" 14399 msgstr "Тәрҗемә" 14400 14401 #: kio/knfotranslator.cpp:109 14402 #, fuzzy, kde-format 14403 #| msgid "Translate" 14404 msgctxt "@label Number of untranslated strings" 14405 msgid "Untranslated" 14406 msgstr "Тәрҗемә итү" 14407 14408 #: kio/kpreviewprops.cpp:51 14409 #, fuzzy, kde-format 14410 #| msgid "No Preview" 14411 msgid "P&review" 14412 msgstr "Кече сүрәт юк." 14413 14414 #: kio/kscan.cpp:49 14415 #, kde-format 14416 msgid "Acquire Image" 14417 msgstr "" 14418 14419 #: kio/kscan.cpp:97 14420 #, fuzzy, kde-format 14421 #| msgid "Copy Image" 14422 msgid "OCR Image" 14423 msgstr "Сурәтнең күчермәсен ясау" 14424 14425 #: kio/netaccess.cpp:102 14426 #, fuzzy, kde-format 14427 #| msgid "File %1 does not exist" 14428 msgid "File '%1' is not readable" 14429 msgstr "%1 файлы юк" 14430 14431 #: kio/netaccess.cpp:435 14432 #, fuzzy, kde-format 14433 #| msgid "Unknown protocol '%1'.\n" 14434 msgid "ERROR: Unknown protocol '%1'" 14435 msgstr "'%1' билгесез беркетмә.\n" 14436 14437 #: kio/passworddialog.cpp:56 14438 #, kde-format 14439 msgid "Authorization Dialog" 14440 msgstr "" 14441 14442 #: kioslave/metainfo/metainfo.cpp:98 14443 #, fuzzy, kde-format 14444 #| msgid "No suggestions for %1" 14445 msgid "No metainfo for %1" 14446 msgstr "%1 өчен вариантлар юк" 14447 14448 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14449 #: kssl/kcm/cacertificates.ui:24 14450 #, kde-format 14451 msgid "Organization / Common Name" 14452 msgstr "" 14453 14454 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14455 #: kssl/kcm/cacertificates.ui:29 14456 #, kde-format 14457 msgid "Organizational Unit" 14458 msgstr "" 14459 14460 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14461 #: kssl/kcm/cacertificates.ui:42 14462 #, fuzzy, kde-format 14463 #| msgid "&Redisplay" 14464 msgid "Display..." 14465 msgstr "Сурәтне &яңарту" 14466 14467 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14468 #: kssl/kcm/cacertificates.ui:68 14469 #, fuzzy, kde-format 14470 #| msgctxt "@item Text character set" 14471 #| msgid "Disabled" 14472 msgid "Disable" 14473 msgstr "Сүндерелгән" 14474 14475 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14476 #: kssl/kcm/cacertificates.ui:78 14477 #, fuzzy, kde-format 14478 #| msgctxt "@item Text character set" 14479 #| msgid "Disabled" 14480 msgid "Enable" 14481 msgstr "Сүндерелгән" 14482 14483 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14484 #: kssl/kcm/cacertificates.ui:104 14485 #, kde-format 14486 msgid "Remove" 14487 msgstr "Бетерү" 14488 14489 #. i18n: ectx: property (text), widget (QPushButton, add) 14490 #: kssl/kcm/cacertificates.ui:111 14491 #, kde-format 14492 msgid "Add..." 14493 msgstr "Өстәү..." 14494 14495 #: kssl/kcm/cacertificatespage.cpp:140 14496 #, fuzzy, kde-format 14497 #| msgctxt "SSL error" 14498 #| msgid "The certificate is invalid" 14499 msgid "System certificates" 14500 msgstr "Таныклык хаталы" 14501 14502 #: kssl/kcm/cacertificatespage.cpp:147 14503 #, kde-format 14504 msgid "User-added certificates" 14505 msgstr "" 14506 14507 #: kssl/kcm/cacertificatespage.cpp:302 14508 #, kde-format 14509 msgid "Pick Certificates" 14510 msgstr "" 14511 14512 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14513 #: kssl/kcm/displaycert.ui:23 14514 #, fuzzy, kde-format 14515 #| msgid "Document Information" 14516 msgid "<b>Subject Information</b>" 14517 msgstr "Документ турында мәгълумат" 14518 14519 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14520 #: kssl/kcm/displaycert.ui:39 14521 #, fuzzy, kde-format 14522 #| msgid "Document Information" 14523 msgid "<b>Issuer Information</b>" 14524 msgstr "Документ турында мәгълумат" 14525 14526 #. i18n: ectx: property (text), widget (QLabel, label) 14527 #: kssl/kcm/displaycert.ui:55 14528 #, fuzzy, kde-format 14529 #| msgctxt "@shortcut/rich" 14530 #| msgid "<b>%1</b>" 14531 msgid "<b>Other</b>" 14532 msgstr "<b>%1</b>" 14533 14534 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14535 #: kssl/kcm/displaycert.ui:64 14536 #, kde-format 14537 msgid "Validity period" 14538 msgstr "" 14539 14540 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14541 #: kssl/kcm/displaycert.ui:78 14542 #, kde-format 14543 msgid "Serial number" 14544 msgstr "" 14545 14546 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14547 #: kssl/kcm/displaycert.ui:92 14548 #, kde-format 14549 msgid "MD5 digest" 14550 msgstr "" 14551 14552 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14553 #: kssl/kcm/displaycert.ui:106 14554 #, kde-format 14555 msgid "SHA1 digest" 14556 msgstr "" 14557 14558 #: kssl/kcm/displaycertdialog.cpp:73 14559 #, kde-format 14560 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14561 msgid "%1 to %2" 14562 msgstr "" 14563 14564 #: kssl/kcm/kcmssl.cpp:37 14565 #, fuzzy, kde-format 14566 #| msgid "Configuration files" 14567 msgid "SSL Configuration Module" 14568 msgstr "Конфигурация файллары" 14569 14570 #: kssl/kcm/kcmssl.cpp:39 14571 #, kde-format 14572 msgid "Copyright 2010 Andreas Hartmetz" 14573 msgstr "" 14574 14575 #: kssl/kcm/kcmssl.cpp:40 14576 #, kde-format 14577 msgid "Andreas Hartmetz" 14578 msgstr "" 14579 14580 #: kssl/kcm/kcmssl.cpp:52 14581 #, kde-format 14582 msgid "SSL Signers" 14583 msgstr "" 14584 14585 #: kssl/ksslcertificate.cpp:202 14586 #, kde-format 14587 msgid "Signature Algorithm: " 14588 msgstr "" 14589 14590 #: kssl/ksslcertificate.cpp:203 14591 #, kde-format 14592 msgid "Unknown" 14593 msgstr "Билгесез" 14594 14595 #: kssl/ksslcertificate.cpp:206 14596 #, kde-format 14597 msgid "Signature Contents:" 14598 msgstr "" 14599 14600 #: kssl/ksslcertificate.cpp:341 14601 #, fuzzy, kde-format 14602 #| msgid "Unknown error" 14603 msgctxt "Unknown" 14604 msgid "Unknown key algorithm" 14605 msgstr "Билгесез хата" 14606 14607 #: kssl/ksslcertificate.cpp:347 14608 #, kde-format 14609 msgid "Key type: RSA (%1 bit)" 14610 msgstr "" 14611 14612 #: kssl/ksslcertificate.cpp:349 14613 #, kde-format 14614 msgid "Modulus: " 14615 msgstr "" 14616 14617 #: kssl/ksslcertificate.cpp:362 14618 #, kde-format 14619 msgid "Exponent: 0x" 14620 msgstr "" 14621 14622 #: kssl/ksslcertificate.cpp:374 14623 #, kde-format 14624 msgid "Key type: DSA (%1 bit)" 14625 msgstr "" 14626 14627 #: kssl/ksslcertificate.cpp:376 14628 #, fuzzy, kde-format 14629 #| msgid "Name: " 14630 msgid "Prime: " 14631 msgstr "Исем: " 14632 14633 #: kssl/ksslcertificate.cpp:389 14634 #, kde-format 14635 msgid "160 bit prime factor: " 14636 msgstr "" 14637 14638 #: kssl/ksslcertificate.cpp:417 14639 #, kde-format 14640 msgid "Public key: " 14641 msgstr "" 14642 14643 #: kssl/ksslcertificate.cpp:1065 14644 #, fuzzy, kde-format 14645 #| msgctxt "SSL error" 14646 #| msgid "The certificate is invalid" 14647 msgid "The certificate is valid." 14648 msgstr "Таныклык хаталы" 14649 14650 #: kssl/ksslcertificate.cpp:1067 14651 #, kde-format 14652 msgid "" 14653 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14654 "Authority) certificate can not be found." 14655 msgstr "" 14656 14657 #: kssl/ksslcertificate.cpp:1069 14658 #, kde-format 14659 msgid "" 14660 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14661 "CA's (Certificate Authority) CRL can not be found." 14662 msgstr "" 14663 14664 #: kssl/ksslcertificate.cpp:1071 14665 #, kde-format 14666 msgid "" 14667 "The decryption of the certificate's signature failed. This means it could " 14668 "not even be calculated as opposed to just not matching the expected result." 14669 msgstr "" 14670 14671 #: kssl/ksslcertificate.cpp:1073 14672 #, kde-format 14673 msgid "" 14674 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14675 "This means it could not even be calculated as opposed to just not matching " 14676 "the expected result." 14677 msgstr "" 14678 14679 #: kssl/ksslcertificate.cpp:1075 14680 #, kde-format 14681 msgid "" 14682 "The decoding of the public key of the issuer failed. This means that the " 14683 "CA's (Certificate Authority) certificate can not be used to verify the " 14684 "certificate you wanted to use." 14685 msgstr "" 14686 14687 #: kssl/ksslcertificate.cpp:1077 14688 #, fuzzy, kde-format 14689 #| msgctxt "SSL error" 14690 #| msgid "The certificate is not signed by any trusted certificate authority" 14691 msgid "" 14692 "The certificate's signature is invalid. This means that the certificate can " 14693 "not be verified." 14694 msgstr "Таныклыкда бер дә булса ышанычлы раслау үзеге имзасы табылмады" 14695 14696 #: kssl/ksslcertificate.cpp:1079 14697 #, kde-format 14698 msgid "" 14699 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14700 "that the CRL can not be verified." 14701 msgstr "" 14702 14703 #: kssl/ksslcertificate.cpp:1081 14704 #, fuzzy, kde-format 14705 #| msgctxt "SSL error" 14706 #| msgid "The certificate is invalid" 14707 msgid "The certificate is not valid, yet." 14708 msgstr "Таныклык хаталы" 14709 14710 #: kssl/ksslcertificate.cpp:1083 14711 #, fuzzy, kde-format 14712 #| msgctxt "SSL error" 14713 #| msgid "The certificate is invalid" 14714 msgid "The certificate is not valid, any more." 14715 msgstr "Таныклык хаталы" 14716 14717 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14718 #, fuzzy, kde-format 14719 #| msgctxt "SSL error" 14720 #| msgid "The certificate is invalid" 14721 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14722 msgstr "Таныклык хаталы" 14723 14724 #: kssl/ksslcertificate.cpp:1089 14725 #, fuzzy, kde-format 14726 #| msgctxt "SSL error" 14727 #| msgid "The certificate authority's certificate is invalid" 14728 msgid "The time format of the certificate's 'notBefore' field is invalid." 14729 msgstr "Раслау үзәгенең таныклыгы хаталы." 14730 14731 #: kssl/ksslcertificate.cpp:1091 14732 #, fuzzy, kde-format 14733 #| msgctxt "SSL error" 14734 #| msgid "The certificate authority's certificate is invalid" 14735 msgid "The time format of the certificate's 'notAfter' field is invalid." 14736 msgstr "Раслау үзәгенең таныклыгы хаталы." 14737 14738 #: kssl/ksslcertificate.cpp:1093 14739 #, kde-format 14740 msgid "" 14741 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14742 "field is invalid." 14743 msgstr "" 14744 14745 #: kssl/ksslcertificate.cpp:1095 14746 #, kde-format 14747 msgid "" 14748 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14749 "field is invalid." 14750 msgstr "" 14751 14752 #: kssl/ksslcertificate.cpp:1097 14753 #, kde-format 14754 msgid "The OpenSSL process ran out of memory." 14755 msgstr "" 14756 14757 #: kssl/ksslcertificate.cpp:1099 14758 #, kde-format 14759 msgid "" 14760 "The certificate is self-signed and not in the list of trusted certificates. " 14761 "If you want to accept this certificate, import it into the list of trusted " 14762 "certificates." 14763 msgstr "" 14764 14765 #: kssl/ksslcertificate.cpp:1102 14766 #, kde-format 14767 msgid "" 14768 "The certificate is self-signed. While the trust chain could be built up, the " 14769 "root CA's (Certificate Authority) certificate can not be found." 14770 msgstr "" 14771 14772 #: kssl/ksslcertificate.cpp:1104 14773 #, fuzzy, kde-format 14774 #| msgctxt "SSL error" 14775 #| msgid "" 14776 #| "The root certificate authority's certificate is not trusted for this " 14777 #| "purpose" 14778 msgid "" 14779 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14780 "your trust chain is broken." 14781 msgstr "Раслаучы тамыр үзәгенең таныклыгы бу куллану өчен ышанычлы була алмый" 14782 14783 #: kssl/ksslcertificate.cpp:1106 14784 #, kde-format 14785 msgid "" 14786 "The certificate can not be verified as it is the only certificate in the " 14787 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14788 "to import it into the list of trusted certificates." 14789 msgstr "" 14790 14791 #: kssl/ksslcertificate.cpp:1108 14792 #, kde-format 14793 msgid "The certificate chain is longer than the maximum depth specified." 14794 msgstr "" 14795 14796 #: kssl/ksslcertificate.cpp:1111 14797 #, fuzzy, kde-format 14798 #| msgctxt "SSL error" 14799 #| msgid "The certificate has been revoked" 14800 msgid "The certificate has been revoked." 14801 msgstr "Таныклык кире алынды" 14802 14803 #: kssl/ksslcertificate.cpp:1113 14804 #, fuzzy, kde-format 14805 #| msgctxt "SSL error" 14806 #| msgid "The certificate authority's certificate is invalid" 14807 msgid "The certificate's CA (Certificate Authority) is invalid." 14808 msgstr "Раслау үзәгенең таныклыгы хаталы." 14809 14810 #: kssl/ksslcertificate.cpp:1115 14811 #, kde-format 14812 msgid "" 14813 "The length of the trust chain exceeded one of the CA's (Certificate " 14814 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14815 msgstr "" 14816 14817 #: kssl/ksslcertificate.cpp:1117 14818 #, kde-format 14819 msgid "" 14820 "The certificate has not been signed for the purpose you tried to use it for. " 14821 "This means the CA (Certificate Authority) does not allow this usage." 14822 msgstr "" 14823 14824 #: kssl/ksslcertificate.cpp:1120 14825 #, fuzzy, kde-format 14826 #| msgctxt "SSL error" 14827 #| msgid "" 14828 #| "The root certificate authority's certificate is not trusted for this " 14829 #| "purpose" 14830 msgid "" 14831 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14832 "to use this certificate for." 14833 msgstr "Раслаучы тамыр үзәгенең таныклыгы бу куллану өчен ышанычлы була алмый" 14834 14835 #: kssl/ksslcertificate.cpp:1123 14836 #, fuzzy, kde-format 14837 #| msgctxt "SSL error" 14838 #| msgid "" 14839 #| "The root certificate authority's certificate is not trusted for this " 14840 #| "purpose" 14841 msgid "" 14842 "The root CA (Certificate Authority) has been marked to be rejected for the " 14843 "purpose you tried to use it for." 14844 msgstr "Раслаучы тамыр үзәгенең таныклыгы бу куллану өчен ышанычлы була алмый" 14845 14846 #: kssl/ksslcertificate.cpp:1125 14847 #, kde-format 14848 msgid "" 14849 "The certificate's CA (Certificate Authority) does not match the CA name of " 14850 "the certificate." 14851 msgstr "" 14852 14853 #: kssl/ksslcertificate.cpp:1127 14854 #, fuzzy, kde-format 14855 #| msgctxt "SSL error" 14856 #| msgid "" 14857 #| "The certificate authority's certificate is marked to reject this " 14858 #| "certificate's purpose" 14859 msgid "" 14860 "The CA (Certificate Authority) certificate's key ID does not match the key " 14861 "ID in the 'Issuer' section of the certificate you are trying to use." 14862 msgstr "Раслаучы тамыр үзәгенең таныклыгы бу куллану өчен яраксыз" 14863 14864 #: kssl/ksslcertificate.cpp:1129 14865 #, kde-format 14866 msgid "" 14867 "The CA (Certificate Authority) certificate's key ID and name do not match " 14868 "the key ID and name in the 'Issuer' section of the certificate you are " 14869 "trying to use." 14870 msgstr "" 14871 14872 #: kssl/ksslcertificate.cpp:1131 14873 #, fuzzy, kde-format 14874 #| msgctxt "SSL error" 14875 #| msgid "" 14876 #| "The certificate authority's certificate is marked to reject this " 14877 #| "certificate's purpose" 14878 msgid "" 14879 "The certificate's CA (Certificate Authority) is not allowed to sign " 14880 "certificates." 14881 msgstr "Раслаучы тамыр үзәгенең таныклыгы бу куллану өчен яраксыз" 14882 14883 #: kssl/ksslcertificate.cpp:1133 14884 #, fuzzy, kde-format 14885 #| msgid "The rating could not be submitted." 14886 msgid "OpenSSL could not be verified." 14887 msgstr "Бәя күтәрү таләбен эшкәрткәндә хата килеп чыкты." 14888 14889 #: kssl/ksslcertificate.cpp:1137 14890 #, kde-format 14891 msgid "" 14892 "The signature test for this certificate failed. This could mean that the " 14893 "signature of this certificate or any in its trust path are invalid, could " 14894 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14895 "verified. If you see this message, please let the author of the software you " 14896 "are using know that he or she should use the new, more specific error " 14897 "messages." 14898 msgstr "" 14899 14900 #: kssl/ksslcertificate.cpp:1139 14901 #, kde-format 14902 msgid "" 14903 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14904 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14905 "valid yet or not valid any more. If you see this message, please let the " 14906 "author of the software you are using know that he or she should use the new, " 14907 "more specific error messages." 14908 msgstr "" 14909 14910 #: kssl/ksslcertificate.cpp:1145 14911 #, kde-format 14912 msgid "" 14913 "Certificate signing authority root files could not be found so the " 14914 "certificate is not verified." 14915 msgstr "" 14916 14917 #: kssl/ksslcertificate.cpp:1147 14918 #, fuzzy, kde-format 14919 #| msgid "The style '%1' was not found" 14920 msgid "SSL support was not found." 14921 msgstr "Стиль «%1» не найден" 14922 14923 #: kssl/ksslcertificate.cpp:1149 14924 #, fuzzy, kde-format 14925 #| msgid "The removal request failed." 14926 msgid "Private key test failed." 14927 msgstr "Берерүгә таләпне эшкәрткәндә хата килеп чыкты." 14928 14929 #: kssl/ksslcertificate.cpp:1151 14930 #, fuzzy, kde-format 14931 #| msgctxt "SSL error" 14932 #| msgid "The certificate is unsuitable for this purpose" 14933 msgid "The certificate has not been issued for this host." 14934 msgstr "Таныклык бернинди куллану өлкәсенә туры килми" 14935 14936 #: kssl/ksslcertificate.cpp:1153 14937 #, fuzzy, kde-format 14938 #| msgctxt "SSL error" 14939 #| msgid "The certificate is invalid" 14940 msgid "This certificate is not relevant." 14941 msgstr "Таныклык хаталы" 14942 14943 #: kssl/ksslcertificate.cpp:1158 14944 #, fuzzy, kde-format 14945 #| msgctxt "SSL error" 14946 #| msgid "The certificate is invalid" 14947 msgid "The certificate is invalid." 14948 msgstr "Таныклык хаталы" 14949 14950 #: kssl/ksslutils.cpp:90 14951 #, kde-format 14952 msgid "GMT" 14953 msgstr "" 14954 14955 #, fuzzy 14956 #~| msgid "(C) 2000 Stephan Kulow" 14957 #~ msgid "(C) 2007 Will Stephenson" 14958 #~ msgstr "(C) 2000 Stephan Kulow" 14959 14960 #, fuzzy 14961 #~| msgid "" 14962 #~| "<html><head><meta name=\"qrichtext\" content=\"1\" /></head><body style=" 14963 #~| "\" white-space: pre-wrap; font-family:Sans Serif; font-weight:400; font-" 14964 #~| "style:normal; text-decoration:none;\"><p style=\" margin-top:0px; margin-" 14965 #~| "bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-" 14966 #~| "indent:0px;\">(do not know yet)</p></body></html>" 14967 #~ msgid "" 14968 #~ "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/" 14969 #~ "css\">\n" 14970 #~ "p, li { white-space: pre-wrap; }\n" 14971 #~ "</style></head><body style=\" font-family:'Sans Serif'; font-size:11pt; " 14972 #~ "font-weight:400; font-style:normal;\">\n" 14973 #~ "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" 14974 #~ "right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" 14975 #~ "size:x-large; font-weight:600;\">Service for KDE 4 Offline Mode</span></" 14976 #~ "p></body></html>" 14977 #~ msgstr "" 14978 #~ "<html><head><meta name=\"qrichtext\" content=\"1\" /></head><body style=" 14979 #~ "\" white-space: pre-wrap; font-family:Sans Serif; font-weight:400; font-" 14980 #~ "style:normal; text-decoration:none;\"><p style=\" margin-top:0px; margin-" 14981 #~ "bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-" 14982 #~ "indent:0px;\">(мәгълүматсыз)</p></body></html>" 14983 14984 #, fuzzy 14985 #~| msgctxt "State of the notified event" 14986 #~| msgid "State" 14987 #~ msgid "Status:" 14988 #~ msgstr "Торыш" 14989 14990 #, fuzzy 14991 #~| msgid "Changelog:" 14992 #~ msgid "Change to:" 14993 #~ msgstr "Үзгәрешләр:" 14994 14995 #, fuzzy 14996 #~| msgid "Connection refused" 14997 #~ msgid "Connecting" 14998 #~ msgstr "Элемтә кире кагылды" 14999 15000 #, fuzzy 15001 #~| msgid "Connection refused" 15002 #~ msgid "Connected" 15003 #~ msgstr "Элемтә кире кагылды" 15004 15005 #, fuzzy 15006 #~| msgctxt "@item font" 15007 #~| msgid "Italic" 15008 #~ msgctxt "color" 15009 #~ msgid "alice" 15010 #~ msgstr "Курсив" 15011 15012 #, fuzzy 15013 #~| msgctxt "dictionary variant" 15014 #~| msgid "medium" 15015 #~ msgctxt "color" 15016 #~ msgid "dim" 15017 #~ msgstr "уртак" 15018 15019 #, fuzzy 15020 #~| msgid "Before" 15021 #~ msgctxt "color" 15022 #~ msgid "forest" 15023 #~ msgstr "Моңа кадәр" 15024 15025 #, fuzzy 15026 #~| msgctxt "keyboard-key-name" 15027 #~| msgid "Right" 15028 #~ msgctxt "color" 15029 #~ msgid "light" 15030 #~ msgstr "Уң кыры буенча" 15031 15032 #, fuzzy 15033 #~| msgctxt "dictionary variant" 15034 #~| msgid "medium" 15035 #~ msgctxt "color" 15036 #~ msgid "medium" 15037 #~ msgstr "уртак" 15038 15039 #, fuzzy 15040 #~| msgctxt "keyboard-key-name" 15041 #~| msgid "Right" 15042 #~ msgctxt "color" 15043 #~ msgid "midnight" 15044 #~ msgstr "Уң кыры буенча" 15045 15046 #, fuzzy 15047 #~| msgctxt "@item font" 15048 #~| msgid "Bold" 15049 #~ msgctxt "color" 15050 #~ msgid "old" 15051 #~ msgstr "Калын" 15052 15053 #, fuzzy 15054 #~| msgid "Translate" 15055 #~ msgctxt "color" 15056 #~ msgid "slate" 15057 #~ msgstr "Тәрҗемә итү" 15058 15059 #~ msgid "Name" 15060 #~ msgstr "Исем" 15061 15062 #~ msgid "Host" 15063 #~ msgstr "Үзәк" 15064 15065 #~ msgid "i18n() takes at least one argument" 15066 #~ msgstr "i18n() функциясе бер аргумент булса да таләп итә" 15067 15068 #~ msgid "i18nc() takes at least two arguments" 15069 #~ msgstr "i18nс() функциясе ике аргумент булса да таләп итә" 15070 15071 #~ msgid "i18np() takes at least two arguments" 15072 #~ msgstr "i18nз() функциясе ике аргумент булса да таләп итә" 15073 15074 #~ msgid "i18ncp() takes at least three arguments" 15075 #~ msgstr "i18nсз() функциясе өч аргумент булса да таләп итә" 15076 15077 #~ msgid "System Default (currently: %1)" 15078 #~ msgstr "Үрнәкле (хәзер: %1)" 15079 15080 #~ msgid "Editor Chooser" 15081 #~ msgstr "Сайланылган мөхәррир" 15082 15083 #~ msgid "" 15084 #~ "Please choose the default text editing component that you wish to use in " 15085 #~ "this application. If you choose <B>System Default</B>, the application " 15086 #~ "will honor your changes in the System Settings. All other choices will " 15087 #~ "override that setting." 15088 #~ msgstr "" 15089 #~ "Бу кушымтада үрнәк булган текст мөһәррире компонентын сайлагыз. Әгәр сез " 15090 #~ "<B>Стандарт</B> дигән көйләүне сайласагыз, система көйләүләрендә " 15091 #~ "күрсәтелгән компонент кулланылачак. Башкабөтен вариантлар беренчелектә " 15092 #~ "тора." 15093 15094 #~ msgid "" 15095 #~ "The template needs information about you, which is stored in your address " 15096 #~ "book.\n" 15097 #~ "However, the required plugin could not be loaded.\n" 15098 #~ "\n" 15099 #~ "Please install the KDEPIM/Kontact package for your system." 15100 #~ msgstr "" 15101 #~ "Калыпны тутыру өчен сезнең турында адрес китабында сакланган мәгълумат " 15102 #~ "кирәк.\n" 15103 #~ "Мондый вазифалы өстәлмә табылмады.\n" 15104 #~ "\n" 15105 #~ "KDEPIM/Kontact төргәген урнаштырыгыз." 15106 15107 #, fuzzy 15108 #~| msgid "Test" 15109 #~ msgid "TETest" 15110 #~ msgstr "Тикшерү" 15111 15112 #~ msgid "Only local files are supported." 15113 #~ msgstr "Урынлы файллар гына эшли ала." 15114 15115 #~ msgid "Keep output results from scripts" 15116 #~ msgstr "Скриптлардан чыгу кодларын саклау" 15117 15118 #~ msgid "Check whether config file itself requires updating" 15119 #~ msgstr "Конфигурация файлы яңартуны таләп итә икәнен тикшерү" 15120 15121 #~ msgid "File to read update instructions from" 15122 #~ msgstr "Файлдан яңарту турында кулланманы уку" 15123 15124 #~ msgid "KConf Update" 15125 #~ msgstr "KConf Update" 15126 15127 #~ msgid "KDE Tool for updating user configuration files" 15128 #~ msgstr "Кулланучыларның көйләү файлларын яңартучы KDE коралы" 15129 15130 #~ msgid "(c) 2001, Waldo Bastian" 15131 #~ msgstr "© Waldo Bastian, 2001" 15132 15133 #~ msgid "Waldo Bastian" 15134 #~ msgstr "~Waldo Bastian" 15135 15136 #~ msgid "??" 15137 #~ msgstr "??" 15138 15139 #~ msgid "&About" 15140 #~ msgstr "KDE &чолганышы турында" 15141 15142 #~ msgid "" 15143 #~ "No information available.\n" 15144 #~ "The supplied KAboutData object does not exist." 15145 #~ msgstr "" 15146 #~ "Кызганычка каршы, мәгълүмат юк.\n" 15147 #~ "KAboutData кушымта объектын тәкъдим итмәде." 15148 15149 #~ msgid "A&uthor" 15150 #~ msgstr "А&втор" 15151 15152 #~ msgid "A&uthors" 15153 #~ msgstr "&Авторлар" 15154 15155 #~ msgid "" 15156 #~ "Please use <a href=\"http://bugs.kde.org\">http://bugs.kde.org</a> to " 15157 #~ "report bugs.\n" 15158 #~ msgstr "" 15159 #~ "Хаталар турында хәбәрләү өчен <a href=\"http://bugs.kde.org\">http://" 15160 #~ "bugs. kde.org</a> белән кулланыгыз.\n" 15161 15162 #~ msgid "Please report bugs to <a href=\"mailto:%1\">%2</a>.\n" 15163 #~ msgstr "" 15164 #~ "Ялгышлар турында хәбәр итү өчен <a href=\"mailto:%1\">%2</a> белән " 15165 #~ "кулланыгыз.\n" 15166 15167 #~ msgid "&Thanks To" 15168 #~ msgstr "&Рәхмәтләр" 15169 15170 #~ msgid "&License Agreement" 15171 #~ msgstr "&Лицензия" 15172 15173 #~ msgid "Email" 15174 #~ msgstr "E-mail" 15175 15176 #~ msgid "Homepage" 15177 #~ msgstr "Албит" 15178 15179 #~ msgid "Task" 15180 #~ msgstr "Мәсьәлә" 15181 15182 #~ msgid "" 15183 #~ "<html><font size=\"5\">%1</font><br/><b>version %2</b><br/>Using KDE %3</" 15184 #~ "html>" 15185 #~ msgstr "" 15186 #~ "<html><font size=\"5\">%1</font><br/><b>%2 юрамасы</b><br/>KDE %3 " 15187 #~ "кулланыла</html>" 15188 15189 #~ msgid "%1 %2, %3" 15190 #~ msgstr "%1 %2, %3" 15191 15192 #~ msgid "Other Contributors:" 15193 #~ msgstr "Башка катнашучылар:" 15194 15195 #~ msgid "(No logo available)" 15196 #~ msgstr "(Билге юк)" 15197 15198 #~ msgid "About %1" 15199 #~ msgstr "%1 турында" 15200 15201 #~ msgid "Undo: %1" 15202 #~ msgstr "Кире кагу: %1" 15203 15204 #~ msgid "Redo: %1" 15205 #~ msgstr "Кабатлау: %1" 15206 15207 #~ msgid "&Undo" 15208 #~ msgstr "Гамәлне кире кагу" 15209 15210 #~ msgid "&Redo" 15211 #~ msgstr "&Кире кагылган гамәлне кабатлау" 15212 15213 #~ msgid "&Undo: %1" 15214 #~ msgstr "&Кире кагу: %1" 15215 15216 #~ msgid "&Redo: %1" 15217 #~ msgstr "&Кабатлау: %1" 15218 15219 #~ msgid "Close" 15220 #~ msgstr "Ябу" 15221 15222 #~ msgctxt "Freeze the window geometry" 15223 #~ msgid "Freeze" 15224 #~ msgstr "Катыру" 15225 15226 #~ msgctxt "Dock this window" 15227 #~ msgid "Dock" 15228 #~ msgstr "Эченә салу" 15229 15230 #~ msgid "Hide %1" 15231 #~ msgstr "%1'не яшерү" 15232 15233 #~ msgid "Search Columns" 15234 #~ msgstr "Эзләү баганалары" 15235 15236 #~ msgid "All Visible Columns" 15237 #~ msgstr "Бар күрсәтелгән баганалар" 15238 15239 #~ msgctxt "Column number %1" 15240 #~ msgid "Column No. %1" 15241 #~ msgstr "%1 номерлы багана" 15242 15243 #~ msgid "S&earch:" 15244 #~ msgstr "&Эзләү:" 15245 15246 #~ msgid "&Password:" 15247 #~ msgstr "&Серсүз:" 15248 15249 #~ msgid "&Keep password" 15250 #~ msgstr "Серсүзне сак&лау" 15251 15252 #~ msgid "&Verify:" 15253 #~ msgstr "&Тикшерү:" 15254 15255 #~ msgid "Password strength meter:" 15256 #~ msgstr "Серсүзнең көче:" 15257 15258 #~ msgid "" 15259 #~ "The password strength meter gives an indication of the security of the " 15260 #~ "password you have entered. To improve the strength of the password, " 15261 #~ "try:\n" 15262 #~ " - using a longer password;\n" 15263 #~ " - using a mixture of upper- and lower-case letters;\n" 15264 #~ " - using numbers or symbols, such as #, as well as letters." 15265 #~ msgstr "" 15266 #~ "Датчик кертелгән серсүзнең саклангычын яки ышанычлыгын күрсәтә. Серсүзнең " 15267 #~ "ышанычлыгын үстерү өчен:\n" 15268 #~ "- ул ничек булса да озынрак булырга;\n" 15269 #~ "- үз эченә баш һәм юл хәрефлерен алырга;\n" 15270 #~ "- хәрефләрдән тыш анда саннар һәм махсус билгеләр (мәс. %, ?...) керергә " 15271 #~ "тиеш." 15272 15273 #~ msgid "Passwords do not match" 15274 #~ msgstr "Серсүзләр туры килми" 15275 15276 #~ msgid "You entered two different passwords. Please try again." 15277 #~ msgstr "Кертелгән серсүзләр туры килми. Тагын бер мәртәбә җыеп карагыз." 15278 15279 #~ msgid "" 15280 #~ "The password you have entered has a low strength. To improve the strength " 15281 #~ "of the password, try:\n" 15282 #~ " - using a longer password;\n" 15283 #~ " - using a mixture of upper- and lower-case letters;\n" 15284 #~ " - using numbers or symbols as well as letters.\n" 15285 #~ "\n" 15286 #~ "Would you like to use this password anyway?" 15287 #~ msgstr "" 15288 #~ "Серсүз бик ышанычлы түгел. Серсүзнең ышанычлыгын үстерү өчен:\n" 15289 #~ "- ул ничек булса да озынрак булырга;\n" 15290 #~ "- үз эченә баш һәм юл хәрефлерен алырга;\n" 15291 #~ "- хәрефләрдән тыш анда саннар һәм махсус билгеләр (мәс. %, ?...) керергә " 15292 #~ "тиеш.\n" 15293 #~ "\n" 15294 #~ "Кертелгән серсүзне кулланырга телисезме?" 15295 15296 #~ msgid "Low Password Strength" 15297 #~ msgstr "Бик ышанычлы серсүз түгел" 15298 15299 #~ msgid "Password Input" 15300 #~ msgstr "Серсүзне җыю" 15301 15302 #~ msgid "Password is empty" 15303 #~ msgstr "Серсүз буш" 15304 15305 #~ msgid "Password must be at least 1 character long" 15306 #~ msgid_plural "Password must be at least %1 characters long" 15307 #~ msgstr[0] "Серсүзнең озынлыгы 1 тамгадан зуррак булырга тиеш." 15308 #~ msgstr[1] "Серсүзнең озынлыгы %1 тамгадан зуррак булырга тиеш." 15309 15310 #~ msgid "Passwords match" 15311 #~ msgstr "Серсүзләр туры килә" 15312 15313 #~ msgctxt "@option:check" 15314 #~ msgid "Do Spellchecking" 15315 #~ msgstr "Дөрес язылышны тикшерү" 15316 15317 #~ msgctxt "@option:check" 15318 #~ msgid "Create &root/affix combinations not in dictionary" 15319 #~ msgstr "Тамыр/аффикс &тезмәләрен сүзлектән читтә ясау" 15320 15321 #~ msgctxt "@option:check" 15322 #~ msgid "Consider run-together &words as spelling errors" 15323 #~ msgstr "Б&ергә язылган сүзләрне хаталы дип санау" 15324 15325 #~ msgctxt "@label:listbox" 15326 #~ msgid "&Dictionary:" 15327 #~ msgstr "С&үзлек:" 15328 15329 #~ msgctxt "@label:listbox" 15330 #~ msgid "&Encoding:" 15331 #~ msgstr "&Кодлашу:" 15332 15333 #~ msgctxt "@item:inlistbox Spell checker" 15334 #~ msgid "International <application>Ispell</application>" 15335 #~ msgstr "Халыкара <application>Ispell</application>" 15336 15337 #~ msgctxt "@item:inlistbox Spell checker" 15338 #~ msgid "<application>Aspell</application>" 15339 #~ msgstr "<application>Aspell</application>" 15340 15341 #~ msgctxt "@item:inlistbox Spell checker" 15342 #~ msgid "<application>Hspell</application>" 15343 #~ msgstr "<application>Hspell</application>" 15344 15345 #~ msgctxt "@item:inlistbox Spell checker" 15346 #~ msgid "<application>Zemberek</application>" 15347 #~ msgstr "<application>Zemberek</application>" 15348 15349 #~ msgctxt "@item:inlistbox Spell checker" 15350 #~ msgid "<application>Hunspell</application>" 15351 #~ msgstr "<application>Hunspell</application>" 15352 15353 #~ msgctxt "@label:listbox" 15354 #~ msgid "&Client:" 15355 #~ msgstr "~&Тикшерү кушымтасы:" 15356 15357 #~ msgctxt "@item Spelling dictionary" 15358 #~ msgid "English" 15359 #~ msgstr "Инглиз" 15360 15361 #~ msgctxt "@item Spelling dictionary" 15362 #~ msgid "Spanish" 15363 #~ msgstr "Испан" 15364 15365 #~ msgctxt "@item Spelling dictionary" 15366 #~ msgid "Danish" 15367 #~ msgstr "Дания" 15368 15369 #~ msgctxt "@item Spelling dictionary" 15370 #~ msgid "German" 15371 #~ msgstr "Алман" 15372 15373 #~ msgctxt "@item Spelling dictionary" 15374 #~ msgid "German (new spelling)" 15375 #~ msgstr "Алман (яңа язу)" 15376 15377 #~ msgctxt "@item Spelling dictionary" 15378 #~ msgid "Brazilian Portuguese" 15379 #~ msgstr "Португал (Бразилия)" 15380 15381 #~ msgctxt "@item Spelling dictionary" 15382 #~ msgid "Portuguese" 15383 #~ msgstr "Португал" 15384 15385 #~ msgctxt "@item Spelling dictionary" 15386 #~ msgid "Esperanto" 15387 #~ msgstr "Эсперанто" 15388 15389 #~ msgctxt "@item Spelling dictionary" 15390 #~ msgid "Norwegian" 15391 #~ msgstr "Норвеж" 15392 15393 #~ msgctxt "@item Spelling dictionary" 15394 #~ msgid "Russian" 15395 #~ msgstr "Рус" 15396 15397 #~ msgctxt "@item Spelling dictionary" 15398 #~ msgid "Slovenian" 15399 #~ msgstr "Словен" 15400 15401 #~ msgctxt "@item Spelling dictionary" 15402 #~ msgid "Slovak" 15403 #~ msgstr "Словак" 15404 15405 #~ msgctxt "@item Spelling dictionary" 15406 #~ msgid "Czech" 15407 #~ msgstr "Чех" 15408 15409 #~ msgctxt "@item Spelling dictionary" 15410 #~ msgid "Swedish" 15411 #~ msgstr "Швед" 15412 15413 #~ msgctxt "@item Spelling dictionary" 15414 #~ msgid "Swiss German" 15415 #~ msgstr "Алман (Швейцария)" 15416 15417 #~ msgctxt "@item Spelling dictionary" 15418 #~ msgid "Ukrainian" 15419 #~ msgstr "Украин" 15420 15421 #~ msgctxt "@item Spelling dictionary" 15422 #~ msgid "Lithuanian" 15423 #~ msgstr "Литва" 15424 15425 #~ msgctxt "@item Spelling dictionary" 15426 #~ msgid "French" 15427 #~ msgstr "Француз" 15428 15429 #~ msgctxt "@item Spelling dictionary" 15430 #~ msgid "Belarusian" 15431 #~ msgstr "Белорус" 15432 15433 #~ msgctxt "@item Spelling dictionary" 15434 #~ msgid "Hungarian" 15435 #~ msgstr "Венгер" 15436 15437 #~ msgctxt "@item Spelling dictionary" 15438 #~ msgid "Unknown" 15439 #~ msgstr "Билгесез" 15440 15441 #~ msgctxt "@item Spelling dictionary" 15442 #~ msgid "<application>ISpell</application> Default" 15443 #~ msgstr "<application>ISpell</application> Алданук" 15444 15445 #~ msgctxt "@item Spelling dictionary: %1 dictionary name, %2 file name" 15446 #~ msgid "Default - %1 [%2]" 15447 #~ msgstr "Үрнәкле: %1 [%2]" 15448 15449 #~ msgctxt "@item Spelling dictionary" 15450 #~ msgid "<application>ASpell</application> Default" 15451 #~ msgstr "<application>ASpell</application> үрнәкле" 15452 15453 #~ msgctxt "@item Spelling dictionary: %1 dictionary name" 15454 #~ msgid "Default - %1" 15455 #~ msgstr "Үрнәкле: %1" 15456 15457 #~ msgctxt "@item Spelling dictionary" 15458 #~ msgid "<application>Hunspell</application> Default" 15459 #~ msgstr "<application>Hunspell</application> үрнәкле" 15460 15461 #~ msgid "You have to restart the dialog for changes to take effect" 15462 #~ msgstr "Үзгәрешләр гамәлгә керсен өчен, диалогны яңача җибәрергә кирәк" 15463 15464 #~ msgid "Spell Checker" 15465 #~ msgstr "Дөрес язылышны тикшерү" 15466 15467 #~ msgid "Check Spelling" 15468 #~ msgstr "Дөрес язылышны тикшерү" 15469 15470 #~ msgid "&Finished" 15471 #~ msgstr "&Әзер" 15472 15473 #~ msgid "" 15474 #~ "<qt><p>This word was considered to be an \"unknown word\" because it does " 15475 #~ "not match any entry in the dictionary currently in use. It may also be a " 15476 #~ "word in a foreign language.</p>\n" 15477 #~ "<p>If the word is not misspelled, you may add it to the dictionary by " 15478 #~ "clicking <b>Add to Dictionary</b>. If you do not want to add the unknown " 15479 #~ "word to the dictionary, but you want to leave it unchanged, click " 15480 #~ "<b>Ignore</b> or <b>Ignore All</b>.</p>\n" 15481 #~ "<p>However, if the word is misspelled, you can try to find the correct " 15482 #~ "replacement in the list below. If you cannot find a replacement there, " 15483 #~ "you may type it in the text box below, and click <b>Replace</b> or " 15484 #~ "<b>Replace All</b>.</p>\n" 15485 #~ "</qt>" 15486 #~ msgstr "" 15487 #~ "<qt><p>Бу сүз сүзлектә табылмады. Бәлки бу чит ил сүзе, ә бәлки " 15488 #~ "неологизмдыр.</p>\n" 15489 #~ "<p>Әгәр сүзнең язылышы дөрес икән, <b>Сүзлеккә кушу</b> төймәсенә " 15490 #~ "басыгыз. Әгәр дә сез моны эшлисегез килмәсә, <b>Төшереп калдыру</b> яки " 15491 #~ "<b>Бөтенләйгә төшереп калдыру</b> төймәләренә баса аласыз. </p>\n" 15492 #~ "<p>Кире очракта, суз хаталы булса, исемлектән яраклы вариантны сайлап " 15493 #~ "алыгыз. Әгәр дә андый сүз булмаса, аны кулдан кертеп <b>Алыштыру</b> яки " 15494 #~ "<b>Барысын алыштыру</b> төймәсенә басыгыз.</p>\n" 15495 #~ "</qt>" 15496 15497 #~ msgid "Unknown word:" 15498 #~ msgstr "Билгесез сүз:" 15499 15500 #~ msgid "Unknown word" 15501 #~ msgstr "Билгесез сүз" 15502 15503 #~ msgid "<b>misspelled</b>" 15504 #~ msgstr "<b>хаталы</b>" 15505 15506 #~ msgid "" 15507 #~ "<qt>\n" 15508 #~ "<p>Select the language of the document you are proofing here.</p>\n" 15509 #~ "</qt>" 15510 #~ msgstr "" 15511 #~ "<qt>\n" 15512 #~ "<p>Тикшерелә торган документның телен сайлагыз.</p>\n" 15513 #~ "</qt>" 15514 15515 #~ msgid "&Language:" 15516 #~ msgstr "&Тел:" 15517 15518 #~ msgid "Text excerpt showing the unknown word in its context." 15519 #~ msgstr "Хатаны тәшкил итүче текст өлеше." 15520 15521 #~ msgid "" 15522 #~ "<qt>\n" 15523 #~ "<p>Here you can see a text excerpt showing the unknown word in its " 15524 #~ "context. If this information is not sufficient to choose the best " 15525 #~ "replacement for the unknown word, you can click on the document you are " 15526 #~ "proofing, read a larger part of the text and then return here to continue " 15527 #~ "proofing.</p>\n" 15528 #~ "</qt>" 15529 #~ msgstr "" 15530 #~ "<qt>\n" 15531 #~ "<p>Монда хатаны тәшкил итүче сүз контекста чагыла. Әгәр бу өлеш җитмәсә " 15532 #~ "документка чиертегез, текстның зуррак өлешен алып дөрес язылыш диалогына " 15533 #~ "яңадан кайтыгыз.</p>\n" 15534 #~ "</qt>" 15535 15536 #~ msgid "... the <b>misspelled</b> word shown in context ..." 15537 #~ msgstr "...<b>хаталы</b> сүз контекста күрсәтелгән..." 15538 15539 #~ msgid "" 15540 #~ "<qt>\n" 15541 #~ "<p>The unknown word was detected and considered unknown because it is not " 15542 #~ "included in the dictionary.<br>\n" 15543 #~ "Click here if you consider the unknown word not to be misspelled, and you " 15544 #~ "want to avoid wrongly detecting it again in the future. If you want to " 15545 #~ "let it remain as is, but not add it to the dictionary, then click " 15546 #~ "<b>Ignore</b> or <b>Ignore All</b> instead.</p>\n" 15547 #~ "</qt>" 15548 #~ msgstr "" 15549 #~ "<qt>\n" 15550 #~ "<p>Бу сүз \"билгесез\" итеп санала, чөнки ул агымдагы сүзлектә юк. Бәлки " 15551 #~ "ул чит ил сүзе, ә бәлки неологизмдыр.<br>\n" 15552 #~ "Әгәр сүзнең язылышы дөрес икән, <b>Сүзлеккә кушу</b> төймәсенә басыгыз. " 15553 #~ "Әгәр дә сез моны эшлисегез килмәсә, <b>Төшереп калдыру</b> яки " 15554 #~ "<b>Бөтенләйгә төшереп калдыру</b> төймәләренә баса аласыз.</p>\n" 15555 #~ "</qt>" 15556 15557 #~ msgid "<< Add to Dictionary" 15558 #~ msgstr "<< Сүзлеккә өстәү" 15559 15560 #~ msgid "" 15561 #~ "<qt>\n" 15562 #~ "<p>Click here to replace all occurrences of the unknown text with the " 15563 #~ "text in the edit box above (to the left).</p>\n" 15564 #~ "</qt>" 15565 #~ msgstr "" 15566 #~ "<qt>\n" 15567 #~ "<p>Документта булган бу сүзне алыштырыр өчен монда басыгыз.</p>\n" 15568 #~ "</qt>" 15569 15570 #~ msgid "R&eplace All" 15571 #~ msgstr "Бө&тенесен алыштыру" 15572 15573 #~ msgid "Suggestion List" 15574 #~ msgstr "Тәкъдим ителгән вариантлар" 15575 15576 #~ msgid "" 15577 #~ "<qt>\n" 15578 #~ "<p>If the unknown word is misspelled, you should check if the correction " 15579 #~ "for it is available and if it is, click on it. If none of the words in " 15580 #~ "this list is a good replacement you may type the correct word in the edit " 15581 #~ "box above.</p>\n" 15582 #~ "<p>To correct this word click <b>Replace</b> if you want to correct only " 15583 #~ "this occurrence or <b>Replace All</b> if you want to correct all " 15584 #~ "occurrences.</p>\n" 15585 #~ "</qt>" 15586 #~ msgstr "" 15587 #~ "<qt>\n" 15588 #~ "<p>Әгәр сүз хата тәшкил итсә, тәкъдим ителгән исемлектә дөрес вариант " 15589 #~ "барлыгын тикшерегез. Әгәр ул анда булмаса, сез дөрес вариантны кулдан " 15590 #~ "кертә аласыз.</p>\n" 15591 #~ "<p>Бу сүзне бу урында гына үзгәртергә теләсәгез <b>Алыштыру</b> төймәсенә " 15592 #~ "басыгыз, ә аны бөтен документта үзгәртер өчен, <b>Бөтенесен алыштыру</b> " 15593 #~ "төймәсен кулланыгыз.</p>\n" 15594 #~ "</qt>" 15595 15596 #~ msgid "Suggested Words" 15597 #~ msgstr "Тәкъдим ителгән сүзләр" 15598 15599 #~ msgid "" 15600 #~ "<qt>\n" 15601 #~ "<p>Click here to replace this occurrence of the unknown text with the " 15602 #~ "text in the edit box above (to the left).</p>\n" 15603 #~ "</qt>" 15604 #~ msgstr "" 15605 #~ "<qt>\n" 15606 #~ "<p>Сүзне монда гына алыштырыр өчен монда басыгыз.</p>\n" 15607 #~ "</qt>" 15608 15609 #~ msgid "&Replace" 15610 #~ msgstr "&Алыштыру" 15611 15612 #~ msgid "" 15613 #~ "<qt>\n" 15614 #~ "<p>If the unknown word is misspelled, you should type the correction for " 15615 #~ "your misspelled word here or select it from the list below.</p>\n" 15616 #~ "<p>You can then click <b>Replace</b> if you want to correct only this " 15617 #~ "occurrence of the word or <b>Replace All</b> if you want to correct all " 15618 #~ "occurrences.</p>\n" 15619 #~ "</qt>" 15620 #~ msgstr "" 15621 #~ "<qt>\n" 15622 #~ "<p>Әгәр сүз хата тәшкил итсә, тәкъдим ителгән исемлектә дөрес вариант " 15623 #~ "барлыгын тикшерегез. Әгәр ул анда булмаса, сез дөрес вариантны кулдан " 15624 #~ "кертә аласыз.</p>\n" 15625 #~ "<p>Шуннан <b>Алыштыру</b> яки <b>Бөтенесен алыштыру</b> төймәсенә басыгыз." 15626 #~ "</p>\n" 15627 #~ "</qt>" 15628 15629 #~ msgid "Replace &with:" 15630 #~ msgstr "Моңа &алыштыру:" 15631 15632 #~ msgid "" 15633 #~ "<qt>\n" 15634 #~ "<p>Click here to let this occurrence of the unknown word remain as is.</" 15635 #~ "p>\n" 15636 #~ "<p>This action is useful when the word is a name, an acronym, a foreign " 15637 #~ "word or any other unknown word that you want to use but not add to the " 15638 #~ "dictionary.</p>\n" 15639 #~ "</qt>" 15640 #~ msgstr "" 15641 #~ "<qt>\n" 15642 #~ "<p>Бу сүзне төшереп калдыру.</p>\n" 15643 #~ "<p>Сүз исем булган очракларда бу бик файдалы була ала, кыскартма, чит ил " 15644 #~ "сүзе яки төрле башка сүз, әгәр дә сез аны сүзлеккә өстәп тормыйча гына " 15645 #~ "кулланырга теләсәгез.</p>\n" 15646 #~ "</qt>" 15647 15648 #~ msgid "&Ignore" 15649 #~ msgstr "&Төшереп калдыру" 15650 15651 #~ msgid "" 15652 #~ "<qt>\n" 15653 #~ "<p>Click here to let all occurrences of the unknown word remain as they " 15654 #~ "are.</p>\n" 15655 #~ "<p>This action is useful when the word is a name, an acronym, a foreign " 15656 #~ "word or any other unknown word that you want to use but not add to the " 15657 #~ "dictionary.</p>\n" 15658 #~ "</qt>" 15659 #~ msgstr "" 15660 #~ "<qt>\n" 15661 #~ "<p>Бөтен текст буенча бу сүзне төшереп калдыру.</p>\n" 15662 #~ "<p>Сүз исем булган очракларда бу бик файдалы була ала, кыскартма, чит ил " 15663 #~ "сүзе яки төрле башка сүз, әгәр дә сез аны сүзлеккә өстәп тормыйча гына " 15664 #~ "кулланырга теләсәгез.</p>\n" 15665 #~ "</qt>" 15666 15667 #~ msgid "I&gnore All" 15668 #~ msgstr "Б&өтен урыннарда төшереп калдыру" 15669 15670 #~ msgid "S&uggest" 15671 #~ msgstr "В&ариант" 15672 15673 #~ msgid "Language Selection" 15674 #~ msgstr "Телне сайлау" 15675 15676 #~ msgid "As-you-type spell checking enabled." 15677 #~ msgstr "Текст җыю вакытында дөрес язылышны тикшерү." 15678 15679 #~ msgid "As-you-type spell checking disabled." 15680 #~ msgstr "Текст җыю вакытында дөрес язылышны тикшермәү." 15681 15682 #~ msgid "Incremental Spellcheck" 15683 #~ msgstr "Текст җыю вакытында дөрес язылышны тикшерү." 15684 15685 #~ msgid "Too many misspelled words. As-you-type spell checking disabled." 15686 #~ msgstr "" 15687 #~ "Хаталы сүз саны артык зур булганга күрә, текст җыю вакытында дөрес " 15688 #~ "язылышның тикшерүе туктатылды." 15689 15690 #~ msgid "Check Spelling..." 15691 #~ msgstr "Дөрес язылышны тикшерү..." 15692 15693 #~ msgid "Auto Spell Check" 15694 #~ msgstr "Дөрес язылышны автоматик рәвештә тикшерү" 15695 15696 #~ msgid "Allow Tabulations" 15697 #~ msgstr "Табуляцияне рөхсәт итү" 15698 15699 #~ msgid "Spell Checking" 15700 #~ msgstr "Дөрес язылышны тикшерү" 15701 15702 #~ msgid "&Back" 15703 #~ msgstr "&Кире кайту" 15704 15705 #~ msgctxt "Opposite to Back" 15706 #~ msgid "&Next" 15707 #~ msgstr "&Алга бару" 15708 15709 #~ msgid "Unknown View" 15710 #~ msgstr "Билгесез кыяфәт" 15711 15712 #~ msgid "" 15713 #~ "A command-line application that can be used to run KUnitTest modules." 15714 #~ msgstr "KUnitTest модульләрен җибәрү өчен командалы юл коралы." 15715 15716 #~ msgid "Only run modules whose filenames match the regexp." 15717 #~ msgstr "Регуляр гыйбарә белән генә бәйле булган модульләрне җибәрү." 15718 15719 #~ msgid "" 15720 #~ "Only run tests modules which are found in the folder. Use the query " 15721 #~ "option to select modules." 15722 #~ msgstr "" 15723 #~ "Каталогтагы тестлар модулен җибәрү. Модульләрне сайлау өчен таләпнең " 15724 #~ "параметрларын үзгәртегез." 15725 15726 #~ msgid "" 15727 #~ "Disables debug capturing. You typically use this option when you use the " 15728 #~ "GUI." 15729 #~ msgstr "" 15730 #~ "Эләктергечнең төзәткеч вазифаларын сүндерү. Гадәттә бу график интерфейсны " 15731 #~ "белән эш иткән вакытта кулланыла." 15732 15733 #~ msgid "KUnitTest ModRunner" 15734 #~ msgstr "KUnitTest ModRunner" 15735 15736 #~ msgid "(C) 2005 Jeroen Wijnhout" 15737 #~ msgstr "(C) 2005 Jeroen Wijnhout" 15738 15739 #~ msgid "DBus Backend error: connection to helper failed. %1" 15740 #~ msgstr "DBus хезмәтенең эчке хатасы: эшкәртүчегә тоташып булмады. %1" 15741 15742 #~ msgid "" 15743 #~ "DBus Backend error: could not contact the helper. Connection error: %1. " 15744 #~ "Message error: %2" 15745 #~ msgstr "" 15746 #~ "DBus хезмәтенең эчке хатасы: эшкәртүчегә тоташып булмады. Элемтә хатасы: " 15747 #~ "%1. Хата турындагы хәбәр: %2" 15748 15749 #~ msgid "DBus Backend error: received corrupt data from helper %1 %2" 15750 #~ msgstr "" 15751 #~ "DBus хезмәтенең эчке хатасы: эшкәртүчедән ватык мәгълумат кабул ителде. " 15752 #~ "%1 %2" 15753 15754 #~ msgid "Please contact your system administrator." 15755 #~ msgstr "Системаның администраторы белән элемтәгә керегез." 15756 15757 #~ msgid "Configuration file \"%1\" not writable.\n" 15758 #~ msgstr "«%1» конфигурация файлына язу гамәле рөхсәт ителми.\n" 15759 15760 #~ msgid "kde4-config" 15761 #~ msgstr "(C) 2005 Jeroen Wijnhout" 15762 15763 #~ msgid "A little program to output installation paths" 15764 #~ msgstr "KDE каталогларының юлларын чыгаручы кушымта" 15765 15766 #~ msgid "Left for legacy support" 15767 #~ msgstr "Искергән кушымталар өчен калдырылган" 15768 15769 #~ msgid "Compiled in prefix for KDE libraries" 15770 #~ msgstr "КДЕ китапханәләрнең кертелгән prefix" 15771 15772 #~ msgid "Compiled in exec_prefix for KDE libraries" 15773 #~ msgstr "КДЕ китапханәләрнең кертелгән exec_prefix" 15774 15775 #~ msgid "Compiled in library path suffix" 15776 #~ msgstr "Китапханәлргә кадәр кертелгән юллар" 15777 15778 #~ msgid "Prefix in $HOME used to write files" 15779 #~ msgstr "Файлларны язу өчен $HOME каталогы" 15780 15781 #~ msgid "Compiled in version string for KDE libraries" 15782 #~ msgstr "KDE китапханәләрнең кертелгән юрама юлы" 15783 15784 #~ msgid "Available KDE resource types" 15785 #~ msgstr "KDE ресурсларының булган төрләре" 15786 15787 #~ msgid "Search path for resource type" 15788 #~ msgstr "Ресурс төрләрен эзләү юлы" 15789 15790 #~ msgid "Find filename inside the resource type given to --path" 15791 #~ msgstr "Ресурсның --path юлында күрсәтелгән төре өчен файл исемен эзләү" 15792 15793 #~ msgid "User path: desktop|autostart|document" 15794 #~ msgstr "Кулдан кертелән юл: desktop|autostart|document" 15795 15796 #~ msgid "Prefix to install resource files to" 15797 #~ msgstr "Ресурс файлларын урнаштыру каталогы" 15798 15799 #~ msgid "Installation prefix for Qt" 15800 #~ msgstr "Qt китапханәсен урнаштыру юлы" 15801 15802 #~ msgid "Location of installed Qt binaries" 15803 #~ msgstr "Qt бинарь файлларның урнашкан урыны" 15804 15805 #~ msgid "Location of installed Qt libraries" 15806 #~ msgstr "Qt китапханәләрнең урнашкан урыны" 15807 15808 #~ msgid "Location of installed Qt plugins" 15809 #~ msgstr "Qt өстәлмәләрнең урнашкан урыны" 15810 15811 #~ msgid "Applications menu (.desktop files)" 15812 #~ msgstr "Кушымталар менюсы (.desktop файллары)" 15813 15814 #~ msgid "Autostart directories" 15815 #~ msgstr "Кушымталарны автоматик рәвештә җибәрү каталогы" 15816 15817 #~ msgid "Cached information (e.g. favicons, web-pages)" 15818 #~ msgstr "Кэшланган мәгълүмат (м. веб-сәхифәләр, аларның рәсемнәре һәм башк.)" 15819 15820 #~ msgid "CGIs to run from kdehelp" 15821 #~ msgstr "kdehelp кушымтасыннан чакырылган CGI" 15822 15823 #~ msgid "Where applications store data" 15824 #~ msgstr "Кушымталар турында мәгълүмат саклагычы" 15825 15826 #~ msgid "Emoticons" 15827 #~ msgstr "Көлчекләр" 15828 15829 #~ msgid "Executables in $prefix/bin" 15830 #~ msgstr "$prefix/bin юлыннан башкарыла торган файллар" 15831 15832 #~ msgid "HTML documentation" 15833 #~ msgstr "HTML документлары" 15834 15835 #~ msgid "Icons" 15836 #~ msgstr "Билгечекләр" 15837 15838 #~ msgid "Configuration description files" 15839 #~ msgstr "Конфигурацияне тасвирлау файллары" 15840 15841 #~ msgid "Libraries" 15842 #~ msgstr "Китапханәләр" 15843 15844 #~ msgid "Includes/Headers" 15845 #~ msgstr "Баш исемнәр" 15846 15847 #~ msgid "Mime types" 15848 #~ msgstr "MIME төрләре" 15849 15850 #~ msgid "Loadable modules" 15851 #~ msgstr "Йөкләнелә торган киңәйтмәләр" 15852 15853 #~ msgid "Legacy pixmaps" 15854 #~ msgstr "Искергән билгечекләр" 15855 15856 #~ msgid "Qt plugins" 15857 #~ msgstr "Qt өстәлмәләре" 15858 15859 #~ msgid "Services" 15860 #~ msgstr "Хезмәтләр" 15861 15862 #~ msgid "Service types" 15863 #~ msgstr "Хезмәтләрнең төрләре" 15864 15865 #~ msgid "Application sounds" 15866 #~ msgstr "Кушымталарның тавыш файллары" 15867 15868 #~ msgid "Templates" 15869 #~ msgstr "Калыплар" 15870 15871 #~ msgid "Wallpapers" 15872 #~ msgstr "Обойлар" 15873 15874 #~ msgid "XDG Application menu (.desktop files)" 15875 #~ msgstr "XDG кушымталар менюсы (.desktop файллары)" 15876 15877 #~ msgid "XDG Menu descriptions (.directory files)" 15878 #~ msgstr "XDG меню тасвиры (.directory файллары)" 15879 15880 #~ msgid "XDG Icons" 15881 #~ msgstr "XDG билгечекләре" 15882 15883 #~ msgid "XDG Mime Types" 15884 #~ msgstr "XDG MIME төрләре" 15885 15886 #~ msgid "XDG Menu layout (.menu files)" 15887 #~ msgstr "XDG меню тәртибе (.menu файллары)" 15888 15889 #~ msgid "XDG autostart directory" 15890 #~ msgstr "XDG автоматик рәвешә җибәргеч каталогы" 15891 15892 #~ msgid "Temporary files (specific for both current host and current user)" 15893 #~ msgstr "Вакытлы файллар (бу компьютер һәм кулланучы өчен)" 15894 15895 #~ msgid "UNIX Sockets (specific for both current host and current user)" 15896 #~ msgstr "UNIX сокетлары (анык компьютер һәм кулланучы өчен)" 15897 15898 #~ msgid "%1 - unknown type\n" 15899 #~ msgstr "%1 - билгесез төр\n" 15900 15901 #~ msgid "%1 - unknown type of userpath\n" 15902 #~ msgstr "%1 - билгесез төр яки юл\n" 15903 15904 #~ msgid "Use the QWS display 'displayname'" 15905 #~ msgstr "QWS «displayname» экранын куллану" 15906 15907 #~ msgid "forces the application to run as QWS Server" 15908 #~ msgstr "Кушымтаны QWS серверы шикелле эшләтә" 15909 15910 #~ msgid "Function must be called from the main thread." 15911 #~ msgstr "Функция процессның төп агымыннан чакырылырга тиеш." 15912 15913 #~ msgid "" 15914 #~ "Error launching %1. Either KLauncher is not running anymore, or it failed " 15915 #~ "to start the application." 15916 #~ msgstr "" 15917 #~ "«%1» кушымтасын җибәреп булмады. KLauncher яисә җибәрелмәгән, яисә " 15918 #~ "кушымтаны җибәрә алмады." 15919 15920 #~ msgid "" 15921 #~ "KLauncher could not be reached via D-Bus. Error when calling %1:\n" 15922 #~ "%2\n" 15923 #~ msgstr "" 15924 #~ "KLauncher D-Bus аша табылмады, чакыру вакытындагы хата: %1:\n" 15925 #~ "%2\n" 15926 15927 #~ msgid "" 15928 #~ "Could not launch the KDE Help Center:\n" 15929 #~ "\n" 15930 #~ "%1" 15931 #~ msgstr "" 15932 #~ "KDE чолганышының Белешмә үзәген җибәреп булмый: \n" 15933 #~ "\n" 15934 #~ " %1" 15935 15936 #~ msgid "Could not Launch Help Center" 15937 #~ msgstr "Белешмә үзәген җибәреп булмый" 15938 15939 #~ msgid "" 15940 #~ "Could not launch the mail client:\n" 15941 #~ "\n" 15942 #~ "%1" 15943 #~ msgstr "" 15944 #~ "Почта клиентын җибәреп булмый:\n" 15945 #~ "\n" 15946 #~ "%1" 15947 15948 #~ msgid "Could not launch Mail Client" 15949 #~ msgstr "Почта клиентын җибәреп булмый" 15950 15951 #~ msgid "" 15952 #~ "Could not launch the browser:\n" 15953 #~ "\n" 15954 #~ "%1" 15955 #~ msgstr "" 15956 #~ "Браузерны җибәреп булмый:\n" 15957 #~ "\n" 15958 #~ "%1" 15959 15960 #~ msgid "Could not launch Browser" 15961 #~ msgstr "Браузерны җибәреп булмый" 15962 15963 #~ msgid "" 15964 #~ "Could not launch the terminal client:\n" 15965 #~ "\n" 15966 #~ "%1" 15967 #~ msgstr "" 15968 #~ "Терминал клиентын җибәреп булмады:\n" 15969 #~ "\n" 15970 #~ "%1" 15971 15972 #~ msgid "Could not launch Terminal Client" 15973 #~ msgstr "Терминал клиентын җибәреп булмый" 15974 15975 #~ msgctxt "@item Text character set" 15976 #~ msgid "Western European" 15977 #~ msgstr "Көнбатыш Аурупа" 15978 15979 #~ msgctxt "@item Text character set" 15980 #~ msgid "Baltic" 15981 #~ msgstr "Балтик" 15982 15983 #~ msgctxt "@item Text character set" 15984 #~ msgid "South-Eastern Europe" 15985 #~ msgstr "Көньяк-көнчыгыш Аурупа" 15986 15987 #~ msgctxt "@item Text character set" 15988 #~ msgid "Turkish" 15989 #~ msgstr "Төрек" 15990 15991 #~ msgctxt "@item Text character set" 15992 #~ msgid "Cyrillic" 15993 #~ msgstr "Кирилл" 15994 15995 #~ msgctxt "@item Text character set" 15996 #~ msgid "Chinese Traditional" 15997 #~ msgstr "Кытай (гадәти)" 15998 15999 #~ msgctxt "@item Text character set" 16000 #~ msgid "Chinese Simplified" 16001 #~ msgstr "Кытай (җиңел)" 16002 16003 #~ msgctxt "@item Text character set" 16004 #~ msgid "Korean" 16005 #~ msgstr "Корея" 16006 16007 #~ msgctxt "@item Text character set" 16008 #~ msgid "Greek" 16009 #~ msgstr "Грек" 16010 16011 #~ msgctxt "@item Text character set" 16012 #~ msgid "Hebrew" 16013 #~ msgstr "Иврит" 16014 16015 #~ msgctxt "@item Text character set" 16016 #~ msgid "Unicode" 16017 #~ msgstr "Юникод" 16018 16019 #~ msgctxt "@item %1 character set, %2 encoding" 16020 #~ msgid "%1 ( %2 )" 16021 #~ msgstr "%1 ( %2 )" 16022 16023 #~ msgctxt "@item" 16024 #~ msgid "Other encoding (%1)" 16025 #~ msgstr "Башка кодлашу (%1)" 16026 16027 #~ msgctxt "@item Text encoding: %1 character set, %2 encoding" 16028 #~ msgid "%1 ( %2 )" 16029 #~ msgstr "%1 ( %2 )" 16030 16031 #~ msgctxt "@item Text character set" 16032 #~ msgid "Universal" 16033 #~ msgstr "Универсаль" 16034 16035 #~ msgctxt "@title/plain" 16036 #~ msgid "== %1 ==" 16037 #~ msgstr "== %1 ==" 16038 16039 #~ msgctxt "@title/rich" 16040 #~ msgid "<h2>%1</h2>" 16041 #~ msgstr "<h2>%1</h2>" 16042 16043 #~ msgctxt "@subtitle/plain" 16044 #~ msgid "~ %1 ~" 16045 #~ msgstr "~ %1 ~" 16046 16047 #~ msgctxt "@subtitle/rich" 16048 #~ msgid "<h3>%1</h3>" 16049 #~ msgstr "<h3>%1</h3>" 16050 16051 #~ msgctxt "@item/plain" 16052 #~ msgid " * %1" 16053 #~ msgstr " * %1" 16054 16055 #~ msgctxt "@item/rich" 16056 #~ msgid "<li>%1</li>" 16057 #~ msgstr "<li>%1</li>" 16058 16059 #~ msgctxt "@note/plain" 16060 #~ msgid "Note: %1" 16061 #~ msgstr "Искәрмә: %1" 16062 16063 #~ msgctxt "@note/rich" 16064 #~ msgid "<i>Note</i>: %1" 16065 #~ msgstr "<i>Искәрмә</i>: %1" 16066 16067 #~ msgctxt "" 16068 #~ "@note-with-label/plain\n" 16069 #~ "%1 is the note label, %2 is the text" 16070 #~ msgid "%1: %2" 16071 #~ msgstr "%1: %2" 16072 16073 #~ msgctxt "" 16074 #~ "@note-with-label/rich\n" 16075 #~ "%1 is the note label, %2 is the text" 16076 #~ msgid "<i>%1</i>: %2" 16077 #~ msgstr "<i>%1</i>: %2" 16078 16079 #~ msgctxt "@warning/plain" 16080 #~ msgid "WARNING: %1" 16081 #~ msgstr "Кисәтү: %1" 16082 16083 #~ msgctxt "@warning/rich" 16084 #~ msgid "<b>Warning</b>: %1" 16085 #~ msgstr "<b>Кисәтү</b>: %1" 16086 16087 #~ msgctxt "" 16088 #~ "@warning-with-label/plain\n" 16089 #~ "%1 is the warning label, %2 is the text" 16090 #~ msgid "%1: %2" 16091 #~ msgstr "%1: %2" 16092 16093 #~ msgctxt "" 16094 #~ "@warning-with-label/rich\n" 16095 #~ "%1 is the warning label, %2 is the text" 16096 #~ msgid "<b>%1</b>: %2" 16097 #~ msgstr "<b>%1</b>: %2" 16098 16099 #~ msgctxt "" 16100 #~ "@link-with-description/plain\n" 16101 #~ "%1 is the URL, %2 is the descriptive text" 16102 #~ msgid "%2 (%1)" 16103 #~ msgstr "%2 (%1)" 16104 16105 #~ msgctxt "" 16106 #~ "@link-with-description/rich\n" 16107 #~ "%1 is the URL, %2 is the descriptive text" 16108 #~ msgid "<a href=\"%1\">%2</a>" 16109 #~ msgstr "<a href=\"%1\">%2</a>" 16110 16111 #~ msgctxt "@filename/plain" 16112 #~ msgid "‘%1’" 16113 #~ msgstr "‘%1’" 16114 16115 #~ msgctxt "@filename/rich" 16116 #~ msgid "<tt>%1</tt>" 16117 #~ msgstr "<tt>%1</tt>" 16118 16119 #~ msgctxt "@application/plain" 16120 #~ msgid "%1" 16121 #~ msgstr "%1" 16122 16123 #~ msgctxt "@application/rich" 16124 #~ msgid "%1" 16125 #~ msgstr "%1" 16126 16127 #~ msgctxt "@command/plain" 16128 #~ msgid "%1" 16129 #~ msgstr "%1" 16130 16131 #~ msgctxt "@command/rich" 16132 #~ msgid "<tt>%1</tt>" 16133 #~ msgstr "<tt>%1</tt>" 16134 16135 #~ msgctxt "" 16136 #~ "@command-with-section/plain\n" 16137 #~ "%1 is the command name, %2 is its man section" 16138 #~ msgid "%1(%2)" 16139 #~ msgstr "%1(%2)" 16140 16141 #~ msgctxt "" 16142 #~ "@command-with-section/rich\n" 16143 #~ "%1 is the command name, %2 is its man section" 16144 #~ msgid "<tt>%1(%2)</tt>" 16145 #~ msgstr "<tt>%1(%2)</tt>" 16146 16147 #~ msgctxt "@resource/plain" 16148 #~ msgid "“%1”" 16149 #~ msgstr "“%1”" 16150 16151 #~ msgctxt "@resource/rich" 16152 #~ msgid "“%1”" 16153 #~ msgstr "“%1”" 16154 16155 #~ msgctxt "@icode/plain" 16156 #~ msgid "“%1”" 16157 #~ msgstr "“%1”" 16158 16159 #~ msgctxt "@icode/rich" 16160 #~ msgid "<tt>%1</tt>" 16161 #~ msgstr "<tt>%1</tt>" 16162 16163 #~ msgctxt "@shortcut/plain" 16164 #~ msgid "%1" 16165 #~ msgstr "%1" 16166 16167 #~ msgctxt "@interface/plain" 16168 #~ msgid "|%1|" 16169 #~ msgstr "|%1|" 16170 16171 #~ msgctxt "@interface/rich" 16172 #~ msgid "<i>%1</i>" 16173 #~ msgstr "<i>%1</i>" 16174 16175 #~ msgctxt "@emphasis/plain" 16176 #~ msgid "*%1*" 16177 #~ msgstr "*%1*" 16178 16179 #~ msgctxt "@emphasis/rich" 16180 #~ msgid "<i>%1</i>" 16181 #~ msgstr "<i>%1</i>" 16182 16183 #~ msgctxt "@emphasis-strong/plain" 16184 #~ msgid "**%1**" 16185 #~ msgstr "**%1**" 16186 16187 #~ msgctxt "@emphasis-strong/rich" 16188 #~ msgid "<b>%1</b>" 16189 #~ msgstr "<b>%1</b>" 16190 16191 #~ msgctxt "@placeholder/plain" 16192 #~ msgid "<%1>" 16193 #~ msgstr "<%1>" 16194 16195 #~ msgctxt "@placeholder/rich" 16196 #~ msgid "<<i>%1</i>>" 16197 #~ msgstr "<<i>%1</i>>" 16198 16199 #~ msgctxt "@email/plain" 16200 #~ msgid "<%1>" 16201 #~ msgstr "<%1>" 16202 16203 #~ msgctxt "@email/rich" 16204 #~ msgid "<<a href=\"mailto:%1\">%1</a>>" 16205 #~ msgstr "<<a href=\"mailto:%1\">%1</a>>" 16206 16207 #~ msgctxt "" 16208 #~ "@email-with-name/plain\n" 16209 #~ "%1 is name, %2 is address" 16210 #~ msgid "%1 <%2>" 16211 #~ msgstr "%1 <%2>" 16212 16213 #~ msgctxt "" 16214 #~ "@email-with-name/rich\n" 16215 #~ "%1 is name, %2 is address" 16216 #~ msgid "<a href=\"mailto:%2\">%1</a>" 16217 #~ msgstr "<a href=\"mailto:%2\">%1</a>" 16218 16219 #~ msgctxt "@envar/plain" 16220 #~ msgid "$%1" 16221 #~ msgstr "$%1" 16222 16223 #~ msgctxt "@envar/rich" 16224 #~ msgid "<tt>$%1</tt>" 16225 #~ msgstr "<tt>$%1</tt>" 16226 16227 #~ msgctxt "@message/plain" 16228 #~ msgid "/%1/" 16229 #~ msgstr "/%1/" 16230 16231 #~ msgctxt "@message/rich" 16232 #~ msgid "<i>%1</i>" 16233 #~ msgstr "<i>%1</i>" 16234 16235 #~ msgctxt "shortcut-key-delimiter/plain" 16236 #~ msgid "+" 16237 #~ msgstr "+" 16238 16239 #~ msgctxt "shortcut-key-delimiter/rich" 16240 #~ msgid "+" 16241 #~ msgstr "+" 16242 16243 #~ msgctxt "gui-path-delimiter/plain" 16244 #~ msgid "→" 16245 #~ msgstr "→" 16246 16247 #~ msgctxt "gui-path-delimiter/rich" 16248 #~ msgid "→" 16249 #~ msgstr "→" 16250 16251 #~ msgctxt "keyboard-key-name" 16252 #~ msgid "Alt" 16253 #~ msgstr "Alt" 16254 16255 #~ msgctxt "keyboard-key-name" 16256 #~ msgid "AltGr" 16257 #~ msgstr "AltGr" 16258 16259 #~ msgctxt "keyboard-key-name" 16260 #~ msgid "Backspace" 16261 #~ msgstr "Клавиша Backspace" 16262 16263 #~ msgctxt "keyboard-key-name" 16264 #~ msgid "CapsLock" 16265 #~ msgstr "CapsLock" 16266 16267 #~ msgctxt "keyboard-key-name" 16268 #~ msgid "Control" 16269 #~ msgstr "Control" 16270 16271 #~ msgctxt "keyboard-key-name" 16272 #~ msgid "Ctrl" 16273 #~ msgstr "Ctrl" 16274 16275 #~ msgctxt "keyboard-key-name" 16276 #~ msgid "Delete" 16277 #~ msgstr "Бетерү" 16278 16279 #~ msgctxt "keyboard-key-name" 16280 #~ msgid "Down" 16281 #~ msgstr "Ук \"Аска\"" 16282 16283 #~ msgctxt "keyboard-key-name" 16284 #~ msgid "End" 16285 #~ msgstr "Ахыр" 16286 16287 #~ msgctxt "keyboard-key-name" 16288 #~ msgid "Enter" 16289 #~ msgstr "Enter" 16290 16291 #~ msgctxt "keyboard-key-name" 16292 #~ msgid "Escape" 16293 #~ msgstr "Escape" 16294 16295 #~ msgctxt "keyboard-key-name" 16296 #~ msgid "Home" 16297 #~ msgstr "Албит" 16298 16299 #~ msgctxt "keyboard-key-name" 16300 #~ msgid "Hyper" 16301 #~ msgstr "Hyper" 16302 16303 #~ msgctxt "keyboard-key-name" 16304 #~ msgid "Ins" 16305 #~ msgstr "Ins" 16306 16307 #~ msgctxt "keyboard-key-name" 16308 #~ msgid "Insert" 16309 #~ msgstr "Insert" 16310 16311 #~ msgctxt "keyboard-key-name" 16312 #~ msgid "Left" 16313 #~ msgstr "Сул кыры буенча" 16314 16315 #~ msgctxt "keyboard-key-name" 16316 #~ msgid "Menu" 16317 #~ msgstr "Menu" 16318 16319 #~ msgctxt "keyboard-key-name" 16320 #~ msgid "Meta" 16321 #~ msgstr "Meta" 16322 16323 #~ msgctxt "keyboard-key-name" 16324 #~ msgid "NumLock" 16325 #~ msgstr "NumLock" 16326 16327 #~ msgctxt "keyboard-key-name" 16328 #~ msgid "PageDown" 16329 #~ msgstr "PageDown" 16330 16331 #~ msgctxt "keyboard-key-name" 16332 #~ msgid "PageUp" 16333 #~ msgstr "PageUp" 16334 16335 #~ msgctxt "keyboard-key-name" 16336 #~ msgid "PgDown" 16337 #~ msgstr "PgDown" 16338 16339 #~ msgctxt "keyboard-key-name" 16340 #~ msgid "PgUp" 16341 #~ msgstr "PgUp" 16342 16343 #~ msgctxt "keyboard-key-name" 16344 #~ msgid "PauseBreak" 16345 #~ msgstr "PauseBreak" 16346 16347 #~ msgctxt "keyboard-key-name" 16348 #~ msgid "PrtScr" 16349 #~ msgstr "PrtScr" 16350 16351 #~ msgctxt "keyboard-key-name" 16352 #~ msgid "Return" 16353 #~ msgstr "Кайту" 16354 16355 #~ msgctxt "keyboard-key-name" 16356 #~ msgid "ScrollLock" 16357 #~ msgstr "ScrollLock" 16358 16359 #~ msgctxt "keyboard-key-name" 16360 #~ msgid "Shift" 16361 #~ msgstr "Shift" 16362 16363 #~ msgctxt "keyboard-key-name" 16364 #~ msgid "Space" 16365 #~ msgstr "Пробел" 16366 16367 #~ msgctxt "keyboard-key-name" 16368 #~ msgid "Super" 16369 #~ msgstr "Super" 16370 16371 #~ msgctxt "keyboard-key-name" 16372 #~ msgid "SysReq" 16373 #~ msgstr "SysReq" 16374 16375 #~ msgctxt "keyboard-key-name" 16376 #~ msgid "Up" 16377 #~ msgstr "Күтәрү" 16378 16379 #~ msgctxt "keyboard-key-name" 16380 #~ msgid "Win" 16381 #~ msgstr "Win" 16382 16383 #~ msgctxt "keyboard-key-name" 16384 #~ msgid "F%1" 16385 #~ msgstr "F%1" 16386 16387 #~ msgid "NEC SOCKS client" 16388 #~ msgstr "NEC SOCKS клиенты" 16389 16390 #~ msgid "Dante SOCKS client" 16391 #~ msgstr "Dante SOCKS клиенты" 16392 16393 #~ msgid "Specified socket path is invalid" 16394 #~ msgstr "Сокетка кадәр билгеләнгән юл хаталы" 16395 16396 #~ msgid "The socket operation is not supported" 16397 #~ msgstr "Сокет белән гамәл тотылмый" 16398 16399 #~ msgid "Connection timed out" 16400 #~ msgstr "Тоташу вакыты үтте" 16401 16402 #~ msgid "Could not set non-blocking mode" 16403 #~ msgstr "Блоклаштырмаучы ысулны эшләтеп булмады" 16404 16405 #~ msgid "Address is already in use" 16406 #~ msgstr "Адрес инде кулланыла" 16407 16408 #~ msgid "Path cannot be used" 16409 #~ msgstr "Юлны кулланып булмый" 16410 16411 #~ msgid "No such file or directory" 16412 #~ msgstr "Файл яисә каталог сайланмаган" 16413 16414 #~ msgid "Read-only filesystem" 16415 #~ msgstr "Укыла гына торган файл системасы" 16416 16417 #~ msgid "Unknown socket error" 16418 #~ msgstr "Сокетның билгесез хатасы." 16419 16420 #~ msgid "Operation not supported" 16421 #~ msgstr "Гамәл тотылмый" 16422 16423 #~ msgctxt "SSL error" 16424 #~ msgid "No error" 16425 #~ msgstr "Хатасыз" 16426 16427 #~ msgctxt "SSL error" 16428 #~ msgid "The certificate has expired" 16429 #~ msgstr "Таныклыкның эш вакыты үтте." 16430 16431 #~ msgctxt "SSL error" 16432 #~ msgid "The peer did not present any certificate" 16433 #~ msgstr "Таныклыксыз элемтә" 16434 16435 #~ msgctxt "SSL error" 16436 #~ msgid "The certificate does not apply to the given host" 16437 #~ msgstr "Бу үзәк өчен таныклыкны кулланып булмый" 16438 16439 #~ msgctxt "SSL error" 16440 #~ msgid "The certificate cannot be verified for internal reasons" 16441 #~ msgstr "Эчке сәбәпләр аркасында таныклыкны тикшереп булмый" 16442 16443 #~ msgctxt "SSL error" 16444 #~ msgid "The certificate chain is too long" 16445 #~ msgstr "Таныклыклар чылбыр артык озын" 16446 16447 #~ msgctxt "SSL error" 16448 #~ msgid "Unknown error" 16449 #~ msgstr "Билгесез хата" 16450 16451 #~ msgid "Could not find mime type <resource>%2</resource>" 16452 #~ msgid_plural "" 16453 #~ "Could not find mime types:\n" 16454 #~ "<resource>%2</resource>" 16455 #~ msgstr[0] "MIME'ның <resource>%2</resource> дигән төре табылмады" 16456 #~ msgstr[1] "MIME'ның <resource>%2</resource> дигән төре табылмады" 16457 16458 #~ msgid "" 16459 #~ "No mime types installed. Check that shared-mime-info is installed, and " 16460 #~ "that XDG_DATA_DIRS is not set, or includes /usr/share." 16461 #~ msgstr "" 16462 #~ "MIME төрләре урнаштырылмаган. shared-mime-info төргәгенең урнашуын һәм " 16463 #~ "чолганышның XDG_DATA_DIRS үзгәрмәсен тикшерегез. Үзгәрмә куелмаска яисә /" 16464 #~ "usr/share объектын эшләтергә тиеш." 16465 16466 #~ msgid "No service matching the requirements was found" 16467 #~ msgstr "Служба, соответствующая требованиям, не найдена" 16468 16469 #~ msgid "" 16470 #~ "The service '%1' does not provide an interface '%2' with keyword '%3'" 16471 #~ msgstr "" 16472 #~ "Служба «%1» не предоставляет интерфейс «%2» с ключевыми словами «%3»." 16473 16474 #~ msgctxt "dictionary variant" 16475 #~ msgid "40" 16476 #~ msgstr "40" 16477 16478 #~ msgctxt "dictionary variant" 16479 #~ msgid "60" 16480 #~ msgstr "60" 16481 16482 #~ msgctxt "dictionary variant" 16483 #~ msgid "80" 16484 #~ msgstr "80" 16485 16486 #~ msgctxt "dictionary variant" 16487 #~ msgid "-ise suffixes" 16488 #~ msgstr "-ise кушымчалары" 16489 16490 #~ msgctxt "dictionary variant" 16491 #~ msgid "-ize suffixes" 16492 #~ msgstr "-ize кушымчалары" 16493 16494 #~ msgctxt "dictionary variant" 16495 #~ msgid "-ise suffixes and with accents" 16496 #~ msgstr "-ise кушымчалары һәм акцентлы хәрефләр" 16497 16498 #~ msgctxt "dictionary variant" 16499 #~ msgid "-ise suffixes and without accents" 16500 #~ msgstr "-ise кушымчалары һәм акцентсыз хәрефләр" 16501 16502 #~ msgctxt "dictionary variant" 16503 #~ msgid "-ize suffixes and with accents" 16504 #~ msgstr "-ize кушымчалары һәм акцентлы хәрефләр" 16505 16506 #~ msgctxt "dictionary variant" 16507 #~ msgid "-ize suffixes and without accents" 16508 #~ msgstr "-ize кушымчалары һәм акцентсыз хәрефләр" 16509 16510 #~ msgctxt "dictionary variant" 16511 #~ msgid "large" 16512 #~ msgstr "зур" 16513 16514 #~ msgctxt "dictionary variant" 16515 #~ msgid "small" 16516 #~ msgstr "кече" 16517 16518 #~ msgctxt "dictionary variant" 16519 #~ msgid "variant 0" 16520 #~ msgstr "вариант 0" 16521 16522 #~ msgctxt "dictionary variant" 16523 #~ msgid "variant 1" 16524 #~ msgstr "вариант 1" 16525 16526 #~ msgctxt "dictionary variant" 16527 #~ msgid "variant 2" 16528 #~ msgstr "вариант 2" 16529 16530 #~ msgctxt "dictionary variant" 16531 #~ msgid "without accents" 16532 #~ msgstr "акцентсыз хәрефләр" 16533 16534 #~ msgctxt "dictionary variant" 16535 #~ msgid "with accents" 16536 #~ msgstr "Акцентлы хәрефләр" 16537 16538 #~ msgctxt "dictionary variant" 16539 #~ msgid "with ye" 16540 #~ msgstr "«е» аша язылу гына" 16541 16542 #~ msgctxt "dictionary variant" 16543 #~ msgid "with yeyo" 16544 #~ msgstr "«е» и «ё» аша язылу" 16545 16546 #~ msgctxt "dictionary variant" 16547 #~ msgid "with yo" 16548 #~ msgstr "«ё» аша язылу гына" 16549 16550 #~ msgctxt "dictionary variant" 16551 #~ msgid "extended" 16552 #~ msgstr "киңәйтелгән" 16553 16554 #~ msgctxt "dictionary name. %1-language, %2-country and %3 variant name" 16555 #~ msgid "%1 (%2) [%3]" 16556 #~ msgstr "%1 (%2) [%3]" 16557 16558 #~ msgctxt "dictionary name. %1-language and %2-country name" 16559 #~ msgid "%1 (%2)" 16560 #~ msgstr "%1 (%2)" 16561 16562 #~ msgctxt "dictionary name. %1-language and %2-variant name" 16563 #~ msgid "%1 [%2]" 16564 #~ msgstr "%1 [%2]" 16565 16566 #~ msgid "Cannot open %1 for reading" 16567 #~ msgstr "%1 файлын укып булмады" 16568 16569 #~ msgid "Cannot create memory segment for file %1" 16570 #~ msgstr "%1 файлы өчен хәтер өлкәсен биреп булмады" 16571 16572 #~ msgid "Could not read data from %1 into shm" 16573 #~ msgstr "%1 файлыннан shm объектына мәгълуматны күчереп булмады" 16574 16575 #~ msgid "Only 'ReadOnly' allowed" 16576 #~ msgstr "Укырга гына рөхсәт ителә" 16577 16578 #~ msgid "Cannot seek past eof" 16579 #~ msgstr "Файлы ахырыннан соң күчеш тыела" 16580 16581 #~ msgid "No service matching the requirements was found." 16582 #~ msgstr "Бу таләпләргә туры килүче хезмәт табылмады." 16583 16584 #~ msgid "" 16585 #~ "The service provides no library, the Library key is missing in the ." 16586 #~ "desktop file." 16587 #~ msgstr "" 16588 #~ "Хезмәт китапханә белән тәэмин итмә алмады, .desktop файлында «Library» " 16589 #~ "язуы табылмады." 16590 16591 #~ msgid "The library does not export a factory for creating components." 16592 #~ msgstr "Китапханә компонентларны ясау коралларын үз эченә алмый." 16593 16594 #~ msgid "" 16595 #~ "The factory does not support creating components of the specified type." 16596 #~ msgstr "Фабрика билгеләнгән төренең компонентларын ясый алмый." 16597 16598 #~ msgid "KLibLoader: Unknown error" 16599 #~ msgstr "KLibLoader: билгесез хата" 16600 16601 #~ msgid "Could not find plugin '%1' for application '%2'" 16602 #~ msgstr "«%2» кушымтасының «%1» өстәлмәсе табылмады" 16603 16604 #~ msgid "The provided service is not valid" 16605 #~ msgstr "Ялгышлы хезмәт күрсәтелде" 16606 16607 #, fuzzy 16608 #~| msgid "" 16609 #~| "The service '%1' provides no library or the Library key is missing in " 16610 #~ msgid "The service '%1' provides no library or the Library key is missing" 16611 #~ msgstr "" 16612 #~ "«%1» хезмәте китапханә белән тәэмин итә алмады яисә «Library» язуы " 16613 #~ "табылмады " 16614 16615 #~ msgid "The library %1 does not offer a KDE 4 compatible factory." 16616 #~ msgstr "" 16617 #~ "%1 китапханәсе KDE4 чолганышына туры килүче компонентларын ясый алмый." 16618 16619 #~ msgid "The plugin '%1' uses an incompatible KDE library (%2)." 16620 #~ msgstr "" 16621 #~ "«%1» өстәлмәсе KDE чолганышының %2 дигән яраксыз китапханәсен куллана." 16622 16623 #~ msgid "KBuildSycoca" 16624 #~ msgstr "KBuildSycoca" 16625 16626 #~ msgid "Rebuilds the system configuration cache." 16627 #~ msgstr "Система конфигурациясенең кэшын яңача ясау." 16628 16629 #~ msgid "(c) 1999-2002 KDE Developers" 16630 #~ msgstr "© KDE чолганышы ясаучылары, 1999-2002" 16631 16632 #~ msgid "Do not signal applications to update" 16633 #~ msgstr "Кушымталарга яңарту сигналын тапшырмау" 16634 16635 #~ msgid "Disable incremental update, re-read everything" 16636 #~ msgstr "Инкремент яңартуны өзү, бөтенесен укып чыгу" 16637 16638 #~ msgid "Check file timestamps" 16639 #~ msgstr "Файлларның үзгәргән вакытын тикшерү" 16640 16641 #~ msgid "Disable checking files (dangerous)" 16642 #~ msgstr "Файллар тикшерүен өзү (игьтибар булыгыз - имин түгел)" 16643 16644 #~ msgid "Create global database" 16645 #~ msgstr "Глобаль базаны ясау" 16646 16647 #~ msgid "Perform menu generation test run only" 16648 #~ msgstr "Меню ясау тикшерүен гына башкару" 16649 16650 #~ msgid "Track menu id for debug purposes" 16651 #~ msgstr "Төзәткечнең идентификатор менюсын күзәтү" 16652 16653 #~ msgid "KDE Daemon" 16654 #~ msgstr "KDE хезмәте" 16655 16656 #~ msgid "KDE Daemon - triggers Sycoca database updates when needed" 16657 #~ msgstr "" 16658 #~ "KDE хезмәте - Sycoca мәгълүмат базасын яңартуын кирәк булганда гына җибәрә" 16659 16660 #~ msgid "Check Sycoca database only once" 16661 #~ msgstr "Sycoca хезмәтенең мәгълүмат базасын бер генә тапкыр тикшерү" 16662 16663 #~ msgid "" 16664 #~ "The key sequence '%1' is ambiguous. Use 'Configure Shortcuts'\n" 16665 #~ "from the 'Settings' menu to solve the ambiguity.\n" 16666 #~ "No action will be triggered." 16667 #~ msgstr "" 16668 #~ "Конфликт действий на комбинации клавиш «%1». Используйте пункт \n" 16669 #~ "«Комбинации клавиш» меню «Настройка» чтобы исправить конфликт.\n" 16670 #~ "Не выполнено ни одно из конфликтующих действий." 16671 16672 #~ msgid "Ambiguous shortcut detected" 16673 #~ msgstr "Гамәлләрнең бәрелеше" 16674 16675 #~ msgctxt "Encodings menu" 16676 #~ msgid "Default" 16677 #~ msgstr "Үрнәкле" 16678 16679 #~ msgctxt "Encodings menu" 16680 #~ msgid "Autodetect" 16681 #~ msgstr "Автоматик рәвештә билгеләү" 16682 16683 #~ msgid "No Entries" 16684 #~ msgstr "Язмасыз" 16685 16686 #~ msgid "Clear List" 16687 #~ msgstr "Исемлекне чистарту" 16688 16689 #~ msgctxt "go back" 16690 #~ msgid "&Back" 16691 #~ msgstr "&Кире кайту" 16692 16693 #~ msgctxt "go forward" 16694 #~ msgid "&Forward" 16695 #~ msgstr "&Алга бару" 16696 16697 #~ msgctxt "home page" 16698 #~ msgid "&Home" 16699 #~ msgstr "&Башына күчү" 16700 16701 #~ msgctxt "show help" 16702 #~ msgid "&Help" 16703 #~ msgstr "Белешмә" 16704 16705 #~ msgid "Show &Menubar" 16706 #~ msgstr "Менюны &чагылдыру" 16707 16708 #~ msgid "Show Menubar<p>Shows the menubar again after it has been hidden</p>" 16709 #~ msgstr "" 16710 #~ "Менюны чагылдыру<p>Качырылганнан соң менюны тагын бер тапкыр чагылдыру</p>" 16711 16712 #~ msgid "Show St&atusbar" 16713 #~ msgstr "Торыш юлын ч&агылдыру" 16714 16715 #, fuzzy 16716 #~| msgid "" 16717 #~| "Show Statusbar<p>Shows the statusbar, which is the bar at the bottom of " 16718 #~| "the window used for status information.</p>" 16719 #~ msgid "" 16720 #~ "Show Statusbar<p>Shows the statusbar, which is the bar at the bottom of " 16721 #~ "the window used for status information.</p>" 16722 #~ msgstr "" 16723 #~ "Торыш юлын чагылдыру<p>Торыш юлы - кушымтаның тәрәзә астында урнашкан һәм " 16724 #~ "аның эш-хәлен чагылдыручы буй.</p>" 16725 16726 #~ msgid "&New" 16727 #~ msgstr "&Новый" 16728 16729 #~ msgid "&Open..." 16730 #~ msgstr "&Ачу..." 16731 16732 #~ msgid "Open &Recent" 16733 #~ msgstr "&Күптән түгелдәге файллар" 16734 16735 #~ msgid "&Save" 16736 #~ msgstr "&Саклау" 16737 16738 #, fuzzy 16739 #~| msgid "Close Document" 16740 #~ msgid "Save document" 16741 #~ msgstr "Документны ябу" 16742 16743 #~ msgid "Save &As..." 16744 #~ msgstr "&Саклау..." 16745 16746 #~ msgid "Re&vert" 16747 #~ msgstr "&Тергезү" 16748 16749 #~ msgid "&Close" 16750 #~ msgstr "&Ябу" 16751 16752 #, fuzzy 16753 #~| msgid "Close Document" 16754 #~ msgid "Close document" 16755 #~ msgstr "Документны ябу" 16756 16757 #~ msgid "&Print..." 16758 #~ msgstr "Бас&тыру..." 16759 16760 #, fuzzy 16761 #~| msgctxt "keyboard-key-name" 16762 #~| msgid "PrintScreen" 16763 #~ msgid "Print document" 16764 #~ msgstr "PrintScreen" 16765 16766 #~ msgid "Print Previe&w" 16767 #~ msgstr "Пред&варительный просмотр" 16768 16769 #~ msgid "&Mail..." 16770 #~ msgstr "Почта аша &тапшыру..." 16771 16772 #~ msgid "&Quit" 16773 #~ msgstr "Ч&ыгу" 16774 16775 #~ msgid "Quit application" 16776 #~ msgstr "Кушымтадан чыгу" 16777 16778 #~ msgid "Re&do" 16779 #~ msgstr "&Кабатлау" 16780 16781 #, fuzzy 16782 #~| msgctxt "" 16783 #~| "A link to make a donation for a Get Hot New Stuff item (opens a web " 16784 #~| "browser)" 16785 #~| msgid "Make a donation" 16786 #~ msgid "Redo last undone action" 16787 #~ msgstr "Иганә ясау" 16788 16789 #~ msgid "Cu&t" 16790 #~ msgstr "К&исеп алу" 16791 16792 #~ msgid "&Copy" 16793 #~ msgstr "&Күчермә ясау" 16794 16795 #~ msgid "&Paste" 16796 #~ msgstr "&Кертеп кую" 16797 16798 #, fuzzy 16799 #~| msgid "Upload content" 16800 #~ msgid "Paste clipboard content" 16801 #~ msgstr "Әсбапларны серверга тапшыру" 16802 16803 #~ msgid "C&lear" 16804 #~ msgstr "&Чистарту" 16805 16806 #~ msgid "Select &All" 16807 #~ msgstr "Бө&тенесен сайлау" 16808 16809 #~ msgid "Dese&lect" 16810 #~ msgstr "Сайлауны &кире кагу" 16811 16812 #~ msgid "&Find..." 16813 #~ msgstr "&Табу..." 16814 16815 #~ msgid "Find &Next" 16816 #~ msgstr "Э&зләүне дәвам итү" 16817 16818 #~ msgid "Find Pre&vious" 16819 #~ msgstr "Алдангысын &табу" 16820 16821 #~ msgid "&Replace..." 16822 #~ msgstr "&Алыштыру..." 16823 16824 #~ msgid "&Actual Size" 16825 #~ msgstr "&Фактик зурлык" 16826 16827 #~ msgid "&Fit to Page" 16828 #~ msgstr "&Битне тулысынча кертү" 16829 16830 #~ msgid "Fit to Page &Width" 16831 #~ msgstr "Бит &киңлегендә" 16832 16833 #~ msgid "Fit to Page &Height" 16834 #~ msgstr "Бит &биеклегендә" 16835 16836 #~ msgid "Zoom &In" 16837 #~ msgstr "З&урайту" 16838 16839 #~ msgid "Zoom &Out" 16840 #~ msgstr "К&ечәйтү" 16841 16842 #~ msgid "&Zoom..." 16843 #~ msgstr "&Масштаб..." 16844 16845 #, fuzzy 16846 #~| msgid "Select a week" 16847 #~ msgid "Select zoom level" 16848 #~ msgstr "Атнаны сайлагыз" 16849 16850 #, fuzzy 16851 #~| msgid "&Redisplay" 16852 #~ msgid "Redisplay document" 16853 #~ msgstr "Сурәтне &яңарту" 16854 16855 #~ msgid "&Up" 16856 #~ msgstr "Ө&скә" 16857 16858 #~ msgid "&Previous Page" 16859 #~ msgstr "&Алдынгы бит" 16860 16861 #, fuzzy 16862 #~| msgid "&Previous Page" 16863 #~ msgid "Go to previous page" 16864 #~ msgstr "&Алдынгы бит" 16865 16866 #~ msgid "&Next Page" 16867 #~ msgstr "&Киләсе бит" 16868 16869 #, fuzzy 16870 #~| msgctxt "@action" 16871 #~| msgid "Go to Line" 16872 #~ msgid "Go to next page" 16873 #~ msgstr "Юлга күчү" 16874 16875 #~ msgid "&Go To..." 16876 #~ msgstr "&Күчү..." 16877 16878 #~ msgid "&Go to Page..." 16879 #~ msgstr "Биткә &күчү..." 16880 16881 #~ msgid "&Go to Line..." 16882 #~ msgstr "&Юлга күчү..." 16883 16884 #, fuzzy 16885 #~| msgctxt "@action" 16886 #~| msgid "Go to Line" 16887 #~ msgid "Go to first page" 16888 #~ msgstr "Юлга күчү" 16889 16890 #, fuzzy 16891 #~| msgid "&Go to Page..." 16892 #~ msgid "Go to last page" 16893 #~ msgstr "Биткә &күчү..." 16894 16895 #, fuzzy 16896 #~| msgid "&Back in the Document" 16897 #~ msgid "Go back in document" 16898 #~ msgstr "&Документы буенча артка кайту" 16899 16900 #, fuzzy 16901 #~| msgctxt "go forward" 16902 #~| msgid "&Forward" 16903 #~ msgid "&Forward" 16904 #~ msgstr "&Алга бару" 16905 16906 #, fuzzy 16907 #~| msgid "&Forward in the Document" 16908 #~ msgid "Go forward in document" 16909 #~ msgstr "&Документ буенча алга бару" 16910 16911 #~ msgid "&Add Bookmark" 16912 #~ msgstr "Кыстыргычны &өстәү" 16913 16914 #~ msgid "&Edit Bookmarks..." 16915 #~ msgstr "К&ыстыргычларны үзгәртү..." 16916 16917 #~ msgid "&Spelling..." 16918 #~ msgstr "&Дөрес язылышны тикшерү..." 16919 16920 #, fuzzy 16921 #~| msgid "Check Spelling" 16922 #~ msgid "Check spelling in document" 16923 #~ msgstr "Дөрес язылышны тикшерү" 16924 16925 #, fuzzy 16926 #~| msgid "Show &Menubar" 16927 #~ msgid "Show or hide menubar" 16928 #~ msgstr "Менюны &чагылдыру" 16929 16930 #~ msgid "Show &Toolbar" 16931 #~ msgstr "Кораллар панелен &күрсәтү" 16932 16933 #, fuzzy 16934 #~| msgctxt "@action" 16935 #~| msgid "Show Toolbar" 16936 #~ msgid "Show or hide toolbar" 16937 #~ msgstr "Кораллар панелен күрсәтү" 16938 16939 #, fuzzy 16940 #~| msgctxt "@action" 16941 #~| msgid "Show Statusbar" 16942 #~ msgid "Show or hide statusbar" 16943 #~ msgstr "Торыш юлын күрсәтү" 16944 16945 #~ msgid "F&ull Screen Mode" 16946 #~ msgstr "&Тулы экранлы режим" 16947 16948 #~ msgid "&Save Settings" 16949 #~ msgstr "&Параметрларны саклау" 16950 16951 #~ msgid "Configure S&hortcuts..." 16952 #~ msgstr "&Төймәләр тезмәләре..." 16953 16954 #~ msgid "&Configure %1..." 16955 #~ msgstr "%1 &көйләүләре..." 16956 16957 #~ msgid "Configure Tool&bars..." 16958 #~ msgstr "Кораллар &панеле көйләүләре..." 16959 16960 #~ msgid "Configure &Notifications..." 16961 #~ msgstr "&Белдерүләр..." 16962 16963 #~ msgid "%1 &Handbook" 16964 #~ msgstr "«%1» кулланучының &кулланмасы" 16965 16966 #~ msgid "What's &This?" 16967 #~ msgstr "&Нәрсә бу?" 16968 16969 #~ msgid "Tip of the &Day" 16970 #~ msgstr "Бар мон&да бер киңәш..." 16971 16972 #~ msgid "&Report Bug..." 16973 #~ msgstr "Хата турында &хәбәр итү..." 16974 16975 #~ msgid "Switch Application &Language..." 16976 #~ msgstr "Кушымтаның &телен алыштыру..." 16977 16978 #~ msgid "&About %1" 16979 #~ msgstr "«%1» &турында" 16980 16981 #~ msgid "About &KDE" 16982 #~ msgstr "KDE &турында" 16983 16984 #, fuzzy 16985 #~| msgid "Exit F&ull Screen Mode" 16986 #~ msgctxt "@action:inmenu" 16987 #~ msgid "Exit F&ull Screen Mode" 16988 #~ msgstr "&Тулы экранлы режимнан чыгу" 16989 16990 #, fuzzy 16991 #~| msgid "Exit Full Screen" 16992 #~ msgctxt "@action:intoolbar" 16993 #~ msgid "Exit Full Screen" 16994 #~ msgstr "Тулы экраннан чыгу" 16995 16996 #, fuzzy 16997 #~| msgid "Exit F&ull Screen Mode" 16998 #~ msgctxt "@info:tooltip" 16999 #~ msgid "Exit full screen mode" 17000 #~ msgstr "&Тулы экранлы режимнан чыгу" 17001 17002 #, fuzzy 17003 #~| msgid "F&ull Screen Mode" 17004 #~ msgctxt "@action:inmenu" 17005 #~ msgid "F&ull Screen Mode" 17006 #~ msgstr "&Тулы экранлы режим" 17007 17008 #, fuzzy 17009 #~| msgid "Full Screen" 17010 #~ msgctxt "@action:intoolbar" 17011 #~ msgid "Full Screen" 17012 #~ msgstr "Тулы экран" 17013 17014 #~ msgctxt "Custom color" 17015 #~ msgid "Custom..." 17016 #~ msgstr "Башка..." 17017 17018 #~ msgid "" 17019 #~ "<qt>No information available.<br />The supplied KAboutData object does " 17020 #~ "not exist.</qt>" 17021 #~ msgstr "" 17022 #~ "<qt>Кызганычка каршы, мәгълумат юк.<br />Кушымта KAboutData объекты белән " 17023 #~ "тәэмин итмәде.</qt>" 17024 17025 #~ msgid "" 17026 #~ "<html><font size=\"5\">%1</font><br /><b>Version %2</b><br /> </html>" 17027 #~ msgstr "" 17028 #~ "<html><font size=\"5\">%1</font><br /><b>%2 юрамасы</b><br /> </html>" 17029 17030 #~ msgctxt "" 17031 #~ "Program name, version and KDE platform version; do not translate " 17032 #~ "'Development Platform'" 17033 #~ msgid "" 17034 #~ "<html><font size=\"5\">%1</font><br /><b>Version %2</b><br />Using KDE " 17035 #~ "Development Platform %3</html>" 17036 #~ msgstr "" 17037 #~ "<html><font size=\"5\">%1</font><br /><b>%2 юрамасы</b><br />KDE %3 төзү " 17038 #~ "платформасы кулланыла</html>" 17039 17040 #~ msgid "License: %1" 17041 #~ msgstr "Лицензия: %1" 17042 17043 #~ msgid "License Agreement" 17044 #~ msgstr "Лицензион килешү" 17045 17046 #~ msgctxt "Action to send an email to a contributor" 17047 #~ msgid "Email contributor" 17048 #~ msgstr "Канташучыга эл. почта аша хат тапшыру" 17049 17050 #~ msgid "Visit contributor's homepage" 17051 #~ msgstr "Катнашучының веб-сәхифәсенә күчү" 17052 17053 #~ msgctxt "Action to send an email to a contributor" 17054 #~ msgid "" 17055 #~ "Email contributor\n" 17056 #~ "%1" 17057 #~ msgstr "" 17058 #~ "Канташучыга эл. почта аша хат тапшыру:\n" 17059 #~ "%1" 17060 17061 #~ msgid "" 17062 #~ "Visit contributor's homepage\n" 17063 #~ "%1" 17064 #~ msgstr "" 17065 #~ "Катнашучының веб-сәхифәсенә күчү:\n" 17066 #~ "%1" 17067 17068 #~ msgid "" 17069 #~ "Visit contributor's profile on %1\n" 17070 #~ "%2" 17071 #~ msgstr "" 17072 #~ "Посетить страницу профиля помощника на %1\n" 17073 #~ "%2" 17074 17075 #~ msgid "" 17076 #~ "Visit contributor's page\n" 17077 #~ "%1" 17078 #~ msgstr "" 17079 #~ "Посетить страницу помощника\n" 17080 #~ "%1" 17081 17082 #~ msgid "" 17083 #~ "Visit contributor's blog\n" 17084 #~ "%1" 17085 #~ msgstr "" 17086 #~ "Катнашучының блогына күчү:\n" 17087 #~ "%1" 17088 17089 #~ msgctxt "@item Contributor name in about dialog." 17090 #~ msgid "%1" 17091 #~ msgstr "%1" 17092 17093 #~ msgctxt "City, Country" 17094 #~ msgid "%1, %2" 17095 #~ msgstr "%1, %2" 17096 17097 #~ msgctxt "A generic social network or homepage link of an unlisted type." 17098 #~ msgid "Other" 17099 #~ msgstr "Башкалар" 17100 17101 #~ msgctxt "A type of link." 17102 #~ msgid "Blog" 17103 #~ msgstr "Блог" 17104 17105 #~ msgctxt "A type of link." 17106 #~ msgid "Homepage" 17107 #~ msgstr "Албит" 17108 17109 #~ msgid "About KDE" 17110 #~ msgstr "KDE турында" 17111 17112 #~ msgid "" 17113 #~ "<html><font size=\"5\">KDE - Be Free!</font><br /><b>Platform Version %1</" 17114 #~ "b></html>" 17115 #~ msgstr "" 17116 #~ "<html><font size=\"5\">KDE - Азат яшә!</font><br /><b>%1 платформаның " 17117 #~ "юрамасы</b></html>" 17118 17119 #~ msgid "" 17120 #~ "<html><b>KDE</b> is a world-wide network of software engineers, artists, " 17121 #~ "writers, translators and facilitators who are committed to <a href=" 17122 #~ "\"%1\">Free Software</a> development. This community has created hundreds " 17123 #~ "of Free Software applications as part of the KDE Development Platform and " 17124 #~ "KDE Software Distribution.<br /><br />KDE is a cooperative enterprise in " 17125 #~ "which no single entity controls the efforts or products of KDE to the " 17126 #~ "exclusion of others. Everyone is welcome to join and contribute to KDE, " 17127 #~ "including you.<br /><br />Visit <a href=\"%2\">%2</a> for more " 17128 #~ "information about the KDE community and the software we produce.</html>" 17129 #~ msgstr "" 17130 #~ "<html><b>KDE</b> — международное сообщество программистов, дизайнеров, " 17131 #~ "переводчиков и других людей, так или иначе, посвящающих себя разработке " 17132 #~ "<a href=\"%1\">свободного программного обеспечения</a>. Это сообщество " 17133 #~ "поддерживает Платформу KDE (KDE Development Platform) и Набор прикладного " 17134 #~ "ПО KDE (KDE Software Distribution).<br /><br />Не существует группы или " 17135 #~ "организации, держащей под исключительным контролем действия или продукты " 17136 #~ "KDE. Мы будем рады каждому, кто захочет внести свой вклад в развитие KDE." 17137 #~ "<br /><br />Для того чтобы больше узнать о проекте, зайдите на сайт <a " 17138 #~ "href=\"%2\">%2</a>.</html>" 17139 17140 #~ msgid "" 17141 #~ "<html>Software can always be improved, and the KDE team is ready to do " 17142 #~ "so. However, you - the user - must tell us when something does not work " 17143 #~ "as expected or could be done better.<br /><br />KDE has a bug tracking " 17144 #~ "system. Visit <a href=\"%1\">%1</a> or use the \"Report Bug...\" dialog " 17145 #~ "from the \"Help\" menu to report bugs.<br /><br />If you have a " 17146 #~ "suggestion for improvement then you are welcome to use the bug tracking " 17147 #~ "system to register your wish. Make sure you use the severity called " 17148 #~ "\"Wishlist\".</html>" 17149 #~ msgstr "" 17150 #~ "<html>Программное обеспечение всегда можно улучшить, и команда KDE готова " 17151 #~ "этим заниматься. Однако, для этого надо, чтобы вы, обычный пользователь, " 17152 #~ "сообщили нам о том, что не соответствует вашим ожиданиям и что можно было " 17153 #~ "бы улучшить.<br /><br />В рамках проекта KDE создана система учёта ошибок " 17154 #~ "и пожеланий. Для того чтобы сообщить об ошибке, зайдите на сайт <a href=" 17155 #~ "\"%1\">%1</a> или отправьте сообщение по электронной почте, используя " 17156 #~ "пункт «Сообщить об ошибке...» из меню «Справка» содержащего ошибку " 17157 #~ "приложения. Сообщение должно быть на английском языке.<br /><br />Ваши " 17158 #~ "пожелания можно зарегистрировать тем же способом. При регистрации " 17159 #~ "пожеланий не забудьте установить уровень важности «Wishlist» (пожелание)." 17160 #~ "<br /><br />Для связи с командой перевода KDE на русский язык используйте " 17161 #~ "почтовую рассылку <a href=\"https://lists.kde.ru/mailman/listinfo/kde-" 17162 #~ "russian\">kde-russian@lists.kde.ru</a>.</html>" 17163 17164 #~ msgid "" 17165 #~ "<html>You do not have to be a software developer to be a member of the " 17166 #~ "KDE team. You can join the national teams that translate program " 17167 #~ "interfaces. You can provide graphics, themes, sounds, and improved " 17168 #~ "documentation. You decide!<br /><br />Visit <a href=\"%1\">%1</a> for " 17169 #~ "information on some projects in which you can participate.<br /><br />If " 17170 #~ "you need more information or documentation, then a visit to <a href=" 17171 #~ "\"%2\">%2</a> will provide you with what you need.</html>" 17172 #~ msgstr "" 17173 #~ "<html>Для того чтобы включиться в разработку KDE, не обязательно быть " 17174 #~ "программистом. Вы можете помочь в переводе KDE на родной язык, создавать " 17175 #~ "графику, стили, звуки, улучшать документацию — то есть тем, чем вы сами " 17176 #~ "хотите заниматься.<br /><br />Список проектов, в которых вы могли бы " 17177 #~ "принять участие, приведён на сайте <a href=\"%1\">%1</a>. Вполне " 17178 #~ "возможно, какой-то из них вас заинтересует.<br /><br />Более подробные " 17179 #~ "сведения и документацию можно найти на сайте <a href=\"%2\">%2</a>.</html>" 17180 17181 #~ msgid "" 17182 #~ "<html>KDE software is and will always be available free of charge, " 17183 #~ "however creating it is not free.<br /><br />To support development the " 17184 #~ "KDE community has formed the KDE e.V., a non-profit organization legally " 17185 #~ "founded in Germany. KDE e.V. represents the KDE community in legal and " 17186 #~ "financial matters. See <a href=\"%1\">%1</a> for information on KDE e.V." 17187 #~ "<br /><br />KDE benefits from many kinds of contributions, including " 17188 #~ "financial. We use the funds to reimburse members and others for expenses " 17189 #~ "they incur when contributing. Further funds are used for legal support " 17190 #~ "and organizing conferences and meetings. <br /> <br />We would like to " 17191 #~ "encourage you to support our efforts with a financial donation, using one " 17192 #~ "of the ways described at <a href=\"%2\">%2</a>.<br /><br />Thank you very " 17193 #~ "much in advance for your support.</html>" 17194 #~ msgstr "" 17195 #~ "<html>Среда KDE распространяется бесплатно, но её создание требует затрат." 17196 #~ "<br /><br />Поэтому команда KDE основала Ассоциацию KDE, некоммерческую " 17197 #~ "организацию, которая зарегистрирована в Германии. Ассоциация KDE " 17198 #~ "представляет проект KDE в правовом и финансовом аспектах. Посетите <a " 17199 #~ "href=\"%1\">%1</a> для получения более подробной информации об Ассоциации " 17200 #~ "KDE.<br /><br />Финансовая поддержка идёт на благо KDE. Большая часть " 17201 #~ "средств используется для возмещения расходов участников проекта, которые " 17202 #~ "они несут при разработке KDE. Остальные средства используются для " 17203 #~ "юридической поддержки и организации конференций и встреч. Вы можете " 17204 #~ "поддержать KDE финансовым пожертвованием, которое может быть внесено " 17205 #~ "одним из способов, описанных на странице <a href=\"%2\">%2</a>. <br /" 17206 #~ "><br />Заранее благодарим за поддержку!</html>" 17207 17208 #~ msgctxt "About KDE" 17209 #~ msgid "&About" 17210 #~ msgstr "KDE &чолганышы турында" 17211 17212 #~ msgid "&Report Bugs or Wishes" 17213 #~ msgstr "&Хаталар һәм теләкләр турында хәбәр итү" 17214 17215 #~ msgid "&Join KDE" 17216 #~ msgstr "&KDE проектына кушылу" 17217 17218 #~ msgid "&Support KDE" 17219 #~ msgstr "&KDE проектына ярдәм итү" 17220 17221 #~ msgctxt "Opposite to Back" 17222 #~ msgid "Next" 17223 #~ msgstr "Алга бару" 17224 17225 #~ msgid "Finish" 17226 #~ msgstr "Тәмамлау" 17227 17228 #~ msgid "Submit Bug Report" 17229 #~ msgstr "Хата турында хисапны тапшыру" 17230 17231 #~ msgid "" 17232 #~ "Your email address. If incorrect, use the Configure Email button to " 17233 #~ "change it" 17234 #~ msgstr "" 17235 #~ "Бу сезнең электрон адресыгыз. Ул дөрес булмаса, \"Электрон почтаны көйләү" 17236 #~ "\" төймәсенә басыгыз һәм аны үзгәртегез." 17237 17238 #~ msgctxt "Email sender address" 17239 #~ msgid "From:" 17240 #~ msgstr "Кемнән:" 17241 17242 #~ msgid "Configure Email..." 17243 #~ msgstr "Электрон почтаны көйләү..." 17244 17245 #~ msgid "The email address this bug report is sent to." 17246 #~ msgstr "Хата турында хисапны тапшыру өчен почта адресы." 17247 17248 #~ msgid "Send bug report." 17249 #~ msgstr "Хата турында хисап җибәрү." 17250 17251 #~ msgid "Send this bug report to %1." 17252 #~ msgstr "Хата турында хисапны %1 га җибәрү." 17253 17254 #~ msgid "" 17255 #~ "The application for which you wish to submit a bug report - if incorrect, " 17256 #~ "please use the Report Bug menu item of the correct application" 17257 #~ msgstr "" 17258 #~ "Тасвирланган хатаны тәшкил итүче кушымта. Әгәр монда башка кушымта " 17259 #~ "кулланылган булса, \"Хата турында хәбәр җибәрү\" менюсындагы пунктны " 17260 #~ "кулланыгыз." 17261 17262 #~ msgid "Application: " 17263 #~ msgstr "Кушымта: " 17264 17265 #~ msgid "" 17266 #~ "The version of this application - please make sure that no newer version " 17267 #~ "is available before sending a bug report" 17268 #~ msgstr "" 17269 #~ "Кушымтаның юрамасы. Хата турында хисапны җибәргәнче, яңа юраманың тәшкил " 17270 #~ "булуын тикшерегез." 17271 17272 #~ msgid "Version:" 17273 #~ msgstr "Юрама:" 17274 17275 #~ msgid "no version set (programmer error)" 17276 #~ msgstr "юрама турында мәгълумат юк (кушымта ясаучының хатасы!)" 17277 17278 #~ msgid "OS:" 17279 #~ msgstr "ОС:" 17280 17281 #~ msgid "Compiler:" 17282 #~ msgstr "Компилятор:" 17283 17284 #~ msgid "Se&verity" 17285 #~ msgstr "Мөһимлек &дәрәҗәсе" 17286 17287 #~ msgid "Critical" 17288 #~ msgstr "Тәнкыйть хата" 17289 17290 #~ msgid "Grave" 17291 #~ msgstr "Җитди хата" 17292 17293 #~ msgctxt "normal severity" 17294 #~ msgid "Normal" 17295 #~ msgstr "Гадәти" 17296 17297 #~ msgid "Wishlist" 17298 #~ msgstr "Теләк" 17299 17300 #~ msgid "" 17301 #~ "Enter the text (in English if possible) that you wish to submit for the " 17302 #~ "bug report.\n" 17303 #~ "If you press \"Send\", a mail message will be sent to the maintainer of " 17304 #~ "this program.\n" 17305 #~ msgstr "" 17306 #~ "Текст кертегез (теләк буенча, инглизчә), һәм хатаны тасвирлагыз.\n" 17307 #~ "Әгәр сез \"Тапшыру\"га бассагыз, хәбәр шул программаны җаваплы " 17308 #~ "эшкәртүчегәтапшырылачак.\n" 17309 17310 #~ msgid "" 17311 #~ "<qt>To submit a bug report, click on the button below. This will open a " 17312 #~ "web browser window on <a href=\"http://bugs.kde.org\">http://bugs.kde." 17313 #~ "org</a> where you will find a form to fill in. The information displayed " 17314 #~ "above will be transferred to that server.</qt>" 17315 #~ msgstr "" 17316 #~ "<qt>Для того, чтобы отправить сообщение об ошибке, нажмите на кнопку " 17317 #~ "внизу. Откроется окно с адресом <a href=\"http://bugs.kde.org\">http://" 17318 #~ "bugs.kde.org</a>, где можно будет заполнить форму. Информация будет " 17319 #~ "отправлена на сервер учёта ошибок.</qt>" 17320 17321 #~ msgid "&Launch Bug Report Wizard" 17322 #~ msgstr "&Хата турында хәбәр тапшыру остасын җибәрү" 17323 17324 #~ msgctxt "unknown program name" 17325 #~ msgid "unknown" 17326 #~ msgstr "билгесез" 17327 17328 #~ msgid "" 17329 #~ "You must specify both a subject and a description before the report can " 17330 #~ "be sent." 17331 #~ msgstr "" 17332 #~ "Тапшыру алдыннан хатаның темасын һәм аның тасвирлавын билгеләргә кирәк." 17333 17334 #~ msgid "" 17335 #~ "<p>You chose the severity <b>Critical</b>. Please note that this severity " 17336 #~ "is intended only for bugs that:</p><ul><li>break unrelated software on " 17337 #~ "the system (or the whole system)</li><li>cause serious data loss</" 17338 #~ "li><li>introduce a security hole on the system where the affected package " 17339 #~ "is installed</li></ul>\n" 17340 #~ "<p>Does the bug you are reporting cause any of the above damage? If it " 17341 #~ "does not, please select a lower severity. Thank you.</p>" 17342 #~ msgstr "" 17343 #~ "<p>Выбран уровень ошибки <b>Критическая</b>. Этот уровень подразумевает, " 17344 #~ "что ошибка:</p><ul><li>может вызвать сбой в работе других программ или " 17345 #~ "системы в целом</li><li>привести к порче и утрате данных</li><li>нарушить " 17346 #~ "безопасность системы, если установлен данный пакет</li></ul>\n" 17347 #~ "<p>Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " 17348 #~ "Если нет, выберите другой, менее высокий уровень ошибки.</p>" 17349 17350 #~ msgid "" 17351 #~ "<p>You chose the severity <b>Grave</b>. Please note that this severity is " 17352 #~ "intended only for bugs that:</p><ul><li>make the package in question " 17353 #~ "unusable or mostly so</li><li>cause data loss</li><li>introduce a " 17354 #~ "security hole allowing access to the accounts of users who use the " 17355 #~ "affected package</li></ul>\n" 17356 #~ "<p>Does the bug you are reporting cause any of the above damage? If it " 17357 #~ "does not, please select a lower severity. Thank you.</p>" 17358 #~ msgstr "" 17359 #~ "<p>Вы выбрали уровень ошибки <b>Опасная</b>. Этот уровень подразумевает, " 17360 #~ "что ошибка:</p><ul><li>может вызвать неисправимый сбой в работе данного " 17361 #~ "пакета</li><li>привести к утрате данных</li><li>нарушить безопасность " 17362 #~ "системы и открыть доступ к файлам пользователей, установивших данный " 17363 #~ "пакет</li></ul>\n" 17364 #~ "<p>Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " 17365 #~ "Если нет, выберите другой, менее высокий уровень ошибки.</p>" 17366 17367 #~ msgid "" 17368 #~ "Unable to send the bug report.\n" 17369 #~ "Please submit a bug report manually....\n" 17370 #~ "See http://bugs.kde.org/ for instructions." 17371 #~ msgstr "" 17372 #~ "Хата турында хәбәрне җибәреп булмады.\n" 17373 #~ "Сез хәбәрне кулдан җибәрә аласыз.\n" 17374 #~ "Аңлатмалар өчен http://bugs.kde.org/ сәхифәсенә\n" 17375 #~ "мөрәҗәгать итегез." 17376 17377 #~ msgid "Bug report sent, thank you for your input." 17378 #~ msgstr "Хата турында хәбәр тапшырылды, рәхмәт." 17379 17380 #~ msgid "" 17381 #~ "Close and discard\n" 17382 #~ "edited message?" 17383 #~ msgstr "" 17384 #~ "Кертелгән хәбәрне\n" 17385 #~ "ябаргамы, кире кагыргамы?" 17386 17387 #~ msgid "Close Message" 17388 #~ msgstr "Хәбәрне ябу" 17389 17390 #~ msgid "Configure" 17391 #~ msgstr "Көйләү" 17392 17393 #~ msgid "Job Control" 17394 #~ msgstr "Эш белән идарә итү" 17395 17396 #~ msgid "Scheduled printing:" 17397 #~ msgstr "Кичектергән бастыру:" 17398 17399 #~ msgid "Billing information:" 17400 #~ msgstr "Бастыруның бәясе:" 17401 17402 #~ msgid "Job priority:" 17403 #~ msgstr "tЭшнең беренчелеге" 17404 17405 #~ msgid "Job Options" 17406 #~ msgstr "Эшнең көйләүләре" 17407 17408 #~ msgid "Option" 17409 #~ msgstr "Параметр" 17410 17411 #~ msgid "Value" 17412 #~ msgstr "Мәгънә" 17413 17414 #~ msgid "Print Immediately" 17415 #~ msgstr "Хәзер үк бастыру" 17416 17417 #~ msgid "Hold Indefinitely" 17418 #~ msgstr "Киләсе күрсәтмәләргә кадәр тотып тору" 17419 17420 #~ msgid "Day (06:00 to 17:59)" 17421 #~ msgstr "Көн (06:00 — 17:59)" 17422 17423 #~ msgid "Night (18:00 to 05:59)" 17424 #~ msgstr "Төн (18:00 — 05:59)" 17425 17426 #~ msgid "Second Shift (16:00 to 23:59)" 17427 #~ msgstr "Икенче алмашу вакытында (16:00 — 23:59)" 17428 17429 #~ msgid "Third Shift (00:00 to 07:59)" 17430 #~ msgstr "Өченче алмашу вакытында (00:00 — 07:59)" 17431 17432 #~ msgid "Weekend (Saturday to Sunday)" 17433 #~ msgstr "Ял көне (шимбә һәм якшәмбе)" 17434 17435 #~ msgid "Pages Per Sheet" 17436 #~ msgstr "Бер табактагы бит саны" 17437 17438 #~ msgid "6" 17439 #~ msgstr "6" 17440 17441 #~ msgid "9" 17442 #~ msgstr "9" 17443 17444 #~ msgid "16" 17445 #~ msgstr "16" 17446 17447 #~ msgid "Banner Pages" 17448 #~ msgstr "Бүлүче битләрне бастыру" 17449 17450 #~ msgctxt "Banner page at start" 17451 #~ msgid "Start" 17452 #~ msgstr "Башлау" 17453 17454 #~ msgctxt "Banner page at end" 17455 #~ msgid "End" 17456 #~ msgstr "Ахыр" 17457 17458 #~ msgid "Page Label" 17459 #~ msgstr "Битнең исеме" 17460 17461 #~ msgid "Page Border" 17462 #~ msgstr "Битнең чиге" 17463 17464 #~ msgid "Mirror Pages" 17465 #~ msgstr "Битнең кире чагылышы" 17466 17467 #~ msgid "Mirror pages along vertical axis" 17468 #~ msgstr "Асма сызык буенча битне кире чагылдыру" 17469 17470 #~ msgid "Left to Right, Top to Bottom" 17471 #~ msgstr "Сулдан уңга, өстән аска" 17472 17473 #~ msgid "Left to Right, Bottom to Top" 17474 #~ msgstr "Сулдан уңга, астан өскә" 17475 17476 #~ msgid "Right to Left, Bottom to Top" 17477 #~ msgstr "Уңнан сулга, астан өскә" 17478 17479 #~ msgid "Right to Left, Top to Bottom" 17480 #~ msgstr "Уңнан сулга, өстән аска" 17481 17482 #~ msgid "Bottom to Top, Left to Right" 17483 #~ msgstr "Астан өскә, сулдан уңга" 17484 17485 #~ msgid "Bottom to Top, Right to Left" 17486 #~ msgstr "Астан өскә, уңнан сулга" 17487 17488 #~ msgid "Top to Bottom, Left to Right" 17489 #~ msgstr "Өстән аска, сулдан уңга" 17490 17491 #~ msgid "Top to Bottom, Right to Left" 17492 #~ msgstr "Өстән аска, уңнан сулга" 17493 17494 #~ msgid "Single Line" 17495 #~ msgstr "Бер сызык" 17496 17497 #~ msgid "Single Thick Line" 17498 #~ msgstr "Бер калын сызык" 17499 17500 #~ msgid "Double Line" 17501 #~ msgstr "Икеле сызык" 17502 17503 #~ msgid "Double Thick Line" 17504 #~ msgstr "Икеле калын сызык" 17505 17506 #~ msgctxt "Banner page" 17507 #~ msgid "None" 17508 #~ msgstr "Юк" 17509 17510 #~ msgctxt "Banner page" 17511 #~ msgid "Standard" 17512 #~ msgstr "Үрнәкле" 17513 17514 #~ msgctxt "Banner page" 17515 #~ msgid "Unclassified" 17516 #~ msgstr "Төркемләнми" 17517 17518 #~ msgctxt "Banner page" 17519 #~ msgid "Confidential" 17520 #~ msgstr "Яшерен" 17521 17522 #~ msgctxt "Banner page" 17523 #~ msgid "Classified" 17524 #~ msgstr "Төркемләнә" 17525 17526 #~ msgctxt "Banner page" 17527 #~ msgid "Secret" 17528 #~ msgstr "Серле" 17529 17530 #~ msgctxt "Banner page" 17531 #~ msgid "Top Secret" 17532 #~ msgstr "Катгый рәвештә серле" 17533 17534 #~ msgid "Odd Pages" 17535 #~ msgstr "Так битләр" 17536 17537 #~ msgid "Even Pages" 17538 #~ msgstr "Җөп битләр" 17539 17540 #~ msgid "Page Set" 17541 #~ msgstr "Битләр җыелмасы" 17542 17543 #~ msgid "--- separator ---" 17544 #~ msgstr "--- бүлгеч ---" 17545 17546 #~ msgid "Icon te&xt:" 17547 #~ msgstr "Төй&мәнең тексты:" 17548 17549 #~ msgid "&Hide text when toolbar shows text alongside icons" 17550 #~ msgstr "&Билгечек янында язулар күрсәтелгәндә текстны качыру" 17551 17552 #~ msgid "Configure Toolbars" 17553 #~ msgstr "Кораллар панелен көйләү" 17554 17555 #~ msgid "" 17556 #~ "Do you really want to reset all toolbars of this application to their " 17557 #~ "default? The changes will be applied immediately." 17558 #~ msgstr "" 17559 #~ "Алданук билгеләнгән кораллар панелен торгызыргамы? Үзгәрешләр шунда ук " 17560 #~ "гамәлгә ашачак." 17561 17562 #~ msgid "Reset Toolbars" 17563 #~ msgstr "Кораллар панелен торгызу" 17564 17565 #~ msgid "Reset" 17566 #~ msgstr "Кайтару" 17567 17568 #~ msgid "&Toolbar:" 17569 #~ msgstr "&Кораллар панеле:" 17570 17571 #~ msgid "A&vailable actions:" 17572 #~ msgstr "&Рөхсәт ителгән гамәлләр:" 17573 17574 #~ msgid "Filter" 17575 #~ msgstr "Сөзгеч" 17576 17577 #~ msgid "Change &Icon..." 17578 #~ msgstr "Билгечекне алыштыру..." 17579 17580 #~ msgid "Change Te&xt..." 17581 #~ msgstr "Текстны үзгәртү..." 17582 17583 #~ msgctxt "@item:intable Action name in toolbar editor" 17584 #~ msgid "%1" 17585 #~ msgstr "%1" 17586 17587 #~ msgid "" 17588 #~ "This element will be replaced with all the elements of an embedded " 17589 #~ "component." 17590 #~ msgstr "Кертелгән компонент бу элементны тулысынча алыштырачак." 17591 17592 #~ msgid "<Merge>" 17593 #~ msgstr "<Кертү ноктасы>" 17594 17595 #~ msgid "<Merge %1>" 17596 #~ msgstr "<%1 кертү ноктасы>" 17597 17598 #~ msgid "" 17599 #~ "This is a dynamic list of actions. You can move it, but if you remove it " 17600 #~ "you will not be able to re-add it." 17601 #~ msgstr "" 17602 #~ "Бу гамәлләр исемлеге. Сез аны икенче урынга күчерә аласыз, ләкин бетергән " 17603 #~ "вакытта сез аны кире торгыза алмаячаксыз." 17604 17605 #~ msgid "ActionList: %1" 17606 #~ msgstr "Гамәлләр җыелмасы: %1" 17607 17608 #~ msgctxt "@label Action tooltip in toolbar editor, below the action list" 17609 #~ msgid "%1" 17610 #~ msgstr "%1" 17611 17612 #~ msgid "Change Icon" 17613 #~ msgstr "Билгечекне үзгәртү" 17614 17615 #~ msgid "Manage Link" 17616 #~ msgstr "Сылтама" 17617 17618 #~ msgid "Link Text:" 17619 #~ msgstr "Сылтаманың тексты:" 17620 17621 #~ msgid "Link URL:" 17622 #~ msgstr "Сылтаманың URL:" 17623 17624 #~ msgctxt "@action:button filter-yes" 17625 #~ msgid "%1" 17626 #~ msgstr "%1" 17627 17628 #~ msgctxt "@action:button filter-no" 17629 #~ msgid "%1" 17630 #~ msgstr "%1" 17631 17632 #~ msgctxt "@action:button filter-continue" 17633 #~ msgid "%1" 17634 #~ msgstr "%1" 17635 17636 #~ msgctxt "@action:button filter-cancel" 17637 #~ msgid "%1" 17638 #~ msgstr "%1" 17639 17640 #~ msgctxt "@action:button post-filter" 17641 #~ msgid "." 17642 #~ msgstr "." 17643 17644 #~ msgid "Details" 17645 #~ msgstr "Өстәмә" 17646 17647 #~ msgid "Question" 17648 #~ msgstr "Сорау" 17649 17650 #~ msgid "Do not ask again" 17651 #~ msgstr "Башка бу сорауны бирмәү" 17652 17653 #~ msgid "Sorry" 17654 #~ msgstr "Ялгыш" 17655 17656 #~ msgid "Do not show this message again" 17657 #~ msgstr "Бу хәбәрне башка күрсәтмәү" 17658 17659 #~ msgid "Password:" 17660 #~ msgstr "Серсүз:" 17661 17662 #~ msgid "Password" 17663 #~ msgstr "Серсүз" 17664 17665 #~ msgid "Supply a username and password below." 17666 #~ msgstr "Кулланучы исемен һәм серсүзен җыегыз." 17667 17668 #, fuzzy 17669 #~| msgid "&Keep password" 17670 #~ msgid "Use this password:" 17671 #~ msgstr "Серсүзне сак&лау" 17672 17673 #~ msgid "Username:" 17674 #~ msgstr "Кулланучының исеме:" 17675 17676 #~ msgid "Domain:" 17677 #~ msgstr "Домен:" 17678 17679 #~ msgid "Remember password" 17680 #~ msgstr "Серсүзне истә калдыру" 17681 17682 #~ msgid "Please click and drag on the image to select the region of interest:" 17683 #~ msgstr "" 17684 #~ "Кирәкле өлкәне сайлау өчен тычканның төймәсенә басып күрсәткечкә " 17685 #~ "күчерегез:" 17686 17687 #~ msgid "Default:" 17688 #~ msgstr "Стандарт:" 17689 17690 #~ msgctxt "No shortcut defined" 17691 #~ msgid "None" 17692 #~ msgstr "Юк" 17693 17694 #~ msgid "Custom:" 17695 #~ msgstr "Кулдан:" 17696 17697 #~ msgid "Shortcut Schemes" 17698 #~ msgstr "Бәйләнү схемалары" 17699 17700 #~ msgid "Current scheme:" 17701 #~ msgstr "Хәзерге схема:" 17702 17703 #~ msgid "New..." 17704 #~ msgstr "Яңа..." 17705 17706 #~ msgid "More Actions" 17707 #~ msgstr "Башка гамәлләр" 17708 17709 #~ msgid "Save as Scheme Defaults" 17710 #~ msgstr "Үрнәкле схема итеп саклау" 17711 17712 #~ msgid "Export Scheme..." 17713 #~ msgstr "Схеманы чыгару..." 17714 17715 #~ msgid "Name for New Scheme" 17716 #~ msgstr "Яңа схеманың исеме" 17717 17718 #~ msgid "Name for new scheme:" 17719 #~ msgstr "Яңа схеманың исеме:" 17720 17721 #~ msgid "New Scheme" 17722 #~ msgstr "Яңа схема" 17723 17724 #~ msgid "" 17725 #~ "Do you really want to delete the scheme %1?\n" 17726 #~ "Note that this will not remove any system wide shortcut schemes." 17727 #~ msgstr "«%1» схемасын бетерергәме?" 17728 17729 #~ msgid "Export to Location" 17730 #~ msgstr "Каталогка чыгару" 17731 17732 #~ msgid "Could not export shortcuts scheme because the location is invalid." 17733 #~ msgstr "Хата белән күрсәтелгән каталогка схеманы чыгарып булмый." 17734 17735 #~ msgid "" 17736 #~ "The current shortcut scheme is modified. Save before switching to the new " 17737 #~ "one?" 17738 #~ msgstr "" 17739 #~ "Схемаларның хәзерге бәйләнүе үзгәртелде. Икенче схемага күчүгә кадәр " 17740 #~ "үзгәрешләрне сакларгамы?" 17741 17742 #~ msgid "Print" 17743 #~ msgstr "Бастыру" 17744 17745 #~ msgid "Reset to Defaults" 17746 #~ msgstr "Алдан куелган көйләүләр" 17747 17748 #~ msgid "" 17749 #~ "Search interactively for shortcut names (e.g. Copy) or combination of " 17750 #~ "keys (e.g. Ctrl+C) by typing them here." 17751 #~ msgstr "" 17752 #~ "Текстны җыю вакытында төймә комбинациясе (мәсәлән, Күчермә ясау) яки " 17753 #~ "комбинацияләрнең үзләре (мәсәлән, Ctrl+C) ярдәмендә интерактив эзләү." 17754 17755 #~ msgid "" 17756 #~ "Here you can see a list of key bindings, i.e. associations between " 17757 #~ "actions (e.g. 'Copy') shown in the left column and keys or combination of " 17758 #~ "keys (e.g. Ctrl+V) shown in the right column." 17759 #~ msgstr "" 17760 #~ "Монда <i>төймә комбинациясе</i> исемлеге күрсәтелгән, ягъни сул баганада " 17761 #~ "бирелгән гамәлләрнең төймәләре (мәсәлән, 'Күчермә ясау') уң баганада " 17762 #~ "китерелгән тезмәләре белән (мәсәлән, CTRL-V) бер-берсенә туры килә дигән " 17763 #~ "сүз." 17764 17765 #~ msgid "Action" 17766 #~ msgstr "Гамәл" 17767 17768 #~ msgid "Shortcut" 17769 #~ msgstr "Төймәләр тезмәсе" 17770 17771 #~ msgid "Alternate" 17772 #~ msgstr "Өстәмә" 17773 17774 #~ msgid "Global" 17775 #~ msgstr "Глобаль" 17776 17777 #~ msgid "Global Alternate" 17778 #~ msgstr "Глобаль өстәмә" 17779 17780 #~ msgid "Mouse Button Gesture" 17781 #~ msgstr "Тычканның ишарә төймәсе" 17782 17783 #~ msgid "Mouse Shape Gesture" 17784 #~ msgstr "Тычканның ишарә сыны" 17785 17786 #~ msgid "Key Conflict" 17787 #~ msgstr "Төймәләр бәрелештә" 17788 17789 #~ msgid "" 17790 #~ "The '%1' shape gesture has already been allocated to the \"%2\" action.\n" 17791 #~ "Do you want to reassign it from that action to the current one?" 17792 #~ msgstr "" 17793 #~ "%1 сырының рәвеше инде «%2» гамәленә бәйләнгән.\n" 17794 #~ "Хәзерге гамәл белән бәйләргә телисезме?" 17795 17796 #~ msgid "Reassign" 17797 #~ msgstr "Яңа белән бәйләү" 17798 17799 #~ msgid "" 17800 #~ "The '%1' rocker gesture has already been allocated to the \"%2\" action.\n" 17801 #~ "Do you want to reassign it from that action to the current one?" 17802 #~ msgstr "" 17803 #~ "%1 сызучы сыны инде «%2» гамәленә бәйләнгән.\n" 17804 #~ "Хәзерге гамәл белән бәйләргә телисезме?" 17805 17806 #~ msgctxt "header for an applications shortcut list" 17807 #~ msgid "Shortcuts for %1" 17808 #~ msgstr "%1 өчен төймә тезмәсе" 17809 17810 #~ msgid "Main:" 17811 #~ msgstr "Баш:" 17812 17813 #~ msgid "Alternate:" 17814 #~ msgstr "Өстәмә:" 17815 17816 #~ msgid "Global:" 17817 #~ msgstr "Глобаль:" 17818 17819 #~ msgid "Action Name" 17820 #~ msgstr "Гамәлнең исеме" 17821 17822 #~ msgid "Shortcuts" 17823 #~ msgstr "Төймә тезмәләре" 17824 17825 #~ msgctxt "@item:intable Action name in shortcuts configuration" 17826 #~ msgid "%1" 17827 #~ msgstr "%1" 17828 17829 #~ msgid "Switch Application Language" 17830 #~ msgstr "Кушымтаның телен үзгәртү" 17831 17832 #~ msgid "" 17833 #~ "Please choose the language which should be used for this application:" 17834 #~ msgstr "Бу кушымтада кулланырга теләгән телне сайлагыз:" 17835 17836 #~ msgid "Add Fallback Language" 17837 #~ msgstr "Запас телне кушу:" 17838 17839 #~ msgid "" 17840 #~ "Adds one more language which will be used if other translations do not " 17841 #~ "contain a proper translation." 17842 #~ msgstr "" 17843 #~ "Сезнең телегезгә тәрҗемә булмаган вакытта бер яисә берничә кулланыла " 17844 #~ "торган телне күрсәтү." 17845 17846 #~ msgid "" 17847 #~ "The language for this application has been changed. The change will take " 17848 #~ "effect the next time the application is started." 17849 #~ msgstr "" 17850 #~ "Бу кушымтаның теле үзгәртелде. Үзгәрешләр кушымтаның яңадан җибәргән " 17851 #~ "вакытта тормышка ашырылачак." 17852 17853 #~ msgid "Application Language Changed" 17854 #~ msgstr "Кушымтаның теле үзгәрелде" 17855 17856 #~ msgid "Primary language:" 17857 #~ msgstr "Төп тел:" 17858 17859 #~ msgid "Fallback language:" 17860 #~ msgstr "Запас язык:" 17861 17862 #~ msgid "" 17863 #~ "This is the main application language which will be used first, before " 17864 #~ "any other languages." 17865 #~ msgstr "Бу төп тел, кушымта өчен ул башка телләрдән өстенрәк тора." 17866 17867 #~ msgid "" 17868 #~ "This is the language which will be used if any previous languages do not " 17869 #~ "contain a proper translation." 17870 #~ msgstr "Сезнең телегезгә тәрҗемә булмаган вакытта бу тел кулланылачак." 17871 17872 #~ msgid "Tip of the Day" 17873 #~ msgstr "Бар монда бер киңәш..." 17874 17875 #~ msgid "Did you know...?\n" 17876 #~ msgstr "А сез беләсезме?\n" 17877 17878 #~ msgid "&Show tips on startup" 17879 #~ msgstr "&Җибәргәндә киңәшләрне чагылдыру" 17880 17881 #~ msgid "&Previous" 17882 #~ msgstr "&Кире кайту" 17883 17884 #~ msgctxt "Opposite to Previous" 17885 #~ msgid "&Next" 17886 #~ msgstr "&Алга бару" 17887 17888 #~ msgid "Find Next" 17889 #~ msgstr "Алга барып эзләү" 17890 17891 #~ msgid "<qt>Find next occurrence of '<b>%1</b>'?</qt>" 17892 #~ msgstr "<qt>Түбәндәге '<b>%1</b>' кертүне табаргамы?</qt>" 17893 17894 #~ msgid "1 match found." 17895 #~ msgid_plural "%1 matches found." 17896 #~ msgstr[0] "1 объект тәңгәл килде." 17897 #~ msgstr[1] "%1 объект тәңгәл килде." 17898 17899 #~ msgid "<qt>No matches found for '<b>%1</b>'.</qt>" 17900 #~ msgstr "<qt>'<b>%1</b>' өчен тәңгәлләр табылмады.</qt>" 17901 17902 #~ msgid "No matches found for '<b>%1</b>'." 17903 #~ msgstr "'<b>%1</b> өчен тәңгәлләр табылмады'." 17904 17905 #~ msgid "Beginning of document reached." 17906 #~ msgstr "Документның башына килеп җиттегез." 17907 17908 #~ msgid "End of document reached." 17909 #~ msgstr "Документның ахырына килеп җиттегез." 17910 17911 #~ msgid "Continue from the end?" 17912 #~ msgstr "Ахырдан дәвам итәргәме?" 17913 17914 #~ msgid "Continue from the beginning?" 17915 #~ msgstr "Баштан дәвам итәргәме?" 17916 17917 #~ msgid "Find Text" 17918 #~ msgstr "Текстны эзләү" 17919 17920 #~ msgctxt "@title:group" 17921 #~ msgid "Find" 17922 #~ msgstr "Эзләү" 17923 17924 #~ msgid "&Text to find:" 17925 #~ msgstr "Текстны &эзләү:" 17926 17927 #~ msgid "Regular e&xpression" 17928 #~ msgstr "&Регуляр гыйбарә" 17929 17930 #~ msgid "&Edit..." 17931 #~ msgstr "&Үзгәртү..." 17932 17933 #~ msgid "Replace With" 17934 #~ msgstr "Алыштыру" 17935 17936 #~ msgid "Replace&ment text:" 17937 #~ msgstr "Алыштыру өчен &текст:" 17938 17939 #~ msgid "Use p&laceholders" 17940 #~ msgstr "&Тутыргычларны куллану" 17941 17942 #~ msgid "Options" 17943 #~ msgstr "Параметрлар" 17944 17945 #~ msgid "C&ase sensitive" 17946 #~ msgstr "Регистрны &истә тотып эшләү" 17947 17948 #~ msgid "&Whole words only" 17949 #~ msgstr "&Тулы сүзләр генә" 17950 17951 #~ msgid "From c&ursor" 17952 #~ msgstr "Кур&сордан" 17953 17954 #~ msgid "Find &backwards" 17955 #~ msgstr "Ар&тка кайтып эзләү" 17956 17957 #~ msgid "&Selected text" 17958 #~ msgstr "&Сайланган текст" 17959 17960 #~ msgid "&Prompt on replace" 17961 #~ msgstr "&Алыштырганда сорау" 17962 17963 #~ msgid "Start replace" 17964 #~ msgstr "Алыштыруны башлау" 17965 17966 #~ msgid "" 17967 #~ "<qt>If you press the <b>Replace</b> button, the text you entered above is " 17968 #~ "searched for within the document and any occurrence is replaced with the " 17969 #~ "replacement text.</qt>" 17970 #~ msgstr "" 17971 #~ "<qt>Әгәр сез <b> төймәсенә бассагыз </b> алыштыру, сезнең сайланган " 17972 #~ "гыйбарәгезкертелә, һәм аннары шул сайланганнарның һәрберсен алыштыра</qt>" 17973 17974 #~ msgid "&Find" 17975 #~ msgstr "&Эзләү" 17976 17977 #~ msgid "Start searching" 17978 #~ msgstr "Эзләүне башлау" 17979 17980 #~ msgid "" 17981 #~ "<qt>If you press the <b>Find</b> button, the text you entered above is " 17982 #~ "searched for within the document.</qt>" 17983 #~ msgstr "" 17984 #~ "<qt>Әгәр сез Эзләү <b> төймәсен бассагыз</b>, бөтен текст буенча сездән " 17985 #~ "кертелгәнгыйбарә эзләнелә.</qt>" 17986 17987 #~ msgid "" 17988 #~ "Enter a pattern to search for, or select a previous pattern from the list." 17989 #~ msgstr "" 17990 #~ "Эзләү өчен калыпны кертегез яки исемлектән алдынгы калыпны сайлагыз." 17991 17992 #~ msgid "If enabled, search for a regular expression." 17993 #~ msgstr "Эшләсә, регуляр гыйбарә эзләнә." 17994 17995 #~ msgid "Click here to edit your regular expression using a graphical editor." 17996 #~ msgstr "" 17997 #~ "Басыгыз, әгәр регуляр гыйбарәгезне график мөхәррир ярдәмендә " 17998 #~ "үзгәртәсәгезкилсә." 17999 18000 #~ msgid "Enter a replacement string, or select a previous one from the list." 18001 #~ msgstr "Алыштыру өчен юл кертегез, яки алдынгысын исемлектән сайлагыз." 18002 18003 #~ msgid "" 18004 #~ "<qt>If enabled, any occurrence of <code><b>\\N</b></code>, where " 18005 #~ "<code><b>N</b></code> is an integer number, will be replaced with the " 18006 #~ "corresponding capture (\"parenthesized substring\") from the pattern." 18007 #~ "<p>To include (a literal <code><b>\\N</b></code> in your replacement, put " 18008 #~ "an extra backslash in front of it, like <code><b>\\\\N</b></code>.</p></" 18009 #~ "qt>" 18010 #~ msgstr "" 18011 #~ "<qt>Если установлен флажок, любое вхождение вида <code><b>\\N</b></code>, " 18012 #~ "где <code><b>N</b></code> — целое число, будет заменено N-ым <i>захватом</" 18013 #~ "i> (компонентом найденной строки; компоненты обозначаются в регулярном " 18014 #~ "выражении круглыми скобками).<p>Для того, чтобы последовательность " 18015 #~ "<code><b>\\N</b></code> не интерпретировалась (включалась в замены " 18016 #~ "буквально), поместите перед ней экранированную обратную косую черту: " 18017 #~ "<code><b>\\\\N</b></code>.</p></qt>" 18018 18019 #~ msgid "Click for a menu of available captures." 18020 #~ msgstr "Рөхсәтле булган эләктереп алу менюсын чакыру өчен басыгыз." 18021 18022 #~ msgid "Require word boundaries in both ends of a match to succeed." 18023 #~ msgstr "Тиңләшү ике яктан да сүзләр белән тәмамланырга тиешле." 18024 18025 #~ msgid "" 18026 #~ "Start searching at the current cursor location rather than at the top." 18027 #~ msgstr "Эзләүне курсор позициясеннән башлау, ә документ башыннан түгел." 18028 18029 #~ msgid "Only search within the current selection." 18030 #~ msgstr "Билгеләнгән өзектән генә эзләү." 18031 18032 #~ msgid "" 18033 #~ "Perform a case sensitive search: entering the pattern 'Joe' will not " 18034 #~ "match 'joe' or 'JOE', only 'Joe'." 18035 #~ msgstr "" 18036 #~ "Регистрны искә алып эзләү. Бу очракта 'Joe' юлын эзләгәндә'joe' яки 'JOE' " 18037 #~ "сүзләре табыла, яки 'Joe' гына." 18038 18039 #~ msgid "Search backwards." 18040 #~ msgstr "Артка кайтып эзләү." 18041 18042 #~ msgid "Ask before replacing each match found." 18043 #~ msgstr "Һәр алыштыруда раслауны сорау." 18044 18045 #~ msgid "Any Character" 18046 #~ msgstr "Теләсә нинди тамга" 18047 18048 #~ msgid "End of Line" 18049 #~ msgstr "Юлның ахыры" 18050 18051 #~ msgid "Set of Characters" 18052 #~ msgstr "Тамгаларның җыентыгы" 18053 18054 #~ msgid "Repeats, Zero or More Times" 18055 #~ msgstr "Кабатлаулар, нуль яисә аннан күбрәк мәртәбә" 18056 18057 #~ msgid "Repeats, One or More Times" 18058 #~ msgstr "Кабатлаулар, бер яисә аннан күбрәк мәртәбә" 18059 18060 #~ msgid "Optional" 18061 #~ msgstr "Өстәмәләр" 18062 18063 #~ msgid "TAB" 18064 #~ msgstr "Табульләштерү" 18065 18066 #~ msgid "Carriage Return" 18067 #~ msgstr "Каретканы кайтару" 18068 18069 #~ msgid "Digit" 18070 #~ msgstr "Сан" 18071 18072 #~ msgid "Complete Match" 18073 #~ msgstr "Тулы тәңгәл" 18074 18075 #~ msgid "Captured Text (%1)" 18076 #~ msgstr "Эләктереп алынган текст (%1)" 18077 18078 #~ msgid "You must enter some text to search for." 18079 #~ msgstr "Эзләү өчен текст кертергә кирәк." 18080 18081 #~ msgid "Invalid regular expression." 18082 #~ msgstr "Дөрес булмаган регуляр гыйбарә." 18083 18084 #~ msgid "Replace" 18085 #~ msgstr "Алыштыру" 18086 18087 #~ msgctxt "@action:button Replace all occurrences" 18088 #~ msgid "&All" 18089 #~ msgstr "&Бөтенесе" 18090 18091 #~ msgid "&Skip" 18092 #~ msgstr "Төшереп &калдыру" 18093 18094 #~ msgid "Replace '%1' with '%2'?" 18095 #~ msgstr "'%1' ны '%2'га алыштырыргамы?" 18096 18097 #~ msgid "No text was replaced." 18098 #~ msgstr "Текст алыштырылмады." 18099 18100 #~ msgid "1 replacement done." 18101 #~ msgid_plural "%1 replacements done." 18102 #~ msgstr[0] "%1 алыштыру ясалды." 18103 #~ msgstr[1] "%1 алыштыру ясалды." 18104 18105 #~ msgid "Do you want to restart search from the end?" 18106 #~ msgstr "Эзләүне ахырдан дәвам итәргәме?" 18107 18108 #~ msgid "Do you want to restart search at the beginning?" 18109 #~ msgstr "Эзләүне баштан эзләргәме?" 18110 18111 #~ msgctxt "@action:button Restart find & replace" 18112 #~ msgid "Restart" 18113 #~ msgstr "Яңадан җибәрү" 18114 18115 #~ msgctxt "@action:button Stop find & replace" 18116 #~ msgid "Stop" 18117 #~ msgstr "Туктату" 18118 18119 #~ msgid "" 18120 #~ "Your replacement string is referencing a capture greater than '\\%1', " 18121 #~ msgstr "" 18122 #~ "Алыштыру юлы эләктереп алуга сылтама ясый, һәм ул '\\%1'дән күбрәк. " 18123 18124 #~ msgid "but your pattern only defines 1 capture." 18125 #~ msgid_plural "but your pattern only defines %1 captures." 18126 #~ msgstr[0] "но шаблон определяет только %1 захват." 18127 #~ msgstr[1] "но шаблон определяет только %1 захвата." 18128 18129 #~ msgid "but your pattern defines no captures." 18130 #~ msgstr "шаблоныгыз эләктереп алуны билгеләми." 18131 18132 #~ msgid "" 18133 #~ "\n" 18134 #~ "Please correct." 18135 #~ msgstr "" 18136 #~ "\n" 18137 #~ "Төзәтү кирәк." 18138 18139 #~ msgctxt "@item Font name" 18140 #~ msgid "%1" 18141 #~ msgstr "%1" 18142 18143 #~ msgctxt "@item Font name [foundry]" 18144 #~ msgid "%1 [%2]" 18145 #~ msgstr "%1 [%2]" 18146 18147 #~ msgctxt "@info:whatsthis" 18148 #~ msgid "Here you can choose the font to be used." 18149 #~ msgstr "Монда хәрефне сайлап була." 18150 18151 #~ msgid "Requested Font" 18152 #~ msgstr "Соралган хәреф" 18153 18154 #~ msgctxt "@option:check" 18155 #~ msgid "Font" 18156 #~ msgstr "Хәреф" 18157 18158 #~ msgctxt "@info:whatsthis" 18159 #~ msgid "Enable this checkbox to change the font family settings." 18160 #~ msgstr "Хәрефнең гарнитурасын үзгәртү өчен билге куегыз." 18161 18162 #~ msgctxt "@info:tooltip" 18163 #~ msgid "Change font family?" 18164 #~ msgstr "Хәрефнең гарнитурасын алыштырыргамы?" 18165 18166 #~ msgctxt "@label" 18167 #~ msgid "Font:" 18168 #~ msgstr "Хәреф:" 18169 18170 #~ msgctxt "@option:check" 18171 #~ msgid "Font style" 18172 #~ msgstr "Хәреф стиле" 18173 18174 #~ msgctxt "@info:whatsthis" 18175 #~ msgid "Enable this checkbox to change the font style settings." 18176 #~ msgstr "Хәрефнең стилен үзгәртү өчен билге куегыз." 18177 18178 #~ msgctxt "@info:tooltip" 18179 #~ msgid "Change font style?" 18180 #~ msgstr "Хәреф стилен үзгәртергәме?" 18181 18182 #~ msgid "Font style:" 18183 #~ msgstr "Хәреф стиле:" 18184 18185 #~ msgctxt "@info:whatsthis" 18186 #~ msgid "Enable this checkbox to change the font size settings." 18187 #~ msgstr "Хәрефләрнең зурлыгын үзгәртер өчен билге куегыз" 18188 18189 #~ msgctxt "@info:tooltip" 18190 #~ msgid "Change font size?" 18191 #~ msgstr "Шрифт зурлыгын үзгәртергәме?" 18192 18193 #~ msgctxt "@label:listbox Font size" 18194 #~ msgid "Size:" 18195 #~ msgstr "Зурлык:" 18196 18197 #~ msgctxt "@info:whatsthis" 18198 #~ msgid "Here you can choose the font family to be used." 18199 #~ msgstr "Монда хәреф гарнитурасын сайлап була." 18200 18201 #~ msgctxt "@info:whatsthis" 18202 #~ msgid "Here you can choose the font style to be used." 18203 #~ msgstr "Монда хәреф стилен сайлап була." 18204 18205 #~ msgctxt "@item font" 18206 #~ msgid "Oblique" 18207 #~ msgstr "Авыш" 18208 18209 #~ msgctxt "@item font" 18210 #~ msgid "Bold Italic" 18211 #~ msgstr "Калын курсив" 18212 18213 #~ msgid "Font size<br /><i>fixed</i> or <i>relative</i><br />to environment" 18214 #~ msgstr "" 18215 #~ "Размер шрифта<br /><i>фиксированный</i> или <i>относительный</i><br /> к " 18216 #~ "среде" 18217 18218 #~ msgid "" 18219 #~ "Here you can switch between fixed font size and font size to be " 18220 #~ "calculated dynamically and adjusted to changing environment (e.g. widget " 18221 #~ "dimensions, paper size)." 18222 #~ msgstr "" 18223 #~ "Монда шрифтның фиксацияләнгән зурлыгы һәм динамик рәвештә исәпләнгән " 18224 #~ "шрифт зурлыкларыарасында күчеп йөреп була һәм шуңа караган мохит " 18225 #~ "үзгәрешләре дә (Тәрәзә элементларызурлыгы, кәгазь зурлыгы һ.б.)." 18226 18227 #~ msgid "Here you can choose the font size to be used." 18228 #~ msgstr "Монда шрифт зурлыгын сайлап була." 18229 18230 #~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 18231 #~ msgstr "" 18232 #~ "Җөмһүриятебездәге матурлыкларны үзебез дә яратабыз да без, иптәшләр!" 18233 18234 #~ msgid "" 18235 #~ "This sample text illustrates the current settings. You may edit it to " 18236 #~ "test special characters." 18237 #~ msgstr "" 18238 #~ "Бу текст агымдагы параметрларны сурәтли. Аның корректлыгын тикшерү " 18239 #~ "өченмахсус символларның чагылуын үзгәртегез." 18240 18241 #~ msgid "Actual Font" 18242 #~ msgstr "Рөхсәт ителгән шрифт" 18243 18244 #~ msgctxt "@item Font style" 18245 #~ msgid "%1" 18246 #~ msgstr "%1" 18247 18248 #~ msgid "Choose..." 18249 #~ msgstr "Сайлау..." 18250 18251 #~ msgid "Click to select a font" 18252 #~ msgstr "Хәрефне сайлау өчен басыгыз" 18253 18254 #~ msgid "Preview of the selected font" 18255 #~ msgstr "Сайланган хәрефнең үрнәге" 18256 18257 #~ msgid "" 18258 #~ "This is a preview of the selected font. You can change it by clicking the " 18259 #~ "\"Choose...\" button." 18260 #~ msgstr "" 18261 #~ "Бу сайланган хәрефнең үрнәге. Аны \"Сайлау...\" төймәсенә басып алыштырып " 18262 #~ "була." 18263 18264 #~ msgid "Preview of the \"%1\" font" 18265 #~ msgstr "«%1» хәрефенең үрнәге" 18266 18267 #~ msgid "" 18268 #~ "This is a preview of the \"%1\" font. You can change it by clicking the " 18269 #~ "\"Choose...\" button." 18270 #~ msgstr "" 18271 #~ "Бу «%1» хәрефенең үрнәге. Аны \"Сайлау...\" төймәсенә басып алыштырып " 18272 #~ "була." 18273 18274 #~ msgid "Stop" 18275 #~ msgstr "Туктату" 18276 18277 #~ msgid " Stalled " 18278 #~ msgstr " Мәгълүмат юк " 18279 18280 #~ msgid " %1/s " 18281 #~ msgstr " %1/с " 18282 18283 #~ msgctxt "%1 is the label, we add a ':' to it" 18284 #~ msgid "%1:" 18285 #~ msgstr "%1:" 18286 18287 #~ msgid "%2 of %3 complete" 18288 #~ msgid_plural "%2 of %3 complete" 18289 #~ msgstr[0] "%3'нең %2" 18290 #~ msgstr[1] "%3'нең %2" 18291 18292 #~ msgid "%2 / %1 folder" 18293 #~ msgid_plural "%2 / %1 folders" 18294 #~ msgstr[0] "%1 каталогыннан %2" 18295 #~ msgstr[1] "%2 из %1 папок" 18296 18297 #~ msgid "%2 / %1 file" 18298 #~ msgid_plural "%2 / %1 files" 18299 #~ msgstr[0] "%1 файлдан %2" 18300 #~ msgstr[1] "%2 из %1 файлов" 18301 18302 #~ msgid "%1% of %2" 18303 #~ msgstr "%2'ның %1%" 18304 18305 #~ msgid "%2% of 1 file" 18306 #~ msgid_plural "%2% of %1 files" 18307 #~ msgstr[0] "%2% %1 файла" 18308 #~ msgstr[1] "%2% %1 файлов" 18309 18310 #~ msgid "%1%" 18311 #~ msgstr "%1%" 18312 18313 #~ msgid "Stalled" 18314 #~ msgstr "Мәгълүмат юк" 18315 18316 #~ msgid "%2/s (%3 remaining)" 18317 #~ msgid_plural "%2/s (%3 remaining)" 18318 #~ msgstr[0] "%2/с (%3 калды)" 18319 #~ msgstr[1] "%2/с (%3 калды)" 18320 18321 #~ msgctxt "speed in bytes per second" 18322 #~ msgid "%1/s" 18323 #~ msgstr "%1/с" 18324 18325 #~ msgid "%1/s (done)" 18326 #~ msgstr "%1/с (әзер)" 18327 18328 #~ msgid "&Resume" 18329 #~ msgstr "&Возобновить" 18330 18331 #~ msgid "&Pause" 18332 #~ msgstr "&Тыналыш" 18333 18334 #~ msgctxt "The source url of a job" 18335 #~ msgid "Source:" 18336 #~ msgstr "Источник:" 18337 18338 #~ msgctxt "The destination url of a job" 18339 #~ msgid "Destination:" 18340 #~ msgstr "Кая:" 18341 18342 #~ msgid "Click this to expand the dialog, to show details" 18343 #~ msgstr "" 18344 #~ "Нажмите эту кнопку, чтобы развернуть диалог для показа дополнительных " 18345 #~ "сведений" 18346 18347 #~ msgid "&Keep this window open after transfer is complete" 18348 #~ msgstr "Не &закрывать окно после окончания передачи данных" 18349 18350 #~ msgid "Open &File" 18351 #~ msgstr "&Открыть файл" 18352 18353 #~ msgid "Open &Destination" 18354 #~ msgstr "Открыть папку &назначения" 18355 18356 #~ msgid "Progress Dialog" 18357 #~ msgstr "Процесс выполнения" 18358 18359 #~ msgid "%1 file" 18360 #~ msgid_plural "%1 files" 18361 #~ msgstr[0] "%1 файлы" 18362 #~ msgstr[1] "%1 файла" 18363 18364 #~ msgid "Click this to collapse the dialog, to hide details" 18365 #~ msgstr "Нажмите эту кнопку для сворачивания диалога" 18366 18367 #~ msgid "Unknown Application" 18368 #~ msgstr "Билгесез кушымта" 18369 18370 #~ msgctxt "@title:window" 18371 #~ msgid "Dr. Klash' Accelerator Diagnosis" 18372 #~ msgstr "Dr. Klash акселераторлар диагностикасы" 18373 18374 #~ msgctxt "@option:check" 18375 #~ msgid "Disable automatic checking" 18376 #~ msgstr "Автоматик рәвеште булга тикшерүне сүндерү" 18377 18378 #~ msgctxt "@action:button" 18379 #~ msgid "Close" 18380 #~ msgstr "Ябу" 18381 18382 #~ msgid "<h2>Accelerators changed</h2>" 18383 #~ msgstr "<h2>Акселераторлар үзгәргән</h2>" 18384 18385 #~ msgid "<h2>Accelerators removed</h2>" 18386 #~ msgstr "<h2>Акселераторлар сөртелгән</h2>" 18387 18388 #~ msgid "<h2>Accelerators added (just for your info)</h2>" 18389 #~ msgstr "<h2>Акселераторлар өстәлгән</h2>" 18390 18391 #~ msgctxt "left mouse button" 18392 #~ msgid "left button" 18393 #~ msgstr "сул төймә" 18394 18395 #~ msgctxt "middle mouse button" 18396 #~ msgid "middle button" 18397 #~ msgstr "урта төймә" 18398 18399 #~ msgctxt "right mouse button" 18400 #~ msgid "right button" 18401 #~ msgstr "уң төймә" 18402 18403 #~ msgctxt "a nonexistent value of mouse button" 18404 #~ msgid "invalid button" 18405 #~ msgstr "хаталы төймә" 18406 18407 #~ msgctxt "" 18408 #~ "a kind of mouse gesture: hold down one mouse button, then press another " 18409 #~ "button" 18410 #~ msgid "Hold %1, then push %2" 18411 #~ msgstr "%1 төймәсен тотып, %2 төймәсенә басу" 18412 18413 #~ msgid "Conflict with Global Shortcut" 18414 #~ msgstr "Глобаль комбинация белән бәрелештә" 18415 18416 #~ msgid "" 18417 #~ "The '%1' key combination has already been allocated to the global action " 18418 #~ "\"%2\" in %3.\n" 18419 #~ "Do you want to reassign it from that action to the current one?" 18420 #~ msgstr "" 18421 #~ "Комбинация клавиш %1 уже связана с глобальным действием «%2» в %3.\n" 18422 #~ "Связать комбинацию с текущим действием?" 18423 18424 #~ msgid "" 18425 #~ "The '%1' key combination is registered by application %2 for action %3:" 18426 #~ msgstr "Клавиша «%1» уже назначена в приложении %2 на действие %3:" 18427 18428 #~ msgid "In context '%1' for action '%2'\n" 18429 #~ msgstr "Контекст «%1» для действия «%2»\n" 18430 18431 #~ msgid "" 18432 #~ "The '%1' key combination is registered by application %2.\n" 18433 #~ "%3" 18434 #~ msgstr "" 18435 #~ "Клавиша «%1» уже назначена в приложении %2.\n" 18436 #~ "%3" 18437 18438 #~ msgid "Conflict With Registered Global Shortcut" 18439 #~ msgstr "Төймәләрнең глобаль тезмә бәрелеше" 18440 18441 #~ msgctxt "@action" 18442 #~ msgid "Open" 18443 #~ msgstr "Ачу" 18444 18445 #~ msgctxt "@action" 18446 #~ msgid "Close" 18447 #~ msgstr "Ябу" 18448 18449 #~ msgctxt "@action" 18450 #~ msgid "Save" 18451 #~ msgstr "Саклау" 18452 18453 #~ msgctxt "@action" 18454 #~ msgid "Print" 18455 #~ msgstr "Бастыру" 18456 18457 #~ msgctxt "@action" 18458 #~ msgid "Quit" 18459 #~ msgstr "Чыгу" 18460 18461 #~ msgctxt "@action" 18462 #~ msgid "Undo" 18463 #~ msgstr "Кире кагу" 18464 18465 #~ msgctxt "@action" 18466 #~ msgid "Redo" 18467 #~ msgstr "Кабатлау" 18468 18469 #~ msgctxt "@action" 18470 #~ msgid "Cut" 18471 #~ msgstr "Кисү" 18472 18473 #~ msgctxt "@action" 18474 #~ msgid "Copy" 18475 #~ msgstr "Күчереп язу" 18476 18477 #~ msgctxt "@action" 18478 #~ msgid "Paste" 18479 #~ msgstr "Кую" 18480 18481 #~ msgctxt "@action" 18482 #~ msgid "Paste Selection" 18483 #~ msgstr "Билгеләүне кертеп кую" 18484 18485 #~ msgctxt "@action" 18486 #~ msgid "Deselect" 18487 #~ msgstr "Сайлауны кире кагу" 18488 18489 #~ msgctxt "@action" 18490 #~ msgid "Delete Word Backwards" 18491 #~ msgstr "Курсор алдындагы сүзне бетерү" 18492 18493 #~ msgctxt "@action" 18494 #~ msgid "Delete Word Forward" 18495 #~ msgstr "Курсор артындагы сүзне бетерү" 18496 18497 #~ msgctxt "@action" 18498 #~ msgid "Find" 18499 #~ msgstr "Эзләү" 18500 18501 #~ msgctxt "@action" 18502 #~ msgid "Find Next" 18503 #~ msgstr "Алга барып эзләү" 18504 18505 #~ msgctxt "@action" 18506 #~ msgid "Find Prev" 18507 #~ msgstr "Алдынгысын табу" 18508 18509 #~ msgctxt "@action" 18510 #~ msgid "Replace" 18511 #~ msgstr "Алыштыру" 18512 18513 #~ msgctxt "@action Go to main page" 18514 #~ msgid "Home" 18515 #~ msgstr "Албит" 18516 18517 #~ msgctxt "@action Beginning of document" 18518 #~ msgid "Begin" 18519 #~ msgstr "Документның башы" 18520 18521 #~ msgctxt "@action End of document" 18522 #~ msgid "End" 18523 #~ msgstr "Ахыр" 18524 18525 #~ msgctxt "@action" 18526 #~ msgid "Prior" 18527 #~ msgstr "Алдынгы" 18528 18529 #~ msgctxt "@action Opposite to Prior" 18530 #~ msgid "Next" 18531 #~ msgstr "Алга бару" 18532 18533 #~ msgctxt "@action" 18534 #~ msgid "Up" 18535 #~ msgstr "Күтәрү" 18536 18537 #~ msgctxt "@action" 18538 #~ msgid "Back" 18539 #~ msgstr "Кире кайту" 18540 18541 #~ msgctxt "@action" 18542 #~ msgid "Forward" 18543 #~ msgstr "Алга бару" 18544 18545 #~ msgctxt "@action" 18546 #~ msgid "Reload" 18547 #~ msgstr "Яңадан ачу" 18548 18549 #~ msgctxt "@action" 18550 #~ msgid "End of Line" 18551 #~ msgstr "Юлның ахыры" 18552 18553 #~ msgctxt "@action" 18554 #~ msgid "Go to Line" 18555 #~ msgstr "Юлга күчү" 18556 18557 #~ msgctxt "@action" 18558 #~ msgid "Backward Word" 18559 #~ msgstr "Бер сүзгә арткка" 18560 18561 #~ msgctxt "@action" 18562 #~ msgid "Forward Word" 18563 #~ msgstr "Бер сүзгә алга" 18564 18565 #~ msgctxt "@action" 18566 #~ msgid "Add Bookmark" 18567 #~ msgstr "Кыстыргыч өстәү" 18568 18569 #~ msgctxt "@action" 18570 #~ msgid "Zoom In" 18571 #~ msgstr "Зурайту" 18572 18573 #~ msgctxt "@action" 18574 #~ msgid "Zoom Out" 18575 #~ msgstr "Кечерәйтү" 18576 18577 #~ msgctxt "@action" 18578 #~ msgid "Full Screen Mode" 18579 #~ msgstr "Тулыэкранлы режим" 18580 18581 #~ msgctxt "@action" 18582 #~ msgid "Show Menu Bar" 18583 #~ msgstr "Менюны күрсәтү" 18584 18585 #~ msgctxt "@action" 18586 #~ msgid "Activate Next Tab" 18587 #~ msgstr "Киләсе өстәмне активлаштыру" 18588 18589 #~ msgctxt "@action" 18590 #~ msgid "Activate Previous Tab" 18591 #~ msgstr "Алдынгы өстәмне активлаштыру" 18592 18593 #~ msgctxt "@action" 18594 #~ msgid "Help" 18595 #~ msgstr "Белешмә" 18596 18597 #~ msgctxt "@action" 18598 #~ msgid "What's This" 18599 #~ msgstr "Бу нәрсә" 18600 18601 #~ msgctxt "@action" 18602 #~ msgid "Text Completion" 18603 #~ msgstr "Текстны тәмамлау" 18604 18605 #~ msgctxt "@action" 18606 #~ msgid "Previous Completion Match" 18607 #~ msgstr "Тәмамлауның алдынгы варианты" 18608 18609 #~ msgctxt "@action" 18610 #~ msgid "Next Completion Match" 18611 #~ msgstr "Тәмамлауның киләсе варианты" 18612 18613 #~ msgctxt "@action" 18614 #~ msgid "Substring Completion" 18615 #~ msgstr "Юлны тәмамлау" 18616 18617 #~ msgctxt "@action" 18618 #~ msgid "Previous Item in List" 18619 #~ msgstr "Исемлектә алдангы элемент" 18620 18621 #~ msgctxt "@action" 18622 #~ msgid "Next Item in List" 18623 #~ msgstr "Исемлектә киләсе элемент" 18624 18625 #~ msgctxt "@action" 18626 #~ msgid "Open Recent" 18627 #~ msgstr "Күптән түгелдәге файллар" 18628 18629 #~ msgctxt "@action" 18630 #~ msgid "Save As" 18631 #~ msgstr "... итеп саклау" 18632 18633 #~ msgctxt "@action" 18634 #~ msgid "Revert" 18635 #~ msgstr "Тергезү" 18636 18637 #~ msgctxt "@action" 18638 #~ msgid "Print Preview" 18639 #~ msgstr "Предварительный просмотр печати" 18640 18641 #~ msgctxt "@action" 18642 #~ msgid "Mail" 18643 #~ msgstr "Почта" 18644 18645 #~ msgctxt "@action" 18646 #~ msgid "Clear" 18647 #~ msgstr "Чистарту" 18648 18649 #~ msgctxt "@action" 18650 #~ msgid "Fit To Page" 18651 #~ msgstr "Битне тулысынча кертү" 18652 18653 #~ msgctxt "@action" 18654 #~ msgid "Fit To Width" 18655 #~ msgstr "Бит киңлегендә" 18656 18657 #~ msgctxt "@action" 18658 #~ msgid "Fit To Height" 18659 #~ msgstr "Бит биеклегендә" 18660 18661 #~ msgctxt "@action" 18662 #~ msgid "Zoom" 18663 #~ msgstr "Зурайту" 18664 18665 #~ msgctxt "@action" 18666 #~ msgid "Goto" 18667 #~ msgstr "Күчергә" 18668 18669 #~ msgctxt "@action" 18670 #~ msgid "Document Back" 18671 #~ msgstr "Артка китү" 18672 18673 #~ msgctxt "@action" 18674 #~ msgid "Document Forward" 18675 #~ msgstr "Алга бару" 18676 18677 #~ msgctxt "@action" 18678 #~ msgid "Edit Bookmarks" 18679 #~ msgstr "Кыстыргычларны үзгәртү" 18680 18681 #~ msgctxt "@action" 18682 #~ msgid "Spelling" 18683 #~ msgstr "Проверка орфографии" 18684 18685 #~ msgctxt "@action" 18686 #~ msgid "Show Toolbar" 18687 #~ msgstr "Кораллар панелен күрсәтү" 18688 18689 #~ msgctxt "@action" 18690 #~ msgid "Show Statusbar" 18691 #~ msgstr "Торыш юлын күрсәтү" 18692 18693 #~ msgctxt "@action" 18694 #~ msgid "Save Options" 18695 #~ msgstr "Көйләүләрне истә калдыру" 18696 18697 #~ msgctxt "@action" 18698 #~ msgid "Key Bindings" 18699 #~ msgstr "Төймәләр тезмәсе" 18700 18701 #~ msgctxt "@action" 18702 #~ msgid "Preferences" 18703 #~ msgstr "Настройки" 18704 18705 #~ msgctxt "@action" 18706 #~ msgid "Configure Toolbars" 18707 #~ msgstr "Кораллар панелен көйләү" 18708 18709 #~ msgctxt "@action" 18710 #~ msgid "Configure Notifications" 18711 #~ msgstr "Белдерүләрне көйләү" 18712 18713 #~ msgctxt "@action" 18714 #~ msgid "Tip Of Day" 18715 #~ msgstr "Көн киңәше" 18716 18717 #~ msgctxt "@action" 18718 #~ msgid "Report Bug" 18719 #~ msgstr "Хата турында хәбәр итү" 18720 18721 #~ msgctxt "@action" 18722 #~ msgid "Switch Application Language" 18723 #~ msgstr "Кушымтаның телен үзгәртү" 18724 18725 #~ msgctxt "@action" 18726 #~ msgid "About KDE" 18727 #~ msgstr "KDE турында" 18728 18729 #~ msgid "Spell Checking Configuration" 18730 #~ msgstr "Настройка проверки орфографии" 18731 18732 #~ msgid "Enable &background spellchecking" 18733 #~ msgstr "Дөрес язылыш тикшерүнең &җирлектә җибәрү" 18734 18735 #~ msgid "&Automatic spell checking enabled by default" 18736 #~ msgstr "Стандарт буенча автоматик рәвештә дөрес язылышны тикшерүне эшләтү" 18737 18738 #~ msgid "Skip all &uppercase words" 18739 #~ msgstr "Өс регистрда булган &сүзләрне төшереп калдыру" 18740 18741 #~ msgid "S&kip run-together words" 18742 #~ msgstr "Бергә язылган сүзләрне төшереп калд&ыру" 18743 18744 #~ msgid "Default language:" 18745 #~ msgstr "Стандарт тел:" 18746 18747 #~ msgid "Ignored Words" 18748 #~ msgstr "Төшереп калдырган сүзләр" 18749 18750 #~ msgctxt "@title:window" 18751 #~ msgid "Check Spelling" 18752 #~ msgstr "Дөрес язылышны тикшерү" 18753 18754 #~ msgctxt "@action:button" 18755 #~ msgid "&Finished" 18756 #~ msgstr "&Әзер" 18757 18758 #~ msgctxt "progress label" 18759 #~ msgid "Spell checking in progress..." 18760 #~ msgstr "Дөрес язылыш тикшерелә" 18761 18762 #~ msgid "Spell check stopped." 18763 #~ msgstr "Дөрес язылышны тикшерү туктатылды" 18764 18765 #~ msgid "Spell check canceled." 18766 #~ msgstr "Дөрес язылыш тикшерүне кире кагу" 18767 18768 #~ msgid "Spell check complete." 18769 #~ msgstr "Дөрес язылыш тикшерелде" 18770 18771 #~ msgid "Autocorrect" 18772 #~ msgstr "Автоматик төзәтү" 18773 18774 #~ msgid "" 18775 #~ "You reached the end of the list\n" 18776 #~ "of matching items.\n" 18777 #~ msgstr "" 18778 #~ "Туры килгән элементлар\n" 18779 #~ "исемлеге ахырына килеп җитте.\n" 18780 18781 #~ msgid "" 18782 #~ "The completion is ambiguous, more than one\n" 18783 #~ "match is available.\n" 18784 #~ msgstr "" 18785 #~ "Тәмамлау бермәгънәле түгел, бер варианттан\n" 18786 #~ "артыграк була.\n" 18787 18788 #~ msgid "There is no matching item available.\n" 18789 #~ msgstr "Туры килгән элементлар юк.\n" 18790 18791 #~ msgid "Backspace" 18792 #~ msgstr "Клавиша Backspace" 18793 18794 #~ msgid "SysReq" 18795 #~ msgstr "SysReq" 18796 18797 #~ msgid "CapsLock" 18798 #~ msgstr "CapsLock" 18799 18800 #~ msgid "NumLock" 18801 #~ msgstr "NumLock" 18802 18803 #~ msgid "ScrollLock" 18804 #~ msgstr "ScrollLock" 18805 18806 #~ msgid "PageUp" 18807 #~ msgstr "PageUp" 18808 18809 #~ msgid "PageDown" 18810 #~ msgstr "PageDown" 18811 18812 #~ msgid "Again" 18813 #~ msgstr "Яңадан" 18814 18815 #~ msgid "Props" 18816 #~ msgstr "Сыйфатлар" 18817 18818 #~ msgid "Front" 18819 #~ msgstr "Фронт" 18820 18821 #~ msgid "Copy" 18822 #~ msgstr "Күчереп язу" 18823 18824 #~ msgid "Paste" 18825 #~ msgstr "Кую" 18826 18827 #~ msgid "Find" 18828 #~ msgstr "Эзләү" 18829 18830 #~ msgid "Cut" 18831 #~ msgstr "Кисү" 18832 18833 #~ msgid "&Cancel" 18834 #~ msgstr "Үт&кәрмәү" 18835 18836 #~ msgid "&Yes" 18837 #~ msgstr "&Әйе" 18838 18839 #~ msgid "&No" 18840 #~ msgstr "&Юк" 18841 18842 #~ msgid "&Discard" 18843 #~ msgstr "Кире &кагу" 18844 18845 #~ msgid "Discard changes" 18846 #~ msgstr "Үзгәрешләрне кире кагу" 18847 18848 #~ msgid "" 18849 #~ "Pressing this button will discard all recent changes made in this dialog." 18850 #~ msgstr "Нажатие этой кнопки сбросит все изменения в текущем диалоге." 18851 18852 #~ msgid "Save data" 18853 #~ msgstr "Мәгълүматларны саклау" 18854 18855 #~ msgid "&Do Not Save" 18856 #~ msgstr "&Сакламаска" 18857 18858 #~ msgid "Do not save data" 18859 #~ msgstr "Мәгълуматны сакламау" 18860 18861 #~ msgid "Save file with another name" 18862 #~ msgstr "Файлны башка исем белән саклау" 18863 18864 #~ msgid "&Apply" 18865 #~ msgstr "&Куллану" 18866 18867 #~ msgid "Apply changes" 18868 #~ msgstr "Үзгәрешләрне куллану" 18869 18870 #~ msgid "" 18871 #~ "When you click <b>Apply</b>, the settings will be handed over to the " 18872 #~ "program, but the dialog will not be closed.\n" 18873 #~ "Use this to try different settings." 18874 #~ msgstr "" 18875 #~ "При нажатии кнопки <b>Применить</b> параметры будут переданы в программу, " 18876 #~ "но окно параметров не будет закрыто.\n" 18877 #~ "Благодаря этому вы можете попробовать различные варианты настройки." 18878 18879 #~ msgid "Administrator &Mode..." 18880 #~ msgstr "&Администратор ысулы..." 18881 18882 #~ msgid "Enter Administrator Mode" 18883 #~ msgstr "Администратор хокуклары белән керү" 18884 18885 #~ msgid "" 18886 #~ "When you click <b>Administrator Mode</b> you will be prompted for the " 18887 #~ "administrator (root) password in order to make changes which require root " 18888 #~ "privileges." 18889 #~ msgstr "" 18890 #~ "При нажатии кнопки <b>Режим администратора</b> будет запрошен пароль " 18891 #~ "администратора (root), поскольку действия нужно будет выполнять с правами " 18892 #~ "этого пользователя." 18893 18894 #~ msgid "Clear input" 18895 #~ msgstr "Керткәнне чистарту" 18896 18897 #~ msgid "Clear the input in the edit field" 18898 #~ msgstr "Редакторлау юлында керүне чистарту" 18899 18900 #~ msgid "Show help" 18901 #~ msgstr "Белешмәне күрсәтү" 18902 18903 #~ msgid "Close the current window or document" 18904 #~ msgstr "Агымдагы тәрәзәне яки документны ябу" 18905 18906 #~ msgid "&Close Window" 18907 #~ msgstr "&Тәрәзәне ябу" 18908 18909 #~ msgid "Close the current window." 18910 #~ msgstr "Бу тәрәзәне ябу" 18911 18912 #~ msgid "&Close Document" 18913 #~ msgstr "&Документны ябу" 18914 18915 #~ msgid "Close the current document." 18916 #~ msgstr "Бу документны ябу" 18917 18918 #~ msgid "&Defaults" 18919 #~ msgstr "Алданук &билгеләнгәнчә" 18920 18921 #~ msgid "Reset all items to their default values" 18922 #~ msgstr "Алданук билгеләнгәнчә мәгънәсен тергезү" 18923 18924 #~ msgid "Go back one step" 18925 #~ msgstr "Бер адымка артка" 18926 18927 #~ msgid "Go forward one step" 18928 #~ msgstr "Бер адымга алга күчү" 18929 18930 #~ msgid "Opens the print dialog to print the current document" 18931 #~ msgstr "Агымдагы документны бастыру өчен бастыру диалогын ача" 18932 18933 #~ msgid "C&ontinue" 18934 #~ msgstr "Д&әвам иттерү" 18935 18936 #~ msgid "Continue operation" 18937 #~ msgstr "Гамәлне дәвам иттерү" 18938 18939 #~ msgid "&Delete" 18940 #~ msgstr "&Бетерү" 18941 18942 #~ msgid "Delete item(s)" 18943 #~ msgstr "Элементларны сөртү" 18944 18945 #~ msgid "Open file" 18946 #~ msgstr "Файлны ачу" 18947 18948 #~ msgid "&Reset" 18949 #~ msgstr "Бе&терү" 18950 18951 #~ msgid "Reset configuration" 18952 #~ msgstr "Конфигурацияне бетерү" 18953 18954 #~ msgctxt "Verb" 18955 #~ msgid "&Insert" 18956 #~ msgstr "&Кертелеш" 18957 18958 #~ msgid "Test" 18959 #~ msgstr "Тикшерү" 18960 18961 #~ msgid "&Overwrite" 18962 #~ msgstr "&Алыштыру" 18963 18964 #~ msgid "&Available:" 18965 #~ msgstr "&Булган:" 18966 18967 #~ msgid "&Selected:" 18968 #~ msgstr "&Сайланган:" 18969 18970 #~ msgctxt "KCharSelect section name" 18971 #~ msgid "Middle Eastern Scripts" 18972 #~ msgstr "Якын көнчыгыш" 18973 18974 #~ msgctxt "KCharSelect section name" 18975 #~ msgid "South Asian Scripts" 18976 #~ msgstr "Көньяк Азия" 18977 18978 #~ msgctxt "KCharSelect section name" 18979 #~ msgid "Philippine Scripts" 18980 #~ msgstr "Филиппин" 18981 18982 #~ msgctxt "KCharSelect section name" 18983 #~ msgid "South East Asian Scripts" 18984 #~ msgstr "Көньяк-көнчыгыш Азия" 18985 18986 #~ msgctxt "KCharSelect section name" 18987 #~ msgid "East Asian Scripts" 18988 #~ msgstr "Көнчыгыш Азия" 18989 18990 #~ msgctxt "KCharSelect section name" 18991 #~ msgid "Central Asian Scripts" 18992 #~ msgstr "Урта Азия" 18993 18994 #~ msgctxt "KCharSelect section name" 18995 #~ msgid "Other Scripts" 18996 #~ msgstr "Башка" 18997 18998 #~ msgctxt "KCharSelect section name" 18999 #~ msgid "Symbols" 19000 #~ msgstr "Тамгалар" 19001 19002 #~ msgctxt "KCharSelect section name" 19003 #~ msgid "Mathematical Symbols" 19004 #~ msgstr "Математик тамгалар" 19005 19006 #~ msgctxt "KCharSelect section name" 19007 #~ msgid "Phonetic Symbols" 19008 #~ msgstr "Фонетик тамгалар" 19009 19010 #~ msgctxt "KCharSelect section name" 19011 #~ msgid "Combining Diacritical Marks" 19012 #~ msgstr "Тулыландыручы диакритик тамгалары" 19013 19014 #~ msgctxt "KCharSelect section name" 19015 #~ msgid "Other" 19016 #~ msgstr "Башкалар" 19017 19018 #~ msgctxt "KCharselect unicode block name" 19019 #~ msgid "Basic Latin" 19020 #~ msgstr "Төп латин" 19021 19022 #~ msgctxt "KCharselect unicode block name" 19023 #~ msgid "Latin-1 Supplement" 19024 #~ msgstr "Латин әлибасына өстәлмә 1" 19025 19026 #~ msgctxt "KCharselect unicode block name" 19027 #~ msgid "Latin Extended-A" 19028 #~ msgstr "Киңәйтелгән латин әлифбасы-A" 19029 19030 #~ msgctxt "KCharselect unicode block name" 19031 #~ msgid "Latin Extended-B" 19032 #~ msgstr "Киңәйтелгән латин әлифбасы-B" 19033 19034 #~ msgctxt "KCharselect unicode block name" 19035 #~ msgid "IPA Extensions" 19036 #~ msgstr "Фонетик тамгалар" 19037 19038 #~ msgctxt "KCharselect unicode block name" 19039 #~ msgid "Spacing Modifier Letters" 19040 #~ msgstr "Символы изменения пробела" 19041 19042 #~ msgctxt "KCharselect unicode block name" 19043 #~ msgid "Combining Diacritical Marks" 19044 #~ msgstr "Тулыландыручы диакритик тамгалары" 19045 19046 #~ msgctxt "KCharselect unicode block name" 19047 #~ msgid "Greek and Coptic" 19048 #~ msgstr "Грек и копт әлифбасы" 19049 19050 #~ msgctxt "KCharselect unicode block name" 19051 #~ msgid "Cyrillic" 19052 #~ msgstr "Кирилл" 19053 19054 #~ msgctxt "KCharselect unicode block name" 19055 #~ msgid "Cyrillic Supplement" 19056 #~ msgstr "Кирилл әлифбасының өстәмә тамгалары" 19057 19058 #~ msgctxt "KCharselect unicode block name" 19059 #~ msgid "Armenian" 19060 #~ msgstr "Әрмән" 19061 19062 #~ msgctxt "KCharselect unicode block name" 19063 #~ msgid "Hebrew" 19064 #~ msgstr "Иврит" 19065 19066 #~ msgctxt "KCharselect unicode block name" 19067 #~ msgid "Arabic" 19068 #~ msgstr "Гарәп" 19069 19070 #~ msgctxt "KCharselect unicode block name" 19071 #~ msgid "Syriac" 19072 #~ msgstr "Сирия" 19073 19074 #~ msgctxt "KCharselect unicode block name" 19075 #~ msgid "Arabic Supplement" 19076 #~ msgstr "Гарәп язмасының өстәмә тамгалары" 19077 19078 #~ msgctxt "KCharselect unicode block name" 19079 #~ msgid "Thaana" 19080 #~ msgstr "Тхаана" 19081 19082 #~ msgctxt "KCharselect unicode block name" 19083 #~ msgid "Devanagari" 19084 #~ msgstr "Деванагари" 19085 19086 #~ msgctxt "KCharselect unicode block name" 19087 #~ msgid "Bengali" 19088 #~ msgstr "Бенгаль" 19089 19090 #~ msgctxt "KCharselect unicode block name" 19091 #~ msgid "Gurmukhi" 19092 #~ msgstr "Гурмуки" 19093 19094 #~ msgctxt "KCharselect unicode block name" 19095 #~ msgid "Gujarati" 19096 #~ msgstr "Гөҗәрәти" 19097 19098 #~ msgctxt "KCharselect unicode block name" 19099 #~ msgid "Oriya" 19100 #~ msgstr "Ория" 19101 19102 #~ msgctxt "KCharselect unicode block name" 19103 #~ msgid "Tamil" 19104 #~ msgstr "Тамиль" 19105 19106 #~ msgctxt "KCharselect unicode block name" 19107 #~ msgid "Telugu" 19108 #~ msgstr "Телугу" 19109 19110 #~ msgctxt "KCharselect unicode block name" 19111 #~ msgid "Kannada" 19112 #~ msgstr "Каннада" 19113 19114 #~ msgctxt "KCharselect unicode block name" 19115 #~ msgid "Malayalam" 19116 #~ msgstr "Малаялам" 19117 19118 #~ msgctxt "KCharselect unicode block name" 19119 #~ msgid "Sinhala" 19120 #~ msgstr "Сингал" 19121 19122 #~ msgctxt "KCharselect unicode block name" 19123 #~ msgid "Thai" 19124 #~ msgstr "Тай" 19125 19126 #~ msgctxt "KCharselect unicode block name" 19127 #~ msgid "Tibetan" 19128 #~ msgstr "Тибет" 19129 19130 #~ msgctxt "KCharselect unicode block name" 19131 #~ msgid "Myanmar" 19132 #~ msgstr "Бирма (Мьянма)" 19133 19134 #~ msgctxt "KCharselect unicode block name" 19135 #~ msgid "Georgian" 19136 #~ msgstr "Грузин" 19137 19138 #~ msgctxt "KCharselect unicode block name" 19139 #~ msgid "Hangul Jamo" 19140 #~ msgstr "Хангыл" 19141 19142 #~ msgctxt "KCharselect unicode block name" 19143 #~ msgid "Ethiopic Supplement" 19144 #~ msgstr "Эфиоп язмасының өстәмә тамгалары" 19145 19146 #~ msgctxt "KCharselect unicode block name" 19147 #~ msgid "Cherokee" 19148 #~ msgstr "Чероки" 19149 19150 #~ msgctxt "KCharselect unicode block name" 19151 #~ msgid "Unified Canadian Aboriginal Syllabics" 19152 #~ msgstr "Канаданың иҗекле язмасы" 19153 19154 #~ msgctxt "KCharselect unicode block name" 19155 #~ msgid "Ogham" 19156 #~ msgstr "Огхам" 19157 19158 #~ msgctxt "KCharselect unicode block name" 19159 #~ msgid "Runic" 19160 #~ msgstr "Руналы" 19161 19162 #~ msgctxt "KCharselect unicode block name" 19163 #~ msgid "Tagalog" 19164 #~ msgstr "Тагал" 19165 19166 #~ msgctxt "KCharselect unicode block name" 19167 #~ msgid "Hanunoo" 19168 #~ msgstr "Хануну" 19169 19170 #~ msgctxt "KCharselect unicode block name" 19171 #~ msgid "Tagbanwa" 19172 #~ msgstr "Тагбанва" 19173 19174 #~ msgctxt "KCharselect unicode block name" 19175 #~ msgid "Khmer" 19176 #~ msgstr "Кхмер" 19177 19178 #~ msgctxt "KCharselect unicode block name" 19179 #~ msgid "Mongolian" 19180 #~ msgstr "Монгол" 19181 19182 #~ msgctxt "KCharselect unicode block name" 19183 #~ msgid "Unified Canadian Aboriginal Syllabics Extended" 19184 #~ msgstr "Канаданың иҗекле язмасының киңәйтмәсе" 19185 19186 #~ msgctxt "KCharselect unicode block name" 19187 #~ msgid "Limbu" 19188 #~ msgstr "Лимбу" 19189 19190 #~ msgctxt "KCharselect unicode block name" 19191 #~ msgid "Tai Le" 19192 #~ msgstr "Тай Лы" 19193 19194 #~ msgctxt "KCharselect unicode block name" 19195 #~ msgid "New Tai Lue" 19196 #~ msgstr "Яңа Тай Лы" 19197 19198 #~ msgctxt "KCharselect unicode block name" 19199 #~ msgid "Khmer Symbols" 19200 #~ msgstr "Кхмер тамгалары" 19201 19202 #~ msgctxt "KCharselect unicode block name" 19203 #~ msgid "Buginese" 19204 #~ msgstr "Буги язмасы" 19205 19206 #~ msgctxt "KCharselect unicode block name" 19207 #~ msgid "Tai Tham" 19208 #~ msgstr "Тай Там" 19209 19210 #~ msgctxt "KCharselect unicode block name" 19211 #~ msgid "Balinese" 19212 #~ msgstr "Балинес" 19213 19214 #, fuzzy 19215 #~| msgctxt "KCharselect unicode block name" 19216 #~| msgid "Katakana" 19217 #~ msgctxt "KCharselect unicode block name" 19218 #~ msgid "Batak" 19219 #~ msgstr "Катакана" 19220 19221 #~ msgctxt "KCharselect unicode block name" 19222 #~ msgid "Lepcha" 19223 #~ msgstr "Леп" 19224 19225 #~ msgctxt "KCharselect unicode block name" 19226 #~ msgid "Ol Chiki" 19227 #~ msgstr "Ол Чики" 19228 19229 #~ msgctxt "KCharselect unicode block name" 19230 #~ msgid "Vedic Extensions" 19231 #~ msgstr "Ведалы санскритның киңәйтмәсе" 19232 19233 #~ msgctxt "KCharselect unicode block name" 19234 #~ msgid "Phonetic Extensions" 19235 #~ msgstr "Фонетик киңәйтмәләр" 19236 19237 #~ msgctxt "KCharselect unicode block name" 19238 #~ msgid "Phonetic Extensions Supplement" 19239 #~ msgstr "Өстәмә фонетик киңәйтмәләре" 19240 19241 #~ msgctxt "KCharselect unicode block name" 19242 #~ msgid "Combining Diacritical Marks Supplement" 19243 #~ msgstr "Дополнительные комбинируемые диакритические знаки для символов" 19244 19245 #~ msgctxt "KCharselect unicode block name" 19246 #~ msgid "Latin Extended Additional" 19247 #~ msgstr "Киңәйтелгән латин әлифбасының өстәлмәсе" 19248 19249 #~ msgctxt "KCharselect unicode block name" 19250 #~ msgid "Greek Extended" 19251 #~ msgstr "Киңәйтелгән грек" 19252 19253 #~ msgctxt "KCharselect unicode block name" 19254 #~ msgid "General Punctuation" 19255 #~ msgstr "Пунктуация тамгалары" 19256 19257 #~ msgctxt "KCharselect unicode block name" 19258 #~ msgid "Superscripts and Subscripts" 19259 #~ msgstr "Аскы һәм өске индекслар" 19260 19261 #~ msgctxt "KCharselect unicode block name" 19262 #~ msgid "Currency Symbols" 19263 #~ msgstr "Акча тамгалары" 19264 19265 #~ msgctxt "KCharselect unicode block name" 19266 #~ msgid "Combining Diacritical Marks for Symbols" 19267 #~ msgstr "Комбинируемые диакритические знаки для символов" 19268 19269 #~ msgctxt "KCharselect unicode block name" 19270 #~ msgid "Letterlike Symbols" 19271 #~ msgstr "Хәрефсыман тамгалар" 19272 19273 #~ msgctxt "KCharselect unicode block name" 19274 #~ msgid "Number Forms" 19275 #~ msgstr "Санлы рәвешләр" 19276 19277 #~ msgctxt "KCharselect unicode block name" 19278 #~ msgid "Arrows" 19279 #~ msgstr "Телләр" 19280 19281 #~ msgctxt "KCharselect unicode block name" 19282 #~ msgid "Mathematical Operators" 19283 #~ msgstr "Математик операторлар" 19284 19285 #~ msgctxt "KCharselect unicode block name" 19286 #~ msgid "Miscellaneous Technical" 19287 #~ msgstr "Техник тамгалар" 19288 19289 #~ msgctxt "KCharselect unicode block name" 19290 #~ msgid "Optical Character Recognition" 19291 #~ msgstr "Оптическое распознавание символов" 19292 19293 #~ msgctxt "KCharselect unicode block name" 19294 #~ msgid "Enclosed Alphanumerics" 19295 #~ msgstr "Вложенные буквы и цифры" 19296 19297 #~ msgctxt "KCharselect unicode block name" 19298 #~ msgid "Box Drawing" 19299 #~ msgstr "Кырларны сүрәтләү тамгалары" 19300 19301 #~ msgctxt "KCharselect unicode block name" 19302 #~ msgid "Block Elements" 19303 #~ msgstr "Символы заполнения" 19304 19305 #~ msgctxt "KCharselect unicode block name" 19306 #~ msgid "Geometric Shapes" 19307 #~ msgstr "Геометрик фигуралар" 19308 19309 #~ msgctxt "KCharselect unicode block name" 19310 #~ msgid "Miscellaneous Symbols" 19311 #~ msgstr "Төрле рәвештәге билгечекләр" 19312 19313 #~ msgctxt "KCharselect unicode block name" 19314 #~ msgid "Dingbats" 19315 #~ msgstr "Dingbats билгечекләре" 19316 19317 #~ msgctxt "KCharselect unicode block name" 19318 #~ msgid "Miscellaneous Mathematical Symbols-A" 19319 #~ msgstr "Төрле рәвештәге математик тамгалар-A" 19320 19321 #~ msgctxt "KCharselect unicode block name" 19322 #~ msgid "Supplemental Arrows-A" 19323 #~ msgstr "Өстәмә уклар - A" 19324 19325 #~ msgctxt "KCharselect unicode block name" 19326 #~ msgid "Braille Patterns" 19327 #~ msgstr "Брайль калыплары" 19328 19329 #~ msgctxt "KCharselect unicode block name" 19330 #~ msgid "Supplemental Arrows-B" 19331 #~ msgstr "Өстәмә уклар - B" 19332 19333 #~ msgctxt "KCharselect unicode block name" 19334 #~ msgid "Miscellaneous Mathematical Symbols-B" 19335 #~ msgstr "Төрле рәвештәге математик тамгалар-B" 19336 19337 #~ msgctxt "KCharselect unicode block name" 19338 #~ msgid "Supplemental Mathematical Operators" 19339 #~ msgstr "Өстәмә матиматик операторлары" 19340 19341 #~ msgctxt "KCharselect unicode block name" 19342 #~ msgid "Miscellaneous Symbols and Arrows" 19343 #~ msgstr "Төәрле рәвештәге тамгалар һәм уклар" 19344 19345 #~ msgctxt "KCharselect unicode block name" 19346 #~ msgid "Glagolitic" 19347 #~ msgstr "Глаголица" 19348 19349 #~ msgctxt "KCharselect unicode block name" 19350 #~ msgid "Latin Extended-C" 19351 #~ msgstr "Киңәйтелгән латин әлифбасы-C" 19352 19353 #~ msgctxt "KCharselect unicode block name" 19354 #~ msgid "Georgian Supplement" 19355 #~ msgstr "Грузин әлифбасының өстәмә төймәләре" 19356 19357 #~ msgctxt "KCharselect unicode block name" 19358 #~ msgid "Tifinagh" 19359 #~ msgstr "Тифинаг" 19360 19361 #~ msgctxt "KCharselect unicode block name" 19362 #~ msgid "Ethiopic Extended" 19363 #~ msgstr "Расширенный набор символов эфиопского письма" 19364 19365 #~ msgctxt "KCharselect unicode block name" 19366 #~ msgid "Cyrillic Extended-A" 19367 #~ msgstr "Кириллица (расширение A)" 19368 19369 #~ msgctxt "KCharselect unicode block name" 19370 #~ msgid "Supplemental Punctuation" 19371 #~ msgstr "Пунктуациянең өстәмә тамгалары" 19372 19373 #~ msgctxt "KCharselect unicode block name" 19374 #~ msgid "CJK Radicals Supplement" 19375 #~ msgstr "Дополнительные иероглифические ключи ККЯ" 19376 19377 #~ msgctxt "KCharselect unicode block name" 19378 #~ msgid "Kangxi Radicals" 19379 #~ msgstr "Канси сүзлегенең иероглифик ачкычлары" 19380 19381 #~ msgctxt "KCharselect unicode block name" 19382 #~ msgid "Ideographic Description Characters" 19383 #~ msgstr "Символы идеографического описания" 19384 19385 #~ msgctxt "KCharselect unicode block name" 19386 #~ msgid "CJK Symbols and Punctuation" 19387 #~ msgstr "Символы и пунктуация ККЯ" 19388 19389 #~ msgctxt "KCharselect unicode block name" 19390 #~ msgid "Hiragana" 19391 #~ msgstr "Хирагана" 19392 19393 #~ msgctxt "KCharselect unicode block name" 19394 #~ msgid "Katakana" 19395 #~ msgstr "Катакана" 19396 19397 #~ msgctxt "KCharselect unicode block name" 19398 #~ msgid "Bopomofo" 19399 #~ msgstr "Бопомофо" 19400 19401 #~ msgctxt "KCharselect unicode block name" 19402 #~ msgid "Hangul Compatibility Jamo" 19403 #~ msgstr "Җамо белән туры килүче һангыл" 19404 19405 #~ msgctxt "KCharselect unicode block name" 19406 #~ msgid "Kanbun" 19407 #~ msgstr "Камбун" 19408 19409 #~ msgctxt "KCharselect unicode block name" 19410 #~ msgid "Bopomofo Extended" 19411 #~ msgstr "Киңәйтелгән бопомофо (Кытай)" 19412 19413 #~ msgctxt "KCharselect unicode block name" 19414 #~ msgid "CJK Strokes" 19415 #~ msgstr "ККЯ сызымнары" 19416 19417 #~ msgctxt "KCharselect unicode block name" 19418 #~ msgid "Katakana Phonetic Extensions" 19419 #~ msgstr "Катакананың фонетик киңәйтмәләре" 19420 19421 #~ msgctxt "KCharselect unicode block name" 19422 #~ msgid "Enclosed CJK Letters and Months" 19423 #~ msgstr "Вложенные буквы и месяцы ККЯ" 19424 19425 #~ msgctxt "KCharselect unicode block name" 19426 #~ msgid "CJK Compatibility" 19427 #~ msgstr "CJK - туры килүче тамгалары" 19428 19429 #~ msgctxt "KCharselect unicode block name" 19430 #~ msgid "CJK Unified Ideographs Extension A" 19431 #~ msgstr "Бердәйләштергән ККЯ тамгалары (А киңәйтмәсе)" 19432 19433 #~ msgctxt "KCharselect unicode block name" 19434 #~ msgid "Yijing Hexagram Symbols" 19435 #~ msgstr "Ицзин гексаграммалары" 19436 19437 #~ msgctxt "KCharselect unicode block name" 19438 #~ msgid "CJK Unified Ideographs" 19439 #~ msgstr "CJK - бердәйләштергән иероглифлар" 19440 19441 #~ msgctxt "KCharselect unicode block name" 19442 #~ msgid "Yi Syllables" 19443 #~ msgstr "«И» язмасының иҗекләре" 19444 19445 #~ msgctxt "KCharselect unicode block name" 19446 #~ msgid "Yi Radicals" 19447 #~ msgstr "«И» язмасының иероглиф ачкычлары" 19448 19449 #~ msgctxt "KCharselect unicode block name" 19450 #~ msgid "Lisu" 19451 #~ msgstr "Лису язмасы" 19452 19453 #~ msgctxt "KCharselect unicode block name" 19454 #~ msgid "Cyrillic Extended-B" 19455 #~ msgstr "Кирилл әлифбасы (B киңәйтмәсе)" 19456 19457 #~ msgctxt "KCharselect unicode block name" 19458 #~ msgid "Bamum" 19459 #~ msgstr "Бамум язмасы" 19460 19461 #~ msgctxt "KCharselect unicode block name" 19462 #~ msgid "Modifier Tone Letters" 19463 #~ msgstr "Тон үзгәрү тамгалары" 19464 19465 #~ msgctxt "KCharselect unicode block name" 19466 #~ msgid "Latin Extended-D" 19467 #~ msgstr "Киңәйтелгән латин әлифбасы-D" 19468 19469 #~ msgctxt "KCharselect unicode block name" 19470 #~ msgid "Syloti Nagri" 19471 #~ msgstr "Силоти Нагри" 19472 19473 #~ msgctxt "KCharselect unicode block name" 19474 #~ msgid "Common Indic Number Forms" 19475 #~ msgstr "Һинд сан тамгалары" 19476 19477 #~ msgctxt "KCharselect unicode block name" 19478 #~ msgid "Phags-pa" 19479 #~ msgstr "Шакмаклы Пагба-ламы язмасы" 19480 19481 #~ msgctxt "KCharselect unicode block name" 19482 #~ msgid "Saurashtra" 19483 #~ msgstr "Саураштра язмасы" 19484 19485 #~ msgctxt "KCharselect unicode block name" 19486 #~ msgid "Devanagari Extended" 19487 #~ msgstr "Деванагари киңәйтмәсе" 19488 19489 #~ msgctxt "KCharselect unicode block name" 19490 #~ msgid "Kayah Li" 19491 #~ msgstr "Кайя Ли язмасы" 19492 19493 #~ msgctxt "KCharselect unicode block name" 19494 #~ msgid "Rejang" 19495 #~ msgstr "Реҗәнг язмасы" 19496 19497 #~ msgctxt "KCharselect unicode block name" 19498 #~ msgid "Hangul Jamo Extended-A" 19499 #~ msgstr "Һангыл (A киңәйтмәсе)" 19500 19501 #~ msgctxt "KCharselect unicode block name" 19502 #~ msgid "Javanese" 19503 #~ msgstr "Яван язмасы" 19504 19505 #~ msgctxt "KCharselect unicode block name" 19506 #~ msgid "Myanmar Extended-A" 19507 #~ msgstr "Мьянма язмасы (A киңәйтмәсе)" 19508 19509 #~ msgctxt "KCharselect unicode block name" 19510 #~ msgid "Tai Viet" 19511 #~ msgstr "Тай Вьет язмасы" 19512 19513 #, fuzzy 19514 #~| msgctxt "KCharselect unicode block name" 19515 #~| msgid "Ethiopic Extended" 19516 #~ msgctxt "KCharselect unicode block name" 19517 #~ msgid "Ethiopic Extended-A" 19518 #~ msgstr "Расширенный набор символов эфиопского письма" 19519 19520 #~ msgctxt "KCharselect unicode block name" 19521 #~ msgid "Meetei Mayek" 19522 #~ msgstr "Манипури язмасы" 19523 19524 #~ msgctxt "KCharselect unicode block name" 19525 #~ msgid "Hangul Syllables" 19526 #~ msgstr "Һангыл иҗекләре" 19527 19528 #~ msgctxt "KCharselect unicode block name" 19529 #~ msgid "Hangul Jamo Extended-B" 19530 #~ msgstr "Һангыл (B киңәйтмәсе)" 19531 19532 #~ msgctxt "KCharselect unicode block name" 19533 #~ msgid "High Surrogates" 19534 #~ msgstr "Верхняя часть суррогатных пар" 19535 19536 #~ msgctxt "KCharselect unicode block name" 19537 #~ msgid "High Private Use Surrogates" 19538 #~ msgstr "Верхняя часть суррогатных пар для частного использования" 19539 19540 #~ msgctxt "KCharselect unicode block name" 19541 #~ msgid "Low Surrogates" 19542 #~ msgstr "Нижняя часть суррогатных пар" 19543 19544 #~ msgctxt "KCharselect unicode block name" 19545 #~ msgid "Private Use Area" 19546 #~ msgstr "Шәхси тамгаларның өлкәсе" 19547 19548 #~ msgctxt "KCharselect unicode block name" 19549 #~ msgid "CJK Compatibility Ideographs" 19550 #~ msgstr "ККЯ - туры килүче иероглифлар" 19551 19552 #~ msgctxt "KCharselect unicode block name" 19553 #~ msgid "Alphabetic Presentation Forms" 19554 #~ msgstr "Декоративные варианты букв" 19555 19556 #~ msgctxt "KCharselect unicode block name" 19557 #~ msgid "Arabic Presentation Forms-A" 19558 #~ msgstr "Гарәп декоратив-A" 19559 19560 #~ msgctxt "KCharselect unicode block name" 19561 #~ msgid "Variation Selectors" 19562 #~ msgstr "Селекторы вариантов начертания" 19563 19564 #~ msgctxt "KCharselect unicode block name" 19565 #~ msgid "Vertical Forms" 19566 #~ msgstr "Вертикальные формы" 19567 19568 #~ msgctxt "KCharselect unicode block name" 19569 #~ msgid "Combining Half Marks" 19570 #~ msgstr "Дополняющие половинки" 19571 19572 #~ msgctxt "KCharselect unicode block name" 19573 #~ msgid "CJK Compatibility Forms" 19574 #~ msgstr "ККЯ - туры килү төрләре" 19575 19576 #~ msgctxt "KCharselect unicode block name" 19577 #~ msgid "Small Form Variants" 19578 #~ msgstr "Кече зурлык вариантлары" 19579 19580 #~ msgctxt "KCharselect unicode block name" 19581 #~ msgid "Arabic Presentation Forms-B" 19582 #~ msgstr "Гарәп декоратив-B" 19583 19584 #~ msgctxt "KCharselect unicode block name" 19585 #~ msgid "Halfwidth and Fullwidth Forms" 19586 #~ msgstr "Полуширинные и полноширинные формы" 19587 19588 #~ msgctxt "KCharselect unicode block name" 19589 #~ msgid "Specials" 19590 #~ msgstr "Махсус тамгалар" 19591 19592 #~ msgid "Enter a search term or character here" 19593 #~ msgstr "Эшләү юлын яисә тамганы кертеге" 19594 19595 #~ msgctxt "Goes to previous character" 19596 #~ msgid "Previous in History" 19597 #~ msgstr "Исемлектә булган алдынгы тамга" 19598 19599 #~ msgid "Previous Character in History" 19600 #~ msgstr "Исемлектә булган алдынгы тамга" 19601 19602 #~ msgctxt "Goes to next character" 19603 #~ msgid "Next in History" 19604 #~ msgstr "Исемлектә булган алдагы тамга" 19605 19606 #~ msgid "Next Character in History" 19607 #~ msgstr "Исемлектә булган алдагы тамга" 19608 19609 #~ msgid "Select a category" 19610 #~ msgstr "Төркемне сайлау" 19611 19612 #~ msgid "Select a block to be displayed" 19613 #~ msgstr "Блокны сайлау" 19614 19615 #~ msgid "Set font" 19616 #~ msgstr "Хәрефне күрсәтү" 19617 19618 #~ msgid "Set font size" 19619 #~ msgstr "Хәрефнең зурлыгын күрсәтү" 19620 19621 #~ msgid "Annotations and Cross References" 19622 #~ msgstr "Аннотации и перекрёстные ссылки" 19623 19624 #~ msgid "Alias names:" 19625 #~ msgstr "Другие представления:" 19626 19627 #~ msgid "Notes:" 19628 #~ msgstr "Искәрмәләр:" 19629 19630 #~ msgid "See also:" 19631 #~ msgstr "Шулай ук моны кара:" 19632 19633 #~ msgid "Equivalents:" 19634 #~ msgstr "Эквивалентлар:" 19635 19636 #~ msgid "Approximate equivalents:" 19637 #~ msgstr "Охшаган эквивалентлар:" 19638 19639 #~ msgid "CJK Ideograph Information" 19640 #~ msgstr "ККЯ иероглифы турында мәгълумат" 19641 19642 #~ msgid "Definition in English: " 19643 #~ msgstr "Инглиз телендә булган билгеләмә: " 19644 19645 #~ msgid "Mandarin Pronunciation: " 19646 #~ msgstr "Мандарин шивәсендәге әйтелеше: " 19647 19648 #~ msgid "Cantonese Pronunciation: " 19649 #~ msgstr "Кантон шивәсендәге әйтелеше: " 19650 19651 #~ msgid "Japanese On Pronunciation: " 19652 #~ msgstr "Он әйтелеше: " 19653 19654 #~ msgid "Japanese Kun Pronunciation: " 19655 #~ msgstr "Кун әйтелеше: " 19656 19657 #~ msgid "Tang Pronunciation: " 19658 #~ msgstr "Танг әйтелеше: " 19659 19660 #~ msgid "Korean Pronunciation: " 19661 #~ msgstr "Корея әйтелеше: " 19662 19663 #~ msgid "General Character Properties" 19664 #~ msgstr "Тамга турындагы гомуми мәгълумат" 19665 19666 #~ msgid "Block: " 19667 #~ msgstr "Блок: " 19668 19669 #~ msgid "Unicode category: " 19670 #~ msgstr "Юникод төркемнәре: " 19671 19672 #~ msgid "Various Useful Representations" 19673 #~ msgstr "Полезные представления" 19674 19675 #~ msgid "UTF-8:" 19676 #~ msgstr "UTF-8:" 19677 19678 #~ msgid "UTF-16: " 19679 #~ msgstr "UTF-16: " 19680 19681 #~ msgid "C octal escaped UTF-8: " 19682 #~ msgstr "С телендәге UTF-8 форматында күрсәтелгән сигезле код: " 19683 19684 #~ msgid "XML decimal entity:" 19685 #~ msgstr "XML форматындагы унлы сүрәтләү:" 19686 19687 #~ msgid "Unicode code point:" 19688 #~ msgstr "Юникодның коды:" 19689 19690 #~ msgctxt "Character" 19691 #~ msgid "In decimal:" 19692 #~ msgstr "Унлы сүрәт:" 19693 19694 #~ msgid "<Non Private Use High Surrogate>" 19695 #~ msgstr "<заменитель в верхнем регистре>" 19696 19697 #~ msgid "<Private Use High Surrogate>" 19698 #~ msgstr "<пользовательский заменитель в верхнем регистре>" 19699 19700 #~ msgid "<Low Surrogate>" 19701 #~ msgstr "<заменитель в нижнем регистре>" 19702 19703 #~ msgid "<Private Use>" 19704 #~ msgstr "<пользовательский символ>" 19705 19706 #~ msgid "<not assigned>" 19707 #~ msgstr "<не присвоен>" 19708 19709 #~ msgid "Non-printable" 19710 #~ msgstr "Басылмый торган" 19711 19712 #~ msgid "Other, Control" 19713 #~ msgstr "Төрле, идарә итүче" 19714 19715 #~ msgid "Other, Format" 19716 #~ msgstr "Төрле, форматлаучы" 19717 19718 #~ msgid "Other, Not Assigned" 19719 #~ msgstr "Төрле, бәйләнмәгән" 19720 19721 #~ msgid "Other, Private Use" 19722 #~ msgstr "Төрле, кулланучыныкы" 19723 19724 #~ msgid "Other, Surrogate" 19725 #~ msgstr "Төрле, алмаштыручу" 19726 19727 #~ msgid "Letter, Lowercase" 19728 #~ msgstr "Хәреф, аскы регистр" 19729 19730 #~ msgid "Letter, Modifier" 19731 #~ msgstr "Хәреф, модификатор" 19732 19733 #~ msgid "Letter, Other" 19734 #~ msgstr "Хәреф, төрле" 19735 19736 #~ msgid "Letter, Titlecase" 19737 #~ msgstr "Хәреф, баш исем өчен" 19738 19739 #~ msgid "Letter, Uppercase" 19740 #~ msgstr "Хәреф, өске регистр" 19741 19742 #~ msgid "Mark, Spacing Combining" 19743 #~ msgstr "Билге, ара" 19744 19745 #~ msgid "Mark, Enclosing" 19746 #~ msgstr "Билге, ңәя эчендәге тамга" 19747 19748 #~ msgid "Mark, Non-Spacing" 19749 #~ msgstr "Билге, араларсыз" 19750 19751 #~ msgid "Number, Decimal Digit" 19752 #~ msgstr "Сан, унлы" 19753 19754 #~ msgid "Number, Letter" 19755 #~ msgstr "Сан, хәреф" 19756 19757 #~ msgid "Number, Other" 19758 #~ msgstr "Сан, төрле" 19759 19760 #~ msgid "Punctuation, Connector" 19761 #~ msgstr "Пунктуация тамгасы, тоташтыручы" 19762 19763 #~ msgid "Punctuation, Dash" 19764 #~ msgstr "Пунктуация тамгасы, озынсызык" 19765 19766 #~ msgid "Punctuation, Close" 19767 #~ msgstr "Пунктуация тамгасы, ябучы" 19768 19769 #~ msgid "Punctuation, Final Quote" 19770 #~ msgstr "Пунктуация тамгасы, ябучы куштырнак" 19771 19772 #~ msgid "Punctuation, Initial Quote" 19773 #~ msgstr "Пунктуация тамгасы, ачучы куштырнак" 19774 19775 #~ msgid "Punctuation, Other" 19776 #~ msgstr "Пунктуация тамгасы, төрле" 19777 19778 #~ msgid "Punctuation, Open" 19779 #~ msgstr "Пунктуация тамгасы, ачучы" 19780 19781 #~ msgid "Symbol, Currency" 19782 #~ msgstr "Тамга, валюта" 19783 19784 #~ msgid "Symbol, Modifier" 19785 #~ msgstr "Тамга, модификатор" 19786 19787 #~ msgid "Symbol, Math" 19788 #~ msgstr "Тамга, математик" 19789 19790 #~ msgid "Symbol, Other" 19791 #~ msgstr "Тамга, төрле" 19792 19793 #~ msgid "Separator, Line" 19794 #~ msgstr "Бүлгеч, юл" 19795 19796 #~ msgid "Separator, Paragraph" 19797 #~ msgstr "Бүлгеч, кызыл юл" 19798 19799 #~ msgid "Separator, Space" 19800 #~ msgstr "Бүлгеч, буш урын" 19801 19802 #~ msgid "You will be asked to authenticate before saving" 19803 #~ msgstr "Перед сохранением настроек нужно будет подтвердить вход в систему" 19804 19805 #~ msgid "You are not allowed to save the configuration" 19806 #~ msgstr "Бу үзгәрешләрне ясау өчен хокуклар юк." 19807 19808 #~ msgctxt "@option next year" 19809 #~ msgid "Next Year" 19810 #~ msgstr "Киләсе ел" 19811 19812 #~ msgctxt "@option next month" 19813 #~ msgid "Next Month" 19814 #~ msgstr "Киләсе ай" 19815 19816 #~ msgctxt "@option next week" 19817 #~ msgid "Next Week" 19818 #~ msgstr "Следующая неделя" 19819 19820 #~ msgctxt "@option tomorrow" 19821 #~ msgid "Tomorrow" 19822 #~ msgstr "Иртәгә" 19823 19824 #~ msgctxt "@option today" 19825 #~ msgid "Today" 19826 #~ msgstr "Бүген" 19827 19828 #~ msgctxt "@option yesterday" 19829 #~ msgid "Yesterday" 19830 #~ msgstr "Кичә" 19831 19832 #~ msgctxt "@option last week" 19833 #~ msgid "Last Week" 19834 #~ msgstr "Ахыргы атна" 19835 19836 #~ msgctxt "@option last month" 19837 #~ msgid "Last Month" 19838 #~ msgstr "Ахыргы ай" 19839 19840 #~ msgctxt "@option last year" 19841 #~ msgid "Last Year" 19842 #~ msgstr "Ахыргы ел" 19843 19844 #~ msgctxt "@option do not specify a date" 19845 #~ msgid "No Date" 19846 #~ msgstr "Нет даты" 19847 19848 #~ msgctxt "@info" 19849 #~ msgid "The date you entered is invalid" 19850 #~ msgstr "Хаталы вакыт кертелгән" 19851 19852 #~ msgctxt "@info" 19853 #~ msgid "Date cannot be earlier than %1" 19854 #~ msgstr "Көн моннан иртәрәк була алмый: %1" 19855 19856 #~ msgctxt "@info" 19857 #~ msgid "Date cannot be later than %1" 19858 #~ msgstr "Көн моннан соңрак була алмый: %1" 19859 19860 #~ msgid "Week %1" 19861 #~ msgstr "%1 атна" 19862 19863 #~ msgid "Next year" 19864 #~ msgstr "Киләсе ел" 19865 19866 #~ msgid "Previous year" 19867 #~ msgstr "Алдынгы ел" 19868 19869 #~ msgid "Next month" 19870 #~ msgstr "Киләсе ай" 19871 19872 #~ msgid "Previous month" 19873 #~ msgstr "Алдынгы ай" 19874 19875 #~ msgid "Select a week" 19876 #~ msgstr "Атнаны сайлагыз" 19877 19878 #~ msgid "Select a month" 19879 #~ msgstr "Айны сайлагыз" 19880 19881 #~ msgid "Select a year" 19882 #~ msgstr "Елны сайлагыз" 19883 19884 #~ msgid "Select the current day" 19885 #~ msgstr "Агымдагы көнне сайлагыз" 19886 19887 #~ msgctxt "UTC time zone" 19888 #~ msgid "UTC" 19889 #~ msgstr "UTC" 19890 19891 #~ msgctxt "No specific time zone" 19892 #~ msgid "Floating" 19893 #~ msgstr "Билгесез" 19894 19895 #~ msgctxt "@info" 19896 #~ msgid "" 19897 #~ "The entered date and time is before the minimum allowed date and time." 19898 #~ msgstr "" 19899 #~ "Введённые дата и время раньше минимальных допустимых даты и времени." 19900 19901 #~ msgctxt "@info" 19902 #~ msgid "" 19903 #~ "The entered date and time is after the maximum allowed date and time." 19904 #~ msgstr "" 19905 #~ "Введённые дата и время позже максимальных допустимых даты и времени." 19906 19907 #~ msgid "&Help" 19908 #~ msgstr "Белешмә" 19909 19910 #~ msgid "Clear &History" 19911 #~ msgstr "Тарихны &чистарту" 19912 19913 #~ msgid "No further items in the history." 19914 #~ msgstr "Исемлектә элементлар бүтән юк." 19915 19916 #~ msgid "Shortcut '%1' in Application %2 for action %3\n" 19917 #~ msgstr "Комбинация клавиш «%1» в приложении %2 для действия «%3»\n" 19918 19919 #~ msgctxt "" 19920 #~ "%1 is the number of conflicts (hidden), %2 is the key sequence of the " 19921 #~ "shortcut that is problematic" 19922 #~ msgid "The shortcut '%2' conflicts with the following key combination:\n" 19923 #~ msgid_plural "" 19924 #~ "The shortcut '%2' conflicts with the following key combinations:\n" 19925 #~ msgstr[0] "" 19926 #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" 19927 #~ msgstr[1] "" 19928 #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" 19929 #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" 19930 #~ "Комбинация клавиш «%2» конфликтует со следующей комбинацией клавиш:\n" 19931 19932 #~ msgctxt "%1 is the number of shortcuts with which there is a conflict" 19933 #~ msgid "Conflict with Registered Global Shortcut" 19934 #~ msgid_plural "Conflict with Registered Global Shortcuts" 19935 #~ msgstr[0] "Конфликт с глобальными комбинациями клавиш" 19936 #~ msgstr[1] "Конфликт с глобальными комбинациями клавиш" 19937 19938 #~ msgctxt "%1 is the number of conflicts" 19939 #~ msgid "Shortcut Conflict" 19940 #~ msgid_plural "Shortcut Conflicts" 19941 #~ msgstr[0] "Конфликты комбинаций клавиш" 19942 #~ msgstr[1] "Конфликты комбинаций клавиш" 19943 19944 #~ msgid "Shortcut '%1' for action '%2'\n" 19945 #~ msgstr "Комбинация клавиш «%1» для действия «%2»\n" 19946 19947 #~ msgctxt "%1 is the number of ambigious shortcut clashes (hidden)" 19948 #~ msgid "" 19949 #~ "The \"%2\" shortcut is ambiguous with the following shortcut.\n" 19950 #~ "Do you want to assign an empty shortcut to this action?\n" 19951 #~ "%3" 19952 #~ msgid_plural "" 19953 #~ "The \"%2\" shortcut is ambiguous with the following shortcuts.\n" 19954 #~ "Do you want to assign an empty shortcut to these actions?\n" 19955 #~ "%3" 19956 #~ msgstr[0] "" 19957 #~ "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " 19958 #~ "клавиш.\n" 19959 #~ "Отменить назначение комбинации клавиш для указанных действий?\n" 19960 #~ "\n" 19961 #~ "%3" 19962 #~ msgstr[1] "" 19963 #~ "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " 19964 #~ "клавиш.\n" 19965 #~ "Отменить назначение комбинации клавиш для указанных действий?\n" 19966 #~ "\n" 19967 #~ "%3Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " 19968 #~ "клавиш.\n" 19969 #~ "Отменить назначение комбинации клавиш для указанных действий?\n" 19970 #~ "\n" 19971 #~ "%3Комбинация клавиш «%2» конфликтует с приведённой ниже комбинацией " 19972 #~ "клавиш.\n" 19973 #~ "Отменить назначение комбинации клавиш для указанного действия?\n" 19974 #~ "\n" 19975 #~ "%3" 19976 19977 #~ msgid "Shortcut conflict" 19978 #~ msgstr "Төймә тезмәләре бәрелештә" 19979 19980 #~ msgid "" 19981 #~ "<qt>The '%1' key combination is already used by the <b>%2</b> action." 19982 #~ "<br>Please select a different one.</qt>" 19983 #~ msgstr "" 19984 #~ "<qt>Комбинация клавиш %1 уже связана с действием <b>%2</b>.<br>Выберите " 19985 #~ "уникальную комбинацию клавиш.</qt>" 19986 19987 #~ msgid "" 19988 #~ "Click on the button, then enter the shortcut like you would in the " 19989 #~ "program.\n" 19990 #~ "Example for Ctrl+a: hold the Ctrl key and press a." 19991 #~ msgstr "" 19992 #~ "Нажмите на кнопке и введите комбинацию клавиш.\n" 19993 #~ "Например, для комбинации клавиш Ctrl+A зажмите клавишу Ctrl и нажмите A." 19994 19995 #~ msgid "Reserved Shortcut" 19996 #~ msgstr "Зарезервированная комбинация клавиш" 19997 19998 #~ msgid "" 19999 #~ "The F12 key is reserved on Windows, so cannot be used for a global " 20000 #~ "shortcut.\n" 20001 #~ "Please choose another one." 20002 #~ msgstr "" 20003 #~ "В Windows клавиша F12 зарезервирована, поэтому её нельзя использовать в " 20004 #~ "глобальных комбинациях клавиш.\n" 20005 #~ "Выберите другую комбинацию клавиш." 20006 20007 #~ msgid "Conflict with Standard Application Shortcut" 20008 #~ msgstr "Стандартлы төймә функциясе белән конфликт" 20009 20010 #~ msgid "" 20011 #~ "The '%1' key combination is also used for the standard action \"%2\" that " 20012 #~ "some applications use.\n" 20013 #~ "Do you really want to use it as a global shortcut as well?" 20014 #~ msgstr "" 20015 #~ "Комбинация клавиш %1 уже связана со стандартным действием «%2», " 20016 #~ "используемым во многих программах.\n" 20017 #~ "Вы действительно хотите использовать эту комбинацию как глобальную?" 20018 20019 #~ msgctxt "What the user inputs now will be taken as the new shortcut" 20020 #~ msgid "Input" 20021 #~ msgstr "Кертү" 20022 20023 #~ msgid "The key you just pressed is not supported by Qt." 20024 #~ msgstr "Басылган төймә Qt коралы белән тотылмый." 20025 20026 #~ msgid "Unsupported Key" 20027 #~ msgstr "Төймә тотылмый" 20028 20029 #~ msgid "without name" 20030 #~ msgstr "исемсез" 20031 20032 #~ msgctxt "Italic placeholder text in line edits: 0 no, 1 yes" 20033 #~ msgid "1" 20034 #~ msgstr "1" 20035 20036 #~ msgctxt "@action:button Clear current text in the line edit" 20037 #~ msgid "Clear text" 20038 #~ msgstr "Текстны чистарту" 20039 20040 #~ msgctxt "@title:menu" 20041 #~ msgid "Text Completion" 20042 #~ msgstr "Текстны тәмамлау" 20043 20044 #~ msgctxt "@item:inmenu Text Completion" 20045 #~ msgid "None" 20046 #~ msgstr "Юк" 20047 20048 #~ msgctxt "@item:inmenu Text Completion" 20049 #~ msgid "Dropdown List" 20050 #~ msgstr "Төшә торган исемлектән" 20051 20052 #~ msgctxt "@item:inmenu Text Completion" 20053 #~ msgid "Short Automatic" 20054 #~ msgstr "Ярым автоматик" 20055 20056 #~ msgctxt "@item:inmenu Text Completion" 20057 #~ msgid "Dropdown List && Automatic" 20058 #~ msgstr "Төшә торган исемлектән һәм автоматик рәвештә" 20059 20060 #~ msgctxt "@item:inmenu Text Completion" 20061 #~ msgid "Default" 20062 #~ msgstr "Үрнәкле" 20063 20064 #~ msgid "Image Operations" 20065 #~ msgstr "Сурәтләр белән операцияләр" 20066 20067 #~ msgid "&Rotate Clockwise" 20068 #~ msgstr "&Сәгать йөреше буенча бору" 20069 20070 #~ msgid "Rotate &Counterclockwise" 20071 #~ msgstr "С&әгать йөреше каршына бору" 20072 20073 #~ msgctxt "@action" 20074 #~ msgid "Text &Color..." 20075 #~ msgstr "&Тестның төсе..." 20076 20077 #~ msgctxt "@action" 20078 #~ msgid "Text &Highlight..." 20079 #~ msgstr "Текстның яктырую..." 20080 20081 #~ msgctxt "@action" 20082 #~ msgid "&Font" 20083 #~ msgstr "&Хәреф" 20084 20085 #~ msgctxt "@action" 20086 #~ msgid "Font &Size" 20087 #~ msgstr "&Хәрефнең зурлыгы" 20088 20089 #~ msgctxt "@action boldify selected text" 20090 #~ msgid "&Bold" 20091 #~ msgstr "Ка&лын" 20092 20093 #~ msgctxt "@action italicize selected text" 20094 #~ msgid "&Italic" 20095 #~ msgstr "&Курсив" 20096 20097 #~ msgctxt "@action underline selected text" 20098 #~ msgid "&Underline" 20099 #~ msgstr "Ассыз&ыклы" 20100 20101 #~ msgctxt "@action" 20102 #~ msgid "&Strike Out" 20103 #~ msgstr "Сыз&ылган" 20104 20105 #~ msgctxt "@action" 20106 #~ msgid "Align &Left" 20107 #~ msgstr "Сул кыры б&уенча" 20108 20109 #~ msgctxt "@label left justify" 20110 #~ msgid "Left" 20111 #~ msgstr "Сул кыры буенча" 20112 20113 #~ msgctxt "@action" 20114 #~ msgid "Align &Center" 20115 #~ msgstr "Ү&зәк буенча" 20116 20117 #~ msgctxt "@action" 20118 #~ msgid "Align &Right" 20119 #~ msgstr "Уң кы&ры буенча" 20120 20121 #~ msgctxt "@label right justify" 20122 #~ msgid "Right" 20123 #~ msgstr "Уң кыры буенча" 20124 20125 #~ msgctxt "@action" 20126 #~ msgid "&Justify" 20127 #~ msgstr "Киңл&ек буенча" 20128 20129 #~ msgctxt "@label justify fill" 20130 #~ msgid "Justify" 20131 #~ msgstr "Киңлек буенча" 20132 20133 #~ msgctxt "@action" 20134 #~ msgid "Left-to-Right" 20135 #~ msgstr "Сулдан уңга" 20136 20137 #~ msgctxt "@label left-to-right" 20138 #~ msgid "Left-to-Right" 20139 #~ msgstr "Сулдан уңга" 20140 20141 #~ msgctxt "@action" 20142 #~ msgid "Right-to-Left" 20143 #~ msgstr "Уңнан сулга" 20144 20145 #~ msgctxt "@label right-to-left" 20146 #~ msgid "Right-to-Left" 20147 #~ msgstr "Уңнан сулга" 20148 20149 #~ msgctxt "@title:menu" 20150 #~ msgid "List Style" 20151 #~ msgstr "Исемлекнең стиле" 20152 20153 #~ msgctxt "@item:inmenu no list style" 20154 #~ msgid "None" 20155 #~ msgstr "Юк" 20156 20157 #~ msgctxt "@item:inmenu disc list style" 20158 #~ msgid "Disc" 20159 #~ msgstr "Диск" 20160 20161 #~ msgctxt "@item:inmenu circle list style" 20162 #~ msgid "Circle" 20163 #~ msgstr "Түгәрәк" 20164 20165 #~ msgctxt "@item:inmenu square list style" 20166 #~ msgid "Square" 20167 #~ msgstr "Квадрат" 20168 20169 #~ msgctxt "@item:inmenu numbered lists" 20170 #~ msgid "123" 20171 #~ msgstr "123" 20172 20173 #~ msgctxt "@item:inmenu lowercase abc lists" 20174 #~ msgid "abc" 20175 #~ msgstr "abc" 20176 20177 #~ msgctxt "@action" 20178 #~ msgid "Increase Indent" 20179 #~ msgstr "Аралыкны зурайту" 20180 20181 #~ msgctxt "@action" 20182 #~ msgid "Decrease Indent" 20183 #~ msgstr "Араклыкны кечерәйтү" 20184 20185 #~ msgctxt "@action" 20186 #~ msgid "Insert Rule Line" 20187 #~ msgstr "Горизонталь сызыкны өстәү" 20188 20189 #~ msgctxt "@action" 20190 #~ msgid "Link" 20191 #~ msgstr "Сылтама" 20192 20193 #~ msgctxt "@action" 20194 #~ msgid "Format Painter" 20195 #~ msgstr "Форматлы текстка әверелдерү" 20196 20197 #~ msgctxt "@action" 20198 #~ msgid "To Plain Text" 20199 #~ msgstr "Гади текстка әверелдерү" 20200 20201 #~ msgctxt "@action" 20202 #~ msgid "Subscript" 20203 #~ msgstr "Аскы индекс" 20204 20205 #~ msgctxt "@action" 20206 #~ msgid "Superscript" 20207 #~ msgstr "Өске индекс" 20208 20209 #~ msgid "&Copy Full Text" 20210 #~ msgstr "&Бар текстның күчермәсен ясау" 20211 20212 #~ msgid "Nothing to spell check." 20213 #~ msgstr "Нечего проверять." 20214 20215 #~ msgid "Speak Text" 20216 #~ msgstr "Текстны уку" 20217 20218 #~ msgid "Starting Jovie Text-to-Speech Service Failed" 20219 #~ msgstr "Авазны синтазлаучы Jovie хезмәтен җибәреп булмады" 20220 20221 #~ msgid "Ignore" 20222 #~ msgstr "Төшереп калдыру" 20223 20224 #~ msgid "Add to Dictionary" 20225 #~ msgstr "Добавить в словарь" 20226 20227 #~ msgctxt "@info" 20228 #~ msgid "The time you entered is invalid" 20229 #~ msgstr "Хаталы вакыт кертелде" 20230 20231 #~ msgctxt "@info" 20232 #~ msgid "Time cannot be earlier than %1" 20233 #~ msgstr "Вакыт моннан иртәрәк була алмый: %1" 20234 20235 #~ msgctxt "@info" 20236 #~ msgid "Time cannot be later than %1" 20237 #~ msgstr "Вакыт моннан соңрак була алмый: %1" 20238 20239 #~ msgctxt "@title:menu" 20240 #~ msgid "Show Text" 20241 #~ msgstr "Подписи кнопок" 20242 20243 #~ msgctxt "@title:menu" 20244 #~ msgid "Toolbar Settings" 20245 #~ msgstr "Меню панели инструментов" 20246 20247 #~ msgctxt "toolbar position string" 20248 #~ msgid "Top" 20249 #~ msgstr "Өскә" 20250 20251 #~ msgctxt "toolbar position string" 20252 #~ msgid "Left" 20253 #~ msgstr "Сул кыры буенча" 20254 20255 #~ msgctxt "toolbar position string" 20256 #~ msgid "Right" 20257 #~ msgstr "Уң кыры буенча" 20258 20259 #~ msgctxt "toolbar position string" 20260 #~ msgid "Bottom" 20261 #~ msgstr "Аска" 20262 20263 #~ msgid "Text Position" 20264 #~ msgstr "Текст урнашуы" 20265 20266 #~ msgid "Icons Only" 20267 #~ msgstr "Билгечекләр генә" 20268 20269 #~ msgid "Text Only" 20270 #~ msgstr "Текст кына" 20271 20272 #~ msgid "Text Alongside Icons" 20273 #~ msgstr "Имзалар билгечекләр янында" 20274 20275 #~ msgid "Text Under Icons" 20276 #~ msgstr "Имзалар билгечекләр астында" 20277 20278 #~ msgid "Icon Size" 20279 #~ msgstr "Билгечекләр зурлыгы" 20280 20281 #~ msgctxt "@item:inmenu Icon size" 20282 #~ msgid "Default" 20283 #~ msgstr "Үрнәкле" 20284 20285 #~ msgid "Small (%1x%2)" 20286 #~ msgstr "Кече (%1x%2)" 20287 20288 #~ msgid "Medium (%1x%2)" 20289 #~ msgstr "Уртача (%1x%2)" 20290 20291 #~ msgid "Large (%1x%2)" 20292 #~ msgstr "Зур (%1x%2)" 20293 20294 #~ msgid "Huge (%1x%2)" 20295 #~ msgstr "Бик зур (%1x%2)" 20296 20297 #~ msgid "Lock Toolbar Positions" 20298 #~ msgstr "Корал панелен катыру" 20299 20300 #~ msgctxt "@action:intoolbar Text label of toolbar button" 20301 #~ msgid "%1" 20302 #~ msgstr "%1" 20303 20304 #~ msgctxt "@info:tooltip Tooltip of toolbar button" 20305 #~ msgid "%1" 20306 #~ msgstr "%1" 20307 20308 #~ msgid "Desktop %1" 20309 #~ msgstr "%1 эш өстәле" 20310 20311 #~ msgid "Add to Toolbar" 20312 #~ msgstr "Корал панеленә өстәү" 20313 20314 #~ msgid "Configure Shortcut..." 20315 #~ msgstr "Төймә тезмәләрен көйләү" 20316 20317 #~ msgid "Toolbars Shown" 20318 #~ msgstr "Чагылдыручы корал панелләре" 20319 20320 #~ msgid "No text" 20321 #~ msgstr "Текст юк" 20322 20323 #~ msgid "&File" 20324 #~ msgstr "&Файл" 20325 20326 #~ msgid "&Game" 20327 #~ msgstr "&Уен" 20328 20329 #~ msgid "&Edit" 20330 #~ msgstr "&Үзгәртү" 20331 20332 #~ msgctxt "@title:menu Game move" 20333 #~ msgid "&Move" 20334 #~ msgstr "&Күчерү" 20335 20336 #~ msgid "&View" 20337 #~ msgstr "&Кыяфәт" 20338 20339 #~ msgid "&Go" 20340 #~ msgstr "К&үчү" 20341 20342 #~ msgid "&Bookmarks" 20343 #~ msgstr "&Кыстыргычлар" 20344 20345 #~ msgid "&Tools" 20346 #~ msgstr "К&ораллар" 20347 20348 #~ msgid "&Settings" 20349 #~ msgstr "&Көйләүләр" 20350 20351 #~ msgid "Main Toolbar" 20352 #~ msgstr "Баш кораллар панеле" 20353 20354 #~ msgid "Builds Qt widget plugins from an ini style description file." 20355 #~ msgstr "Стильләрне тасвирлау файлыннан Qt виджетлар модульләреннән төзи." 20356 20357 #~ msgid "Input file" 20358 #~ msgstr "Кереш файлы" 20359 20360 #~ msgid "Output file" 20361 #~ msgstr "Чыгыш файлы" 20362 20363 #~ msgid "Name of the plugin class to generate" 20364 #~ msgstr "Киңәйтмәнең ясала торган классы исеме" 20365 20366 #~ msgid "Default widget group name to display in designer" 20367 #~ msgstr "Дизайнерда чагылу өчен алданук билгеләнгән виджетлар төркеме исеме" 20368 20369 #~ msgid "makekdewidgets" 20370 #~ msgstr "makekdewidgets" 20371 20372 #~ msgid "(C) 2004-2005 Ian Reinhart Geiser" 20373 #~ msgstr "© Ian Reinhart Geiser, 2004-2005" 20374 20375 #~ msgid "Ian Reinhart Geiser" 20376 #~ msgstr "Ian Reinhart Geiser" 20377 20378 #~ msgid "Daniel Molkentin" 20379 #~ msgstr "Daniel Molkentin" 20380 20381 #~ msgid "Call Stack" 20382 #~ msgstr "Чакыру стегы" 20383 20384 #~ msgid "Call" 20385 #~ msgstr "Чакыру" 20386 20387 #~ msgid "Console" 20388 #~ msgstr "Консоль" 20389 20390 #~ msgid "Enter" 20391 #~ msgstr "Enter" 20392 20393 #~ msgid "" 20394 #~ "Unable to find the Kate editor component;\n" 20395 #~ "please check your KDE installation." 20396 #~ msgstr "" 20397 #~ "Kate дигән текстлы мөһәррир компоненты табылмады.\n" 20398 #~ "KDE чолганышының дөрес урнаштырылган икәнен тикшерегез." 20399 20400 #~ msgid "Breakpoint" 20401 #~ msgstr "Туктау ноктасы" 20402 20403 #~ msgid "JavaScript Debugger" 20404 #~ msgstr "JavaScript төзәткече" 20405 20406 #~ msgid "&Break at Next Statement" 20407 #~ msgstr "К&иләсе операторда өзү" 20408 20409 #~ msgid "Break at Next" 20410 #~ msgstr "К&иләсе операторда өзү" 20411 20412 #~ msgid "Step Over" 20413 #~ msgstr "Икенче юлга күчү" 20414 20415 #~ msgid "Step Into" 20416 #~ msgstr "Функциягә керү" 20417 20418 #~ msgid "Step Out" 20419 #~ msgstr "Функцияне башкару" 20420 20421 #~ msgid "Reindent Sources" 20422 #~ msgstr "Араларны тигезләү" 20423 20424 #~ msgid "Report Exceptions" 20425 #~ msgstr "Хата турында хәбәр итү" 20426 20427 #~ msgid "&Debug" 20428 #~ msgstr "&Төзәтү" 20429 20430 #~ msgid "Close source" 20431 #~ msgstr "Чыганак коды ябу" 20432 20433 #~ msgid "Ready" 20434 #~ msgstr "Булды" 20435 20436 #~ msgid "Parse error at %1 line %2" 20437 #~ msgstr "%1 тикшерүдә хата, юл %2" 20438 20439 #~ msgid "" 20440 #~ "An error occurred while attempting to run a script on this page.\n" 20441 #~ "\n" 20442 #~ "%1 line %2:\n" 20443 #~ "%3" 20444 #~ msgstr "" 20445 #~ "Бу биттә скрипт башкарганда хата барлыкка килде.\n" 20446 #~ "\n" 20447 #~ "%1 строка %2:\n" 20448 #~ "%3" 20449 20450 #~ msgid "" 20451 #~ "Do not know where to evaluate the expression. Please pause a script or " 20452 #~ "open a source file." 20453 #~ msgstr "" 20454 #~ "Неизвестно, в чём выполнять выражение. Остановите выполнение скрипта или " 20455 #~ "откройте файл с исходным кодом." 20456 20457 #~ msgid "Evaluation threw an exception %1" 20458 #~ msgstr "Появление исключения %1 при выполнении" 20459 20460 #~ msgid "JavaScript Error" 20461 #~ msgstr "JavaScript хатасы" 20462 20463 #~ msgid "&Do not show this message again" 20464 #~ msgstr "&Бу хәбәрне башка чыгармаска" 20465 20466 #~ msgid "Local Variables" 20467 #~ msgstr "Локальные переменные" 20468 20469 #~ msgid "Reference" 20470 #~ msgstr "Сылтама" 20471 20472 #~ msgid "Loaded Scripts" 20473 #~ msgstr "Йөкләнгән скриптлар" 20474 20475 #~ msgid "" 20476 #~ "A script on this page is causing KHTML to freeze. If it continues to run, " 20477 #~ "other applications may become less responsive.\n" 20478 #~ "Do you want to stop the script?" 20479 #~ msgstr "" 20480 #~ "Сценарий на этой странице привёл к зависанию KHTML. Если он продолжит " 20481 #~ "работать, другие приложения будут отзываться медленнее.\n" 20482 #~ "Прервать работу сценария?" 20483 20484 #~ msgid "JavaScript" 20485 #~ msgstr "JavaScript" 20486 20487 #~ msgid "&Stop Script" 20488 #~ msgstr "&Cкриптны туктату" 20489 20490 #~ msgid "Confirmation: JavaScript Popup" 20491 #~ msgstr "Раслау: Javascript'ның йөзеп чыга торган тәрәзәсе" 20492 20493 #~ msgid "" 20494 #~ "This site is submitting a form which will open up a new browser window " 20495 #~ "via JavaScript.\n" 20496 #~ "Do you want to allow the form to be submitted?" 20497 #~ msgstr "" 20498 #~ "Бу сайт форма тапшырырга тырыша, бу күзәтүченең яңа тәрәзә ачылышына " 20499 #~ "китерә(JavaScript аша).\n" 20500 #~ "Моны рөхсәт итәргәме?" 20501 20502 #~ msgid "" 20503 #~ "<qt>This site is submitting a form which will open <p>%1</p> in a new " 20504 #~ "browser window via JavaScript.<br />Do you want to allow the form to be " 20505 #~ "submitted?</qt>" 20506 #~ msgstr "" 20507 #~ "<qt>Бу сайт форма тапшырырга тырыша, бу күзәтүченең яңа тәрәзәдә <p>%1</" 20508 #~ "p> ачылышына китерә(JavaScript аша).<br />Рөхсәт итәргәме?</qt>" 20509 20510 #~ msgid "Do Not Allow" 20511 #~ msgstr "Тыю" 20512 20513 #~ msgid "" 20514 #~ "This site is requesting to open up a new browser window via JavaScript.\n" 20515 #~ "Do you want to allow this?" 20516 #~ msgstr "" 20517 #~ "Бу сайт Javascript'ны кулланып яңа тәрәзә ачмакчы була.\n" 20518 #~ "Тәрәзәне ачарга рөхсәт итәргәме?" 20519 20520 #~ msgid "" 20521 #~ "<qt>This site is requesting to open<p>%1</p>in a new browser window via " 20522 #~ "JavaScript.<br />Do you want to allow this?</qt>" 20523 #~ msgstr "" 20524 #~ "<qt>Бу сайт JavaScript ярдәмендә яңа браузер тәрәзәсендә <p>%1</p>'ны " 20525 #~ "ачарга тырыша.<br />Рөхсәт итәргәме?</qt>" 20526 20527 #~ msgid "Close window?" 20528 #~ msgstr "Тәрәзәне ябаргамы?" 20529 20530 #~ msgid "Confirmation Required" 20531 #~ msgstr "Раслау таләп ителә" 20532 20533 #~ msgid "" 20534 #~ "Do you want a bookmark pointing to the location \"%1\" to be added to " 20535 #~ "your collection?" 20536 #~ msgstr "Коллекциягезнең \"%1\" адресына кыстыргыч өстәргәме?" 20537 20538 #~ msgid "" 20539 #~ "Do you want a bookmark pointing to the location \"%1\" titled \"%2\" to " 20540 #~ "be added to your collection?" 20541 #~ msgstr "" 20542 #~ "Коллекциягезнең \"%1\" адресына \"%2\" баш исеме белән кыстыргыч " 20543 #~ "өстәргәме?" 20544 20545 #~ msgid "JavaScript Attempted Bookmark Insert" 20546 #~ msgstr "JavaScript кыстыргыч өстәргә тырыша" 20547 20548 #~ msgid "Insert" 20549 #~ msgstr "Insert" 20550 20551 #~ msgid "Disallow" 20552 #~ msgstr "Тыю" 20553 20554 #~ msgid "" 20555 #~ "The following files will not be uploaded because they could not be " 20556 #~ "found.\n" 20557 #~ "Do you want to continue?" 20558 #~ msgstr "" 20559 #~ "Күрсәтелгән файллар йөкләндерелә алмый, чөнки алар табылмады.\n" 20560 #~ "Дәвам иттерергәме?" 20561 20562 #~ msgid "Submit Confirmation" 20563 #~ msgstr "Тапшыруны раслау" 20564 20565 #~ msgid "&Submit Anyway" 20566 #~ msgstr "&Тапшыру" 20567 20568 #~ msgid "" 20569 #~ "You are about to transfer the following files from your local computer to " 20570 #~ "the Internet.\n" 20571 #~ "Do you really want to continue?" 20572 #~ msgstr "" 20573 #~ "Была запрошена передача следующих файлов с этого компьютера в Интернет.\n" 20574 #~ "Продолжить?" 20575 20576 #~ msgid "Send Confirmation" 20577 #~ msgstr "Раслауны тапшыру" 20578 20579 #~ msgid "&Send File" 20580 #~ msgid_plural "&Send Files" 20581 #~ msgstr[0] "&Файлны тапшыру" 20582 #~ msgstr[1] "&Файлларны тапшыру" 20583 20584 #~ msgid "Submit" 20585 #~ msgstr "Бәяләмә өчен тапшыру" 20586 20587 #~ msgid "" 20588 #~ "No plugin found for '%1'.\n" 20589 #~ "Do you want to download one from %2?" 20590 #~ msgstr "" 20591 #~ "'%1' өчен өстәмәлек табылмады.\n" 20592 #~ "%2 адресыннан йөкләндерергәме аны?" 20593 20594 #~ msgid "Missing Plugin" 20595 #~ msgstr "Өстәлмә юк" 20596 20597 #~ msgid "Download" 20598 #~ msgstr "Кабул итү" 20599 20600 #~ msgid "Do Not Download" 20601 #~ msgstr "Кабул итмәү" 20602 20603 #~ msgid "This is a searchable index. Enter search keywords: " 20604 #~ msgstr "Бу индекс эзләү мөмкинлеге белән. Төп сүзләрне кертегез: " 20605 20606 #~ msgid "URL:" 20607 #~ msgstr "Веб адресы:" 20608 20609 #~ msgid "Title:" 20610 #~ msgstr "Исем:" 20611 20612 #~ msgid "Last modified:" 20613 #~ msgstr "Соңгы үзгәреш:" 20614 20615 #~ msgid "Document encoding:" 20616 #~ msgstr "Документның кодлашуы:" 20617 20618 #~ msgid "HTTP Headers" 20619 #~ msgstr "HTTP'ның баш исемнәре" 20620 20621 #~ msgid "Property" 20622 #~ msgstr "Параметр" 20623 20624 #~ msgid "Initializing Applet \"%1\"..." 20625 #~ msgstr "«%1» аплеты ачыла..." 20626 20627 #~ msgid "Starting Applet \"%1\"..." 20628 #~ msgstr "«%1» аплет җибәрелә..." 20629 20630 #~ msgid "Applet \"%1\" started" 20631 #~ msgstr "«%1» аплеты җибәрелде" 20632 20633 #~ msgid "Applet \"%1\" stopped" 20634 #~ msgstr "«%1» аплеты туктатылды" 20635 20636 #~ msgid "Loading Applet" 20637 #~ msgstr "Аплет йөкләнә" 20638 20639 #~ msgid "Error: java executable not found" 20640 #~ msgstr "Хата: java кушымтасы табылмады" 20641 20642 #~ msgid "Signed by (validation: %1)" 20643 #~ msgstr "Имза (чынлык: %1)" 20644 20645 #~ msgid "Certificate (validation: %1)" 20646 #~ msgstr "Таныклык (чынлык: %1)" 20647 20648 #~ msgid "Security Alert" 20649 #~ msgstr "Иминлек системасының хәбәре" 20650 20651 #~ msgid "Do you grant Java applet with certificate(s):" 20652 #~ msgstr "Таныклыклар белән Java аплетларын җибәрү:" 20653 20654 #~ msgid "the following permission" 20655 #~ msgstr "түбәндәге хокуклар" 20656 20657 #~ msgid "&Reject All" 20658 #~ msgstr "&Бөтенесен кире кагу" 20659 20660 #~ msgid "&Grant All" 20661 #~ msgstr "&Бөтенесен кабул итү" 20662 20663 #~ msgid "Applet Parameters" 20664 #~ msgstr "Аплетның көйләүләре" 20665 20666 #~ msgid "Class" 20667 #~ msgstr "Класс" 20668 20669 #~ msgid "Base URL" 20670 #~ msgstr "Нигез URL" 20671 20672 #~ msgid "Archives" 20673 #~ msgstr "Архивлар" 20674 20675 #~ msgid "KDE Java Applet Plugin" 20676 #~ msgstr "KDE чолганышының Java аплетларын тоту" 20677 20678 #~ msgid "HTML Toolbar" 20679 #~ msgstr "HTML панеле" 20680 20681 #~ msgid "&Copy Text" 20682 #~ msgstr "Тексттан &күчермә ясау" 20683 20684 #~ msgid "Open '%1'" 20685 #~ msgstr "«%1» объектын ачу" 20686 20687 #~ msgid "&Copy Email Address" 20688 #~ msgstr "E-Mail адресын күчерү" 20689 20690 #~ msgid "&Save Link As..." 20691 #~ msgstr "Сылтаманы &саклау..." 20692 20693 #~ msgid "&Copy Link Address" 20694 #~ msgstr "Веб-адресының күчермәсен ясау" 20695 20696 #~ msgctxt "@title:menu HTML frame/iframe" 20697 #~ msgid "Frame" 20698 #~ msgstr "Фрейм" 20699 20700 #~ msgid "Open in New &Window" 20701 #~ msgstr "Яңа &тәрәзәдә ачу" 20702 20703 #~ msgid "Open in &This Window" 20704 #~ msgstr "Агымдагы &тәрәзәдә ачу" 20705 20706 #~ msgid "Open in &New Tab" 20707 #~ msgstr "Яңа &өстәмдә ачу" 20708 20709 #~ msgid "Reload Frame" 20710 #~ msgstr "Фреймны яңарту" 20711 20712 #~ msgid "Print Frame..." 20713 #~ msgstr "Фреймны бастыру..." 20714 20715 #~ msgid "Save &Frame As..." 20716 #~ msgstr "Фреймны&саклау..." 20717 20718 #~ msgid "View Frame Source" 20719 #~ msgstr "Фреймның чыганак текстын карап чыгу" 20720 20721 #~ msgid "View Frame Information" 20722 #~ msgstr "Фрейм турында мәгълүмат" 20723 20724 #~ msgid "Block IFrame..." 20725 #~ msgstr "IFrame'ны тыю..." 20726 20727 #~ msgid "Save Image As..." 20728 #~ msgstr "Сурәтне саклау..." 20729 20730 #~ msgid "Send Image..." 20731 #~ msgstr "Сурәтне тапшыру..." 20732 20733 #~ msgid "Copy Image Location" 20734 #~ msgstr "Сүрәт сылтамасының күчермәсен ясау" 20735 20736 #~ msgid "View Image (%1)" 20737 #~ msgstr "Сурәтне карап чыгу (%1)" 20738 20739 #~ msgid "Block Image..." 20740 #~ msgstr "Сурәтне тыю..." 20741 20742 #~ msgid "Block Images From %1" 20743 #~ msgstr "%1 объектыннан сурәтне тыю" 20744 20745 #~ msgid "Stop Animations" 20746 #~ msgstr "Анимацияне туктату" 20747 20748 #~ msgid "Search for '%1' with %2" 20749 #~ msgstr "%2'дә «%1»'не эзләү" 20750 20751 #~ msgid "Search for '%1' with" 20752 #~ msgstr "Поиск «%1» в" 20753 20754 #~ msgid "Save Link As" 20755 #~ msgstr "Ахыргы документ итеп саклау" 20756 20757 #~ msgid "Save Image As" 20758 #~ msgstr "Сурәтне саклау..." 20759 20760 #~ msgid "Add URL to Filter" 20761 #~ msgstr "URL'ны сөзгеч исемлегенә өстәү" 20762 20763 #~ msgid "Enter the URL:" 20764 #~ msgstr "Веб адресын языгыз:" 20765 20766 #~ msgid "" 20767 #~ "A file named \"%1\" already exists. Are you sure you want to overwrite it?" 20768 #~ msgstr "«%1» исемле файл инде бар. Алыштырыргамы?" 20769 20770 #~ msgid "Overwrite File?" 20771 #~ msgstr "Файлны алыштырыргамы?" 20772 20773 #~ msgid "Overwrite" 20774 #~ msgstr "Алыштыру" 20775 20776 #~ msgid "The Download Manager (%1) could not be found in your $PATH " 20777 #~ msgstr "" 20778 #~ "$PATH юнәлешендә менеджер йөкләндерү программасын табып булмый (%1). " 20779 20780 #~ msgid "" 20781 #~ "Try to reinstall it \n" 20782 #~ "\n" 20783 #~ "The integration with Konqueror will be disabled." 20784 #~ msgstr "" 20785 #~ "Кушымтаны яңадан урнаштырып карагыз.\n" 20786 #~ "\n" 20787 #~ "Konqueror белән бәйләнеш өзеләчәк." 20788 20789 #~ msgid "Default Font Size (100%)" 20790 #~ msgstr "Хәрефнең стандарт зурлыгы (100%)" 20791 20792 #~ msgid "KHTML" 20793 #~ msgstr "KHTML" 20794 20795 #~ msgid "Embeddable HTML component" 20796 #~ msgstr "HTML чагылдырыр өчен кертелгән компонент" 20797 20798 #~ msgid "Lars Knoll" 20799 #~ msgstr "Lars Knoll" 20800 20801 #~ msgid "Antti Koivisto" 20802 #~ msgstr "Antti Koivisto" 20803 20804 #~ msgid "Dirk Mueller" 20805 #~ msgstr "Dirk Mueller" 20806 20807 #~ msgid "Torben Weis" 20808 #~ msgstr "Torben Weis" 20809 20810 #~ msgid "Martin Jones" 20811 #~ msgstr "Martin Jones" 20812 20813 #~ msgid "Simon Hausmann" 20814 #~ msgstr "Simon Hausmann" 20815 20816 #~ msgid "Tobias Anton" 20817 #~ msgstr "Tobias Anton" 20818 20819 #~ msgid "View Do&cument Source" 20820 #~ msgstr "Документның чыганагын &карап чыгу" 20821 20822 #~ msgid "View Document Information" 20823 #~ msgstr "Документ турында мәгълүматны карап чыгу" 20824 20825 #~ msgid "Save &Background Image As..." 20826 #~ msgstr "Җирлек сурәтен &саклау..." 20827 20828 #~ msgid "SSL" 20829 #~ msgstr "SSL" 20830 20831 #~ msgid "Print Rendering Tree to STDOUT" 20832 #~ msgstr "Сурәтләү агачын STDOUT'ка чыгару" 20833 20834 #~ msgid "Print DOM Tree to STDOUT" 20835 #~ msgstr "DOM агачын STDOUT'ка чыгару" 20836 20837 #~ msgid "Print frame tree to STDOUT" 20838 #~ msgstr "Вывести дерево фреймов на STDOUT" 20839 20840 #~ msgid "Stop Animated Images" 20841 #~ msgstr "Рәсемнәр анимациясен туктату" 20842 20843 #~ msgid "Set &Encoding" 20844 #~ msgstr "&Кодлашу..." 20845 20846 #~ msgid "Use S&tylesheet" 20847 #~ msgstr "Стильләр җәдвәлен &куллану" 20848 20849 #~ msgid "Enlarge Font" 20850 #~ msgstr "Хәрефне зурайту" 20851 20852 #~ msgid "" 20853 #~ "<qt>Enlarge Font<br /><br />Make the font in this window bigger. Click " 20854 #~ "and hold down the mouse button for a menu with all available font sizes.</" 20855 #~ "qt>" 20856 #~ msgstr "" 20857 #~ "<qt>Увеличить шрифт<br /><br />Увеличить шрифт в этом окне. Нажмите и " 20858 #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта.</" 20859 #~ "qt>" 20860 20861 #~ msgid "Shrink Font" 20862 #~ msgstr "Хәрефне кечерәйтү" 20863 20864 #~ msgid "" 20865 #~ "<qt>Shrink Font<br /><br />Make the font in this window smaller. Click " 20866 #~ "and hold down the mouse button for a menu with all available font sizes.</" 20867 #~ "qt>" 20868 #~ msgstr "" 20869 #~ "<qt>Уменьшить шрифт<br /><br />Уменьшить шрифт в этом окне. Нажмите и " 20870 #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта.</" 20871 #~ "qt>" 20872 20873 #~ msgid "" 20874 #~ "<qt>Find text<br /><br />Shows a dialog that allows you to find text on " 20875 #~ "the displayed page.</qt>" 20876 #~ msgstr "" 20877 #~ "<qt>Найти текст<br /><br />Диалог поиска текста на текущей странице.</qt>" 20878 20879 #~ msgid "" 20880 #~ "<qt>Find next<br /><br />Find the next occurrence of the text that you " 20881 #~ "have found using the <b>Find Text</b> function.</qt>" 20882 #~ msgstr "" 20883 #~ "<qt>Найти далее<br /><br />Поиск следующего вхождения текста, указанного " 20884 #~ "в поле <b>Найти текст</b>.</qt>" 20885 20886 #~ msgid "" 20887 #~ "<qt>Find previous<br /><br />Find the previous occurrence of the text " 20888 #~ "that you have found using the <b>Find Text</b> function.</qt>" 20889 #~ msgstr "" 20890 #~ "<qt>Найти предыдущее<br /><br />Поиск предыдущего вхождения текста, " 20891 #~ "указанного в поле <b>Найти текст</b>.</qt>" 20892 20893 #~ msgid "Find Text as You Type" 20894 #~ msgstr "Җыеп бару белән текстны эзләү" 20895 20896 #~ msgid "" 20897 #~ "This shortcut shows the find bar, for finding text in the displayed page. " 20898 #~ "It cancels the effect of \"Find Links as You Type\", which sets the " 20899 #~ "\"Find links only\" option." 20900 #~ msgstr "" 20901 #~ "Эта комбинация клавиш вызывает панель для поиска текста на текущей " 20902 #~ "странице. Это отключит функцию поиска ссылок по набору." 20903 20904 #~ msgid "Find Links as You Type" 20905 #~ msgstr "Җыеп бару белән сылтамаларны эзләү" 20906 20907 #~ msgid "" 20908 #~ "This shortcut shows the find bar, and sets the option \"Find links only\"." 20909 #~ msgstr "" 20910 #~ "Эта комбинация клавиш вызывает панель для поиска ссылок на текущей " 20911 #~ "странице." 20912 20913 #~ msgid "" 20914 #~ "<qt>Print Frame<br /><br />Some pages have several frames. To print only " 20915 #~ "a single frame, click on it and then use this function.</qt>" 20916 #~ msgstr "" 20917 #~ "<qt>Печать фрейма<br /><br />Некоторые страницы могут содержать несколько " 20918 #~ "фреймов. Чтобы напечатать только один фрейм, нажмите на нем и используйте " 20919 #~ "эту функцию.</qt>" 20920 20921 #~ msgid "Toggle Caret Mode" 20922 #~ msgstr "Кертү/алыштыру режимын к&үчерү" 20923 20924 #~ msgid "The fake user-agent '%1' is in use." 20925 #~ msgstr "'%1' бпраузерның астынкы идентификаторы кулланыла." 20926 20927 #~ msgid "This web page contains coding errors." 20928 #~ msgstr "Бу веб-бит кодлаштыру хаталарын тәшкил итә." 20929 20930 #~ msgid "&Hide Errors" 20931 #~ msgstr "&Хаталарны яшерү" 20932 20933 #~ msgid "&Disable Error Reporting" 20934 #~ msgstr "&Хаталар турында хәбәрләрне тыю" 20935 20936 #~ msgid "<qt><b>Error</b>: %1: %2</qt>" 20937 #~ msgstr "<qt><b>Хата</b>: %1: %2</qt>" 20938 20939 #~ msgid "<qt><b>Error</b>: node %1: %2</qt>" 20940 #~ msgstr "<qt><b>Ошибка</b>: узел %1: %2</qt>" 20941 20942 #~ msgid "Display Images on Page" 20943 #~ msgstr "Биттә сурәтне чагылдыру" 20944 20945 #~ msgid "Error: %1 - %2" 20946 #~ msgstr "Хата: %1 - %2" 20947 20948 #~ msgid "The requested operation could not be completed" 20949 #~ msgstr "Чакырылган операция тәмамлана алмый" 20950 20951 #~ msgid "Technical Reason: " 20952 #~ msgstr "Техник сәбәп: " 20953 20954 #~ msgid "Details of the Request:" 20955 #~ msgstr "Сорауның төгәллекләре:" 20956 20957 #~ msgid "URL: %1" 20958 #~ msgstr "URL: %1" 20959 20960 #~ msgid "Protocol: %1" 20961 #~ msgstr "Беркетмә: %1" 20962 20963 #~ msgid "Additional Information: %1" 20964 #~ msgstr "Өстәмә мәгълүмат: %1" 20965 20966 #~ msgid "Description:" 20967 #~ msgstr "Тасвирлама:" 20968 20969 #~ msgid "Possible Causes:" 20970 #~ msgstr "Мөмкинле нәтиҗәләр:" 20971 20972 #~ msgid "Possible Solutions:" 20973 #~ msgstr "Мөмкинле карарлар:" 20974 20975 #~ msgid "Page loaded." 20976 #~ msgstr "Бит йөкләндерелгән." 20977 20978 #~ msgid "%1 Image of %2 loaded." 20979 #~ msgid_plural "%1 Images of %2 loaded." 20980 #~ msgstr[0] "Загружено изображений: %1 из %2" 20981 #~ msgstr[1] "Загружено изображений: %1 из %2" 20982 20983 #~ msgid "Automatic Detection" 20984 #~ msgstr "Автоматик билгеләү" 20985 20986 #~ msgid " (In new window)" 20987 #~ msgstr " (Яңа тәрәзәдә)" 20988 20989 #~ msgid "Symbolic Link" 20990 #~ msgstr "Символик сылтама" 20991 20992 #~ msgid "%1 (Link)" 20993 #~ msgstr "%1 (Сылтама)" 20994 20995 #~ msgid "%2 (%1 byte)" 20996 #~ msgid_plural "%2 (%1 bytes)" 20997 #~ msgstr[0] "%2 (%1 байт)" 20998 #~ msgstr[1] "%2 (%1 байта)" 20999 21000 #~ msgid "%2 (%1 K)" 21001 #~ msgstr "%2 (%1 К)" 21002 21003 #~ msgid " (In other frame)" 21004 #~ msgstr " (Башка фреймда)" 21005 21006 #~ msgid "Email to: " 21007 #~ msgstr "Хат язу: " 21008 21009 #~ msgid " - Subject: " 21010 #~ msgstr " - Тема: " 21011 21012 #~ msgid " - CC: " 21013 #~ msgstr " - Күчермә: " 21014 21015 #~ msgid " - BCC: " 21016 #~ msgstr " - BCC: " 21017 21018 #~ msgid "" 21019 #~ "<qt>This untrusted page links to<br /><b>%1</b>.<br />Do you want to " 21020 #~ "follow the link?</qt>" 21021 #~ msgstr "" 21022 #~ "<qt>Данная непроверенная страница содержит ссылку <br /><b>%1</b>.<br /" 21023 #~ ">Перейти по ссылке?</qt>" 21024 21025 #~ msgid "Follow" 21026 #~ msgstr "Күчү" 21027 21028 #~ msgid "Frame Information" 21029 #~ msgstr "Фрейм турфндагы мәгълүмат" 21030 21031 #~ msgid " <a href=\"%1\">[Properties]</a>" 21032 #~ msgstr " <a href=\"%1\">[Сыйфатлар]</a>" 21033 21034 #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" 21035 #~ msgid "Quirks" 21036 #~ msgstr "Туры килү ысулы" 21037 21038 #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" 21039 #~ msgid "Almost standards" 21040 #~ msgstr "Стандартларга туры килә диярлек" 21041 21042 #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" 21043 #~ msgid "Strict" 21044 #~ msgstr "Стандартларга катгый рәвештә туры килү" 21045 21046 #~ msgid "Save Background Image As" 21047 #~ msgstr "Җирлек сурәтен саклау..." 21048 21049 #~ msgid "The peer SSL certificate chain appears to be corrupt." 21050 #~ msgstr "Ихтимал, SSL таныклыкларның чылбыры ватык." 21051 21052 #~ msgid "Save Frame As" 21053 #~ msgstr "Фреймны саклау..." 21054 21055 #~ msgid "&Find in Frame..." 21056 #~ msgstr "&Фреймда эзләү..." 21057 21058 #~ msgid "" 21059 #~ "Warning: This is a secure form but it is attempting to send your data " 21060 #~ "back unencrypted.\n" 21061 #~ "A third party may be able to intercept and view this information.\n" 21062 #~ "Are you sure you wish to continue?" 21063 #~ msgstr "" 21064 #~ "Игътибар: Бу фраза саклангычта, әмма ул сезнең мәгълүматларыгызны кире " 21065 #~ "шифрсыз күренешендәкайтармакчы була.\n" 21066 #~ "Кырыйдан кем дә булса бу мәгълүматны алып карый ала.\n" 21067 #~ "Дәвам иттерергәме?" 21068 21069 #~ msgid "Network Transmission" 21070 #~ msgstr "Челтәрдән тапшыру" 21071 21072 #~ msgid "&Send Unencrypted" 21073 #~ msgstr "&Шифрлаусыз тапшыру" 21074 21075 #~ msgid "" 21076 #~ "Warning: Your data is about to be transmitted across the network " 21077 #~ "unencrypted.\n" 21078 #~ "Are you sure you wish to continue?" 21079 #~ msgstr "" 21080 #~ "Игътибар: Мәгълүматларыгыз челтәр буенча саклангычсыз тапшырылачак.\n" 21081 #~ "Дәвам иттерергәме?" 21082 21083 #~ msgid "" 21084 #~ "This site is attempting to submit form data via email.\n" 21085 #~ "Do you want to continue?" 21086 #~ msgstr "" 21087 #~ "Форманың мәгълүматлар сайтка электрон почта тапшырып каралган.\n" 21088 #~ "Чыннан да дәвам иттерергәме?" 21089 21090 #~ msgid "&Send Email" 21091 #~ msgstr "&Е-mail тапшыру" 21092 21093 #~ msgid "" 21094 #~ "<qt>The form will be submitted to <br /><b>%1</b><br />on your local " 21095 #~ "filesystem.<br />Do you want to submit the form?</qt>" 21096 #~ msgstr "" 21097 #~ "<qt>Форма будет передана файлу <br /><b>%1</b><br /> на локальной " 21098 #~ "файловой системе.<br />Отправить данные формы?</qt>" 21099 21100 #~ msgid "" 21101 #~ "This site attempted to attach a file from your computer in the form " 21102 #~ "submission. The attachment was removed for your protection." 21103 #~ msgstr "" 21104 #~ "Сайтка тапшыру өчен форма мәгълүматларына локаль файл кыстырып каралган. " 21105 #~ "Сезнең иминлегегез өчен кушылган файл сөртелде." 21106 21107 #~ msgid "(%1/s)" 21108 #~ msgstr "(%1/с)" 21109 21110 #~ msgid "Security Warning" 21111 #~ msgstr "Иминлек кисәтүе" 21112 21113 #~ msgid "<qt>Access by untrusted page to<br /><b>%1</b><br /> denied.</qt>" 21114 #~ msgstr "" 21115 #~ "<qt>Доступ с ненадёжной страницы на <br /><b>%1</b><br /> запрещён.</qt>" 21116 21117 #~ msgid "The wallet '%1' is open and being used for form data and passwords." 21118 #~ msgstr "" 21119 #~ "'%1' куенчык ачык һәм мәгълүматларны һәм парольләрне кертү өчен кулланыла." 21120 21121 #~ msgid "&Close Wallet" 21122 #~ msgstr "&Куенчыкны ябу" 21123 21124 #~ msgid "&Allow storing passwords for this site" 21125 #~ msgstr "&Позволить сохранять пароли для этого сайта" 21126 21127 #~ msgid "Remove password for form %1" 21128 #~ msgstr "%1 рәвешенең серсүзен бетерү" 21129 21130 #~ msgid "JavaScript &Debugger" 21131 #~ msgstr "&JavaScript төзәткече" 21132 21133 #~ msgid "This page was prevented from opening a new window via JavaScript." 21134 #~ msgstr "Сайт Javascript ярдәмендә яңа тәрәзә ачырга тырыша." 21135 21136 #~ msgid "Popup Window Blocked" 21137 #~ msgstr "Йөзеп чыга торган тәрәзә тыелды" 21138 21139 #~ msgid "" 21140 #~ "This page has attempted to open a popup window but was blocked.\n" 21141 #~ "You can click on this icon in the status bar to control this behavior\n" 21142 #~ "or to open the popup." 21143 #~ msgstr "" 21144 #~ "Йөзеп чыга торган тәрәзә тыеп куелган, һәм аны тәрәзә ачарга тырышты.\n" 21145 #~ "Бу функция белән идарә итеп була, моның өчен торыш юлына чиертергә " 21146 #~ "кирәк,\n" 21147 #~ "һәм шуның белән йөзеп чыга торган тәрәзәгә рөхсәт бирелә яки тыела." 21148 21149 #~ msgid "&Show Blocked Popup Window" 21150 #~ msgid_plural "&Show %1 Blocked Popup Windows" 21151 #~ msgstr[0] "По&казать %1 заблокированное всплывающее окно" 21152 #~ msgstr[1] "По&казать %1 заблокированных всплывающих окна" 21153 21154 #~ msgid "Show Blocked Window Passive Popup &Notification" 21155 #~ msgstr "&Тыелып куелган тәрәзәләр турында хәбәрләштерү" 21156 21157 #~ msgid "&Configure JavaScript New Window Policies..." 21158 #~ msgstr "&JavaScript'ның яңа тәрәзәләре өчен кагыйдәләрне көйләү..." 21159 21160 #~ msgid "" 21161 #~ "<qt><p><strong>'Print images'</strong></p><p>If this checkbox is enabled, " 21162 #~ "images contained in the HTML page will be printed. Printing may take " 21163 #~ "longer and use more ink or toner.</p><p>If this checkbox is disabled, " 21164 #~ "only the text of the HTML page will be printed, without the included " 21165 #~ "images. Printing will be faster and use less ink or toner.</p> </qt>" 21166 #~ msgstr "" 21167 #~ "<qt><p><strong>'Сурәтләрне бастыру'</strong></p><p>Бу әләмчек эшләсә, веб-" 21168 #~ "биттәге сурәтләр текст белән бергәбастырылачак. Әмма бу очракта бастыру " 21169 #~ "күләме зуррак була һәмкүбрәк кара яки тонер сорый.</p><p>Бу әләмчек " 21170 #~ "эшләмәсә, веб-битләр генә быстырылачак. Бу очрактабастыру тизрәк бетә дә " 21171 #~ "һәм сез кара яки тонерны әзрзк бетерәсез.</p> </qt>" 21172 21173 #~ msgid "" 21174 #~ "<qt><p><strong>'Print header'</strong></p><p>If this checkbox is enabled, " 21175 #~ "the printout of the HTML document will contain a header line at the top " 21176 #~ "of each page. This header contains the current date, the location URL of " 21177 #~ "the printed page and the page number.</p><p>If this checkbox is disabled, " 21178 #~ "the printout of the HTML document will not contain such a header line.</" 21179 #~ "p> </qt>" 21180 #~ msgstr "" 21181 #~ "<qt><p><strong>'Баш исемне бастыру'</strong></p><p>Әгәр бу параметр " 21182 #~ "эшләсә, бастырылган һәрбер биттәHTML форматында баш исеме була, ә шулай " 21183 #~ "ук агымдагы дата, шул битнең (URL)адресы һәм номеры булачак.</p></qt>" 21184 21185 #~ msgid "" 21186 #~ "<qt><p><strong>'Printerfriendly mode'</strong></p><p>If this checkbox is " 21187 #~ "enabled, the printout of the HTML document will be black and white only, " 21188 #~ "and all colored background will be converted into white. Printout will be " 21189 #~ "faster and use less ink or toner.</p><p>If this checkbox is disabled, the " 21190 #~ "printout of the HTML document will happen in the original color settings " 21191 #~ "as you see in your application. This may result in areas of full-page " 21192 #~ "color (or grayscale, if you use a black+white printer). Printout will " 21193 #~ "possibly happen more slowly and will probably use more toner or ink.</p> " 21194 #~ "</qt>" 21195 #~ msgstr "" 21196 #~ "<qt><p><strong>Экономный режим</strong></p><p>Если этот параметр включён, " 21197 #~ "распечатка документа в формате HTML будет только черно-белой, любой " 21198 #~ "цветной фон будет преобразован в белый. Печать будет быстрее и будет " 21199 #~ "использоваться меньше чернил или тонера.</p><p>Если этот параметр " 21200 #~ "выключен, распечатка документа в формате HTML будет иметь такие же цвета, " 21201 #~ "как вы видите в приложении. Результатом может быть полностью цветная " 21202 #~ "страница (или с градациями серого, если принтер черно-белый). Печать " 21203 #~ "будет идти медленнее и использовать намного больше тонера или чернил.</p> " 21204 #~ "</qt>" 21205 21206 #~ msgid "HTML Settings" 21207 #~ msgstr "HTML'ны көйләү" 21208 21209 #~ msgid "Printer friendly mode (black text, no background)" 21210 #~ msgstr "Принтер режимы (кара текст, җирлексез)" 21211 21212 #~ msgid "Print images" 21213 #~ msgstr "Сурәтләрне бастыру" 21214 21215 #~ msgid "Print header" 21216 #~ msgstr "Баш исемен бастыру" 21217 21218 #~ msgid "Filter error" 21219 #~ msgstr "Сөзгечнең хатасы" 21220 21221 #~ msgid "Inactive" 21222 #~ msgstr "Актив булмаган тәрәзә" 21223 21224 #~ msgid "%1 (%2 - %3x%4 Pixels)" 21225 #~ msgstr "%1 (%2 - %3x%4 пиксел)" 21226 21227 #~ msgid "%1 - %2x%3 Pixels" 21228 #~ msgstr "%1 - %2x%3 пиксел" 21229 21230 #~ msgid "%1 (%2x%3 Pixels)" 21231 #~ msgstr "%1 (%2x%3 пиксел)" 21232 21233 #~ msgid "Image - %1x%2 Pixels" 21234 #~ msgstr "Сурәт - %1x%2 пикселов" 21235 21236 #~ msgid "Done." 21237 #~ msgstr "Әзер." 21238 21239 #~ msgid "Access Keys activated" 21240 #~ msgstr "Рөхсәт итү ачкычларын куллану эшли" 21241 21242 #~ msgid "JavaScript Errors" 21243 #~ msgstr "JavaScript хаталары" 21244 21245 #~ msgid "" 21246 #~ "This dialog provides you with notification and details of scripting " 21247 #~ "errors that occur on web pages. In many cases it is due to an error in " 21248 #~ "the web site as designed by its author. In other cases it is the result " 21249 #~ "of a programming error in Konqueror. If you suspect the former, please " 21250 #~ "contact the webmaster of the site in question. Conversely if you suspect " 21251 #~ "an error in Konqueror, please file a bug report at http://bugs.kde.org/. " 21252 #~ "A test case which illustrates the problem will be appreciated." 21253 #~ msgstr "" 21254 #~ "Бу диалогта веб битләрдәге скрипт хаталары күрсәтелгән. Еш очракта алар " 21255 #~ "веб битләрендә башкарган чактагы хаталар белән бәйле, ләкин кайвакыт " 21256 #~ "Konqueror кушымтаның хаталары килеп чыгарга мөмкин. Беренче очракта " 21257 #~ "сайтның веб остасына хәбәр итегез, ә әгәр бу Konqueror'дагы хата булып " 21258 #~ "чыкса, аның турында http:// bugs.kde.org/ адресы аша хәбәр итегез. Хатаны " 21259 #~ "сурәтләүче мисал хатаны чишү мәсьәләсен бик җиңеләйтә." 21260 21261 #~ msgid "KMultiPart" 21262 #~ msgstr "KMultiPart" 21263 21264 #~ msgid "Embeddable component for multipart/mixed" 21265 #~ msgstr "multipart/mixed өчен кертелә торган компонент" 21266 21267 #~ msgid "No handler found for %1." 21268 #~ msgstr "%1 өчен эшкәрткеч табылмады." 21269 21270 #~ msgid "Play" 21271 #~ msgstr "Уйнату" 21272 21273 #~ msgid "New Web Shortcut" 21274 #~ msgstr "Новое сокращение Веб" 21275 21276 #~ msgid "%1 is already assigned to %2" 21277 #~ msgstr "%1 уже назначено для %2" 21278 21279 #~ msgid "Search &provider name:" 21280 #~ msgstr "&Название поисковой системы:" 21281 21282 #~ msgid "New search provider" 21283 #~ msgstr "Яңа эзләү системасы" 21284 21285 #~ msgid "UR&I shortcuts:" 21286 #~ msgstr "&Кыскартмалар:" 21287 21288 #~ msgid "Create Web Shortcut" 21289 #~ msgstr "Создать сокращение Веб" 21290 21291 #~ msgid "Directory containing tests, basedir and output directories." 21292 #~ msgstr "" 21293 #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " 21294 #~ "выводимых данных." 21295 21296 #~ msgid "Regenerate baseline (instead of checking)" 21297 #~ msgstr "Башта булганын торгызу (тикшерү урынына)" 21298 21299 #~ msgid "Do not show the window while running tests" 21300 #~ msgstr "Тикшерүләр барганда тәрәзәне качыру" 21301 21302 #~ msgid "Only run a single test. Multiple options allowed." 21303 #~ msgstr "Бер генә тикшерүне башкару. Берничә көйләүне күрсәтергә ярый." 21304 21305 #~ msgid "Only run .js tests" 21306 #~ msgstr ".js тикшерүләрне генә башкару" 21307 21308 #~ msgid "Only run .html tests" 21309 #~ msgstr ".html тикшерүләрне генә башкару" 21310 21311 #~ msgid "Do not use Xvfb" 21312 #~ msgstr "Xvfb белән эш итмәү" 21313 21314 #~ msgid "Put output in <directory> instead of <base_dir>/output" 21315 #~ msgstr "" 21316 #~ "Сохранить вывод в <каталог> вместо файла <базовый_каталог>/" 21317 #~ "output" 21318 21319 #~ msgid "" 21320 #~ "Use <directory> as reference instead of <base_dir>/baseline" 21321 #~ msgstr "" 21322 #~ "Использовать <каталог> в качестве каталога эталонных результатов " 21323 #~ "вместо <базовый_каталог>/baseline" 21324 21325 #~ msgid "" 21326 #~ "Directory containing tests, basedir and output directories. Only regarded " 21327 #~ "if -b is not specified." 21328 #~ msgstr "" 21329 #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " 21330 #~ "выводимых данных. Используется, если не указан параметр -b." 21331 21332 #~ msgid "" 21333 #~ "Relative path to testcase, or directory of testcases to be run " 21334 #~ "(equivalent to -t)." 21335 #~ msgstr "Относительный путь к тестам или каталог с тестами (эквивалент -t)." 21336 21337 #~ msgid "TestRegression" 21338 #~ msgstr "TestRegression" 21339 21340 #~ msgid "Regression tester for khtml" 21341 #~ msgstr "khtml ялгышларын тикшерү" 21342 21343 #~ msgid "KHTML Regression Testing Utility" 21344 #~ msgstr "KHTML ялгышларын тикшерүче кушымта" 21345 21346 #~ msgid "0" 21347 #~ msgstr "0" 21348 21349 #~ msgid "Regression testing output" 21350 #~ msgstr "Регрессияләргә тикшерү кушымтаның чыгышы" 21351 21352 #~ msgid "Pause/Continue regression testing process" 21353 #~ msgstr "Регрессияләргә тикшерү кушымтасын туктату/җибәрү" 21354 21355 #~ msgid "" 21356 #~ "You may select a file where the log content is stored, before the " 21357 #~ "regression testing is started." 21358 #~ msgstr "Тикшерүне башлау алдыннан сез протоколны файлга саклый аласыз." 21359 21360 #~ msgid "Regression Testing Status" 21361 #~ msgstr "Тикшерүнең хәле" 21362 21363 #~ msgid "View HTML Output" 21364 #~ msgstr "Чыгышны HTML форматында карау" 21365 21366 #~ msgid "Tests" 21367 #~ msgstr "Тикшерүләр" 21368 21369 #~ msgid "Only Run JS Tests" 21370 #~ msgstr "JS тикшерүләрен генә җибәрү" 21371 21372 #~ msgid "Only Run HTML Tests" 21373 #~ msgstr "HTML тикшерүләрен генә җибәрү" 21374 21375 #~ msgid "Do Not Suppress Debug Output" 21376 #~ msgstr "Төзәткечнең чыгышын күрсәтү" 21377 21378 #~ msgid "Run Tests..." 21379 #~ msgstr "Тикшерүне җибәрү..." 21380 21381 #~ msgid "Run Single Test..." 21382 #~ msgstr "Аерым тикшерүне җибәрү..." 21383 21384 #~ msgid "Specify tests Directory..." 21385 #~ msgstr "Тикшерү каталогын сайлау..." 21386 21387 #~ msgid "Specify khtml Directory..." 21388 #~ msgstr "khtml каталогын сайлау..." 21389 21390 #~ msgid "Specify Output Directory..." 21391 #~ msgstr "Чыгыш каталогын сайлау..." 21392 21393 #~ msgid "TestRegressionGui" 21394 #~ msgstr "TestRegressionGui" 21395 21396 #~ msgid "GUI for the khtml regression tester" 21397 #~ msgstr "Графический интерфейс для поиска регрессии в khtml" 21398 21399 #~ msgid "Available Tests: 0" 21400 #~ msgstr "Булган тикшерүләр саны: 0" 21401 21402 #~ msgid "Please choose a valid 'khtmltests/regression/' directory." 21403 #~ msgstr "Укажите правильный каталог «khtmltests/regression/»." 21404 21405 #~ msgid "Please choose a valid 'khtml/' build directory." 21406 #~ msgstr "Укажите правильный каталог «khtml/»." 21407 21408 #~ msgid "Available Tests: %1 (ignored: %2)" 21409 #~ msgstr "Доступных тестов: %1 (игнорировано: %2)" 21410 21411 #~ msgid "Cannot find testregression executable." 21412 #~ msgstr "testregression кушымтасын табып булмады." 21413 21414 #~ msgid "Run test..." 21415 #~ msgstr "Тикшерүне җибәрү..." 21416 21417 #~ msgid "Add to ignores..." 21418 #~ msgstr "Тикшерүне төшереп калдыру..." 21419 21420 #~ msgid "Remove from ignores..." 21421 #~ msgstr "Тикшерүне төшереп калганнардан бетерү..." 21422 21423 #~ msgid "URL to open" 21424 #~ msgstr "Сылтаманы ачу" 21425 21426 #~ msgid "Testkhtml" 21427 #~ msgstr "Testkhtml" 21428 21429 #~ msgid "a basic web browser using the KHTML library" 21430 #~ msgstr "KHTML коралы ярдәмендә ясалган гади веб караучысы" 21431 21432 #~ msgid "Find &links only" 21433 #~ msgstr "Сылтамаларны гына эзләү" 21434 21435 #~ msgid "Not found" 21436 #~ msgstr "Табылмады" 21437 21438 #~ msgid "No more matches for this search direction." 21439 #~ msgstr "Не найдено вхождений в выбранном направлении" 21440 21441 #~ msgid "F&ind:" 21442 #~ msgstr "Э&зләү" 21443 21444 #~ msgid "&Next" 21445 #~ msgstr "&Алга бару" 21446 21447 #~ msgid "Opt&ions" 21448 #~ msgstr "Пар&аметрлар" 21449 21450 #~ msgid "Do you want to store this password?" 21451 #~ msgstr "Серсүзне истә калдырыргамы?" 21452 21453 #~ msgid "Do you want to store this password for %1?" 21454 #~ msgstr "%1 серсүзен сакларгамы?" 21455 21456 #~ msgid "&Store" 21457 #~ msgstr "&Саклау" 21458 21459 #~ msgid "Ne&ver store for this site" 21460 #~ msgstr "Бу сәхифәдә саклауны сүндерү" 21461 21462 #~ msgid "Do ¬ store this time" 21463 #~ msgstr "Хәзер сакламау" 21464 21465 #~ msgid "Basic Page Style" 21466 #~ msgstr "Битнең төп стиле" 21467 21468 #~ msgid "the document is not in the correct file format" 21469 #~ msgstr "документ коррект булмаган мәгълүматларны тәшкил итә" 21470 21471 #~ msgid "fatal parsing error: %1 in line %2, column %3" 21472 #~ msgstr "эшкәртүдә тәнкыйть хата: %1 %2 юлында, позиция %3" 21473 21474 #~ msgid "XML parsing error" 21475 #~ msgstr "XML файлын уку вакытында хата килеп чыкты" 21476 21477 #~ msgid "" 21478 #~ "Unable to start new process.\n" 21479 #~ "The system may have reached the maximum number of open files possible or " 21480 #~ "the maximum number of open files that you are allowed to use has been " 21481 #~ "reached." 21482 #~ msgstr "" 21483 #~ "Процессны җибәреп булмый.\n" 21484 #~ "Бәлки, системадагы мөмкин булган ачык файллар саны артты якикулланучы " 21485 #~ "өчен." 21486 21487 #~ msgid "" 21488 #~ "Unable to create new process.\n" 21489 #~ "The system may have reached the maximum number of processes possible or " 21490 #~ "the maximum number of processes that you are allowed to use has been " 21491 #~ "reached." 21492 #~ msgstr "" 21493 #~ "Процессны җибәреп булмый.\n" 21494 #~ "Бәлки, системадагы мөмкин булган ачык файллар саны артты якикулланучы " 21495 #~ "өчен." 21496 21497 #~ msgid "Could not find '%1' executable." 21498 #~ msgstr "«%1» кушымтасын табып булмады." 21499 21500 #~ msgid "" 21501 #~ "Could not open library '%1'.\n" 21502 #~ "%2" 21503 #~ msgstr "" 21504 #~ "«%1» китапханәсен ачып булмады.\n" 21505 #~ "%2" 21506 21507 #~ msgid "" 21508 #~ "Could not find 'kdemain' in '%1'.\n" 21509 #~ "%2" 21510 #~ msgstr "" 21511 #~ "'%1'да kdemain'ны табып булмады.\n" 21512 #~ "%2" 21513 21514 #, fuzzy 21515 #~| msgid "KDEInit could not launch '%1'." 21516 #~ msgid "KDEInit could not launch '%1'" 21517 #~ msgstr "KDEInit '%1 кушымтасын җибәрә алмый." 21518 21519 #~ msgid "Could not find service '%1'." 21520 #~ msgstr "'%1' хезмәтен табып булмый." 21521 21522 #~ msgid "Service '%1' must be executable to run." 21523 #~ msgstr "Служба «%1» должна быть сделана выполняемой для запуска." 21524 21525 #~ msgid "Service '%1' is malformatted." 21526 #~ msgstr "'%1' хезмәте дөрес булмаган форматка ия." 21527 21528 #~ msgid "Launching %1" 21529 #~ msgstr "%1 җибәрелә" 21530 21531 #~ msgid "Error loading '%1'.\n" 21532 #~ msgstr "'%1' йөкләндерү хатасы:\n" 21533 21534 #~ msgid "" 21535 #~ "klauncher: This program is not supposed to be started manually.\n" 21536 #~ "klauncher: It is started automatically by kdeinit4.\n" 21537 #~ msgstr "" 21538 #~ "klauncher: программа не должна запускаться вручную.\n" 21539 #~ "klauncher: запускается автоматически из kdeinit4.\n" 21540 21541 #~ msgid "Evaluation error" 21542 #~ msgstr "Исәпләү хатасы" 21543 21544 #~ msgid "Range error" 21545 #~ msgstr "Чик хатасы" 21546 21547 #~ msgid "Reference error" 21548 #~ msgstr "Сылтама хатасы" 21549 21550 #~ msgid "Syntax error" 21551 #~ msgstr "Синтаксик хата" 21552 21553 #~ msgid "Type error" 21554 #~ msgstr "Төр хатасы" 21555 21556 #~ msgid "URI error" 21557 #~ msgstr "URI хатасы" 21558 21559 #~ msgid "JS Calculator" 21560 #~ msgstr "JS калькуляторы" 21561 21562 #~ msgctxt "addition" 21563 #~ msgid "+" 21564 #~ msgstr "+" 21565 21566 #~ msgctxt "evaluation" 21567 #~ msgid "=" 21568 #~ msgstr "=" 21569 21570 #~ msgid "CL" 21571 #~ msgstr "CL" 21572 21573 #~ msgid "7" 21574 #~ msgstr "7" 21575 21576 #~ msgid "8" 21577 #~ msgstr "8" 21578 21579 #~ msgid "MainWindow" 21580 #~ msgstr "MainWindow" 21581 21582 #~ msgid "<h1>KJSEmbed Documentation Viewer</h1>" 21583 #~ msgstr "<h1>KJSEmbed документларын карау</h1>" 21584 21585 #~ msgid "Execute" 21586 #~ msgstr "Башкару" 21587 21588 #~ msgid "Open Script" 21589 #~ msgstr "Скриптны ачу" 21590 21591 #~ msgid "Open a script..." 21592 #~ msgstr "Скриптны ачу..." 21593 21594 #~ msgid "Ctrl+O" 21595 #~ msgstr "Ctrl+O" 21596 21597 #~ msgid "Close Script" 21598 #~ msgstr "Скриптны ябу" 21599 21600 #~ msgid "Close script..." 21601 #~ msgstr "Скриптны ябу..." 21602 21603 #~ msgid "Quit" 21604 #~ msgstr "Чыгу" 21605 21606 #~ msgid "Quit application..." 21607 #~ msgstr "Кушымтадан чыгу..." 21608 21609 #~ msgid "Run script..." 21610 #~ msgstr "Скриптны җибәрү..." 21611 21612 #~ msgid "Run To..." 21613 #~ msgstr "Бу урынга кадәр башкару..." 21614 21615 #~ msgid "Run to breakpoint..." 21616 #~ msgstr "Туктау ноктасына кадәр башкару..." 21617 21618 #~ msgid "Step to next line..." 21619 #~ msgstr "Алдагы юлга кадәр башкару..." 21620 21621 #~ msgid "Step execution..." 21622 #~ msgstr "Башкаруны туктату..." 21623 21624 #~ msgid "KJSCmd" 21625 #~ msgstr "KJSCmd" 21626 21627 #~ msgid "Utility for running KJSEmbed scripts \n" 21628 #~ msgstr "Программа для запуска скриптов KJSEmbed \n" 21629 21630 #~ msgid "(C) 2005-2006 The KJSEmbed Authors" 21631 #~ msgstr "© Разработчики KJSEmbed, 2005-2006" 21632 21633 #~ msgid "Execute script without gui support" 21634 #~ msgstr "Выполнить скрипт без графического интерфейса" 21635 21636 #~ msgid "start interactive kjs interpreter" 21637 #~ msgstr "запустить интерактивный интерпретатор kjs" 21638 21639 #~ msgid "start without KDE KApplication support." 21640 #~ msgstr "запустить без поддержки KDE KApplication." 21641 21642 #~ msgid "Script to execute" 21643 #~ msgstr "Имя выполняемого скрипта" 21644 21645 #~ msgid "Error encountered while processing include '%1' line %2: %3" 21646 #~ msgstr "Ошибка при выполнении include «%1» на строке %2: %3" 21647 21648 #~ msgid "include only takes 1 argument, not %1." 21649 #~ msgstr "директива include требует один аргумент, а не %1." 21650 21651 #~ msgid "File %1 not found." 21652 #~ msgstr "%1 файлы табылмады." 21653 21654 #~ msgid "library only takes 1 argument, not %1." 21655 #~ msgstr "библиотека требует один аргумент, а не %1." 21656 21657 #~ msgid "Alert" 21658 #~ msgstr "Тревога" 21659 21660 #~ msgid "Confirm" 21661 #~ msgstr "Раслау" 21662 21663 #~ msgid "Bad event handler: Object %1 Identifier %2 Method %3 Type: %4." 21664 #~ msgstr "" 21665 #~ "Неверный обработчик событий: объект %1, идентификатор %2, метод %3, тип " 21666 #~ "%4." 21667 21668 #~ msgid "Exception calling '%1' function from %2:%3:%4" 21669 #~ msgstr "Возникло исключение при вызове функции «%1» из %2:%3:%4" 21670 21671 #~ msgid "Could not open file '%1'" 21672 #~ msgstr "Не удалось открыть файл «%1»" 21673 21674 #~ msgid "Could not create temporary file." 21675 #~ msgstr "Не удалось создать временный файл." 21676 21677 #~ msgid "%1 is not a function and cannot be called." 21678 #~ msgstr "%1 не является функцией и не может быть вызвано." 21679 21680 #~ msgid "%1 is not an Object type" 21681 #~ msgstr "%1 не является объектом" 21682 21683 #~ msgid "Action takes 2 args." 21684 #~ msgstr "Действие требует 2 аргумента." 21685 21686 #~ msgid "ActionGroup takes 2 args." 21687 #~ msgstr "ActionGroup требует 2 аргумента." 21688 21689 #~ msgid "Must supply a valid parent." 21690 #~ msgstr "Необходимо указать правильный родительский объект." 21691 21692 #~ msgid "There was an error reading the file '%1'" 21693 #~ msgstr "Ошибка чтения из файла «%1»" 21694 21695 #~ msgid "Could not read file '%1'" 21696 #~ msgstr "Не удалось открыть файл «%1»" 21697 21698 #~ msgid "Must supply a filename." 21699 #~ msgstr "Необходимо указать имя файла." 21700 21701 #~ msgid "'%1' is not a valid QLayout." 21702 #~ msgstr "«%1» не является правильным объектом QLayout." 21703 21704 #~ msgid "Must supply a layout name." 21705 #~ msgstr "Необходимо указать имя компоновки." 21706 21707 #~ msgid "Wrong object type." 21708 #~ msgstr "Неверное имя объекта." 21709 21710 #~ msgid "First argument must be a QObject." 21711 #~ msgstr "Первый аргумент должен быть объектом QObject." 21712 21713 #~ msgid "Incorrect number of arguments." 21714 #~ msgstr "Неверное количество аргументов." 21715 21716 #~ msgid "The slot asked for %1 argument" 21717 #~ msgid_plural "The slot asked for %1 arguments" 21718 #~ msgstr[0] "Слот требует %1 аргумент" 21719 #~ msgstr[1] "Слот требует %1 аргумента" 21720 21721 #~ msgid "but there is only %1 available" 21722 #~ msgid_plural "but there are only %1 available" 21723 #~ msgstr[0] "но есть только %1 аргумент" 21724 #~ msgstr[1] "но есть только %1 аргумента" 21725 21726 #~ msgctxt "" 21727 #~ "%1 is 'the slot asked for foo arguments', %2 is 'but there are only bar " 21728 #~ "available'" 21729 #~ msgid "%1, %2." 21730 #~ msgstr "%1, %2." 21731 21732 #~ msgid "Failure to cast to %1 value from Type %2 (%3)" 21733 #~ msgstr "Не удалось преобразовать значение от типа %2 к типу %1 (%3)" 21734 21735 #~ msgid "No such method '%1'." 21736 #~ msgstr "Нет метода «%1»." 21737 21738 #~ msgid "Call to method '%1' failed, unable to get argument %2: %3" 21739 #~ msgstr "Ошибка вызова метода «%1»: не удалось получить аргумент %2: %3" 21740 21741 #~ msgid "Call to '%1' failed." 21742 #~ msgstr "Ошибка вызова «%1»." 21743 21744 #~ msgid "Could not construct value" 21745 #~ msgstr "Не удалось запустить конструктор значения" 21746 21747 #~ msgid "Not enough arguments." 21748 #~ msgstr "Недостаточно аргументов." 21749 21750 #~ msgid "Failed to create ActionGroup." 21751 #~ msgstr "Не удалось создать ActionGroup." 21752 21753 #~ msgid "No classname specified" 21754 #~ msgstr "Не указано имя класса" 21755 21756 #~ msgid "Failed to create Layout." 21757 #~ msgstr "Не удалось создать Layout." 21758 21759 #~ msgid "No classname specified." 21760 #~ msgstr "Имя класса не указано." 21761 21762 #~ msgid "Failed to create Widget." 21763 #~ msgstr "Не удалось создать Widget." 21764 21765 #~ msgid "Could not open file '%1': %2" 21766 #~ msgstr "Не удалось открыть файл «%1»: %2" 21767 21768 #~ msgid "Failed to load file '%1'" 21769 #~ msgstr "Ошибка открытия файла «%1»" 21770 21771 #~ msgid "'%1' is not a valid QWidget." 21772 #~ msgstr "«%1» не является правильным объектом QWidget." 21773 21774 #~ msgid "Must supply a widget name." 21775 #~ msgstr "Необходимо указать имя виджета." 21776 21777 #~ msgid "Bad slot handler: Object %1 Identifier %2 Method %3 Signature: %4." 21778 #~ msgstr "" 21779 #~ "Неверный обработчик слота: объект %1, идентификатор %2, метод %3, " 21780 #~ "сигнатура %4." 21781 21782 #~ msgid "Exception calling '%1' slot from %2:%3:%4" 21783 #~ msgstr "Возникло исключение при вызове слота «%1» из %2:%3:%4" 21784 21785 #~ msgid "loading %1" 21786 #~ msgstr "Загрузка %1" 21787 21788 #~ msgctxt "describes the feed of the latest posted entries" 21789 #~ msgid "Latest" 21790 #~ msgstr "Соңгылар" 21791 21792 #~ msgid "Highest Rated" 21793 #~ msgstr "Иң югары рейтинг" 21794 21795 #~ msgid "Most Downloads" 21796 #~ msgstr "Иң танылган" 21797 21798 #~ msgid "" 21799 #~ "<qt>Cannot start <i>gpg</i> and retrieve the available keys. Make sure " 21800 #~ "that <i>gpg</i> is installed, otherwise verification of downloaded " 21801 #~ "resources will not be possible.</qt>" 21802 #~ msgstr "" 21803 #~ "<qt>Җибәреп булмый <i>gpg</i> һәм бөтен рөхсәт ителгән ачкычларны табып " 21804 #~ "булмый. Ипләп карагыз, <i>gpg</i> программа чыннан да дөрес " 21805 #~ "урнаштырылганмы, чөнки йөкләндерелгән ресурсларның верификациясебулдырыла " 21806 #~ "алмый.</qt>" 21807 21808 #~ msgid "" 21809 #~ "<qt>Enter passphrase for key <b>0x%1</b>, belonging to<br /><i>%2<" 21810 #~ "%3></i><br />:</qt>" 21811 #~ msgstr "" 21812 #~ "<qt>Введите ключевую фразу для ключа <b>0x%1</b>, принадлежащего<br /><i>" 21813 #~ "%2<%3></i><br />:</qt>" 21814 21815 #~ msgid "" 21816 #~ "<qt>Cannot start <i>gpg</i> and check the validity of the file. Make sure " 21817 #~ "that <i>gpg</i> is installed, otherwise verification of downloaded " 21818 #~ "resources will not be possible.</qt>" 21819 #~ msgstr "" 21820 #~ "<qt><i>gpg</i> җибәреп булмый һәм файлның тулылыгын тикшерү. УИпләп " 21821 #~ "карагыз, <i>gpg</i> программа чыннан да дөрес урнаштырылганмы, чөнки " 21822 #~ "йөкләндерелгән ресурсларның верификациясебулдырыла алмый.</qt>" 21823 21824 #~ msgid "Select Signing Key" 21825 #~ msgstr "Имза өчен ачкыч сайлагыз" 21826 21827 #~ msgid "Key used for signing:" 21828 #~ msgstr "Имза өчен кулланылган ачкыч:" 21829 21830 #~ msgid "" 21831 #~ "<qt>Cannot start <i>gpg</i> and sign the file. Make sure that <i>gpg</i> " 21832 #~ "is installed, otherwise signing of the resources will not be possible.</" 21833 #~ "qt>" 21834 #~ msgstr "" 21835 #~ "<qt><i>gpg</i> җибәреп һәм файлны имзалап булмый. Истә тотыгыз, <i>gpg</" 21836 #~ "i> урнаштырылган, чөнки ресурсларны имзалап булмаячак.</qt>" 21837 21838 #~ msgid "Get Hot New Stuff" 21839 #~ msgstr "Алу" 21840 21841 #~ msgctxt "Program name followed by 'Add On Installer'" 21842 #~ msgid "%1 Add-On Installer" 21843 #~ msgstr "Программа установки дополнений для %1" 21844 21845 #~ msgid "Add Rating" 21846 #~ msgstr "Дәрәҗәне арттыру" 21847 21848 #~ msgid "View Comments" 21849 #~ msgstr "Аңлатмаларны карарга" 21850 21851 #~ msgid "Re: %1" 21852 #~ msgstr "Re: %1" 21853 21854 #~ msgid "Timeout. Check Internet connection." 21855 #~ msgstr "Көтү вакыты үтте. Интернетка тоташуны тикшерегез." 21856 21857 #~ msgid "Entries failed to load" 21858 #~ msgstr "Ошибка загрузки" 21859 21860 #~ msgid "Server: %1" 21861 #~ msgstr "Сервер: %1" 21862 21863 #~ msgid "<br />Provider: %1" 21864 #~ msgstr "<br />Китереп бирүче: %1" 21865 21866 #~ msgid "<br />Version: %1" 21867 #~ msgstr "<br />Юрама: %1" 21868 21869 #~ msgid "Provider information" 21870 #~ msgstr "Китереп бирүче турында мәгълумат" 21871 21872 #~ msgid "Could not install %1" 21873 #~ msgstr "Не удалось установить %1" 21874 21875 #~ msgid "Get Hot New Stuff!" 21876 #~ msgstr "Әсбапларны Интернеттан кабул итү" 21877 21878 #~ msgid "There was an error loading data providers." 21879 #~ msgstr "При загрузке списка поставщиков произошла ошибка." 21880 21881 #~ msgid "A protocol fault has occurred. The request has failed." 21882 #~ msgstr "Ошибка протокола. Запрос не выполнен." 21883 21884 #~ msgid "Desktop Exchange Service" 21885 #~ msgstr "Әсбапларны тапшыру хезмәте" 21886 21887 #~ msgid "A network error has occurred. The request has failed." 21888 #~ msgstr "Челтәрдә хата килеп чыкты. Таләп үтәлмәде." 21889 21890 #~ msgid "&Source:" 21891 #~ msgstr "&Чыганак:" 21892 21893 #~ msgid "?" 21894 #~ msgstr "?" 21895 21896 #~ msgid "&Order by:" 21897 #~ msgstr "&Өстәрәк урнаштыру:" 21898 21899 #~ msgid "Enter search phrase here" 21900 #~ msgstr "Эзли торган текстны языгыз" 21901 21902 #~ msgid "Collaborate" 21903 #~ msgstr "Бердәм эш" 21904 21905 #~ msgid "Rating: " 21906 #~ msgstr "Бәя: " 21907 21908 #~ msgid "Downloads: " 21909 #~ msgstr "Кабул итү саны: " 21910 21911 #~ msgid "Install" 21912 #~ msgstr "Урнаштыру" 21913 21914 #~ msgid "Uninstall" 21915 #~ msgstr "Бетерү" 21916 21917 #~ msgid "<p>No Downloads</p>" 21918 #~ msgstr "<p>Кабул итүләр әле булмады</p>" 21919 21920 #~ msgid "<p>Downloads: %1</p>\n" 21921 #~ msgstr "<p>Кабул итү саны: %1</p>\n" 21922 21923 #~ msgid "Update" 21924 #~ msgstr "Яңарту" 21925 21926 #~ msgid "Rating: %1" 21927 #~ msgstr "Бәя: %1" 21928 21929 #~ msgid "Loading Preview" 21930 #~ msgstr "Кече сүрәтне кабул итү..." 21931 21932 #~ msgid "Comments" 21933 #~ msgstr "Фикерләр" 21934 21935 #~ msgid "Switch version" 21936 #~ msgstr "Юраманы үзгәртү" 21937 21938 #~ msgid "Collaboration" 21939 #~ msgstr "Бердәм эш" 21940 21941 #~ msgid "Subscribe" 21942 #~ msgstr "Язылу" 21943 21944 #~ msgid "Report bad entry" 21945 #~ msgstr "Хата турында хәбәр итү" 21946 21947 #~ msgid "Send Mail" 21948 #~ msgstr "Хатны тапшыру" 21949 21950 #~ msgid "Contact on Jabber" 21951 #~ msgstr "Jabber аша элемтә" 21952 21953 #~ msgid "Provider: %1" 21954 #~ msgstr "Тәэмин итүче: %1" 21955 21956 #~ msgid "Version: %1" 21957 #~ msgstr "Юрама: %1" 21958 21959 #~ msgid "The removal request was successfully registered." 21960 #~ msgstr "Бетерүгә таләп теркәлде." 21961 21962 #~ msgid "Removal of entry" 21963 #~ msgstr "Язманы бетерү" 21964 21965 #~ msgid "The subscription was successfully completed." 21966 #~ msgstr "Сез үзгәрешләргә язылдыгыз." 21967 21968 #~ msgid "Subscription to entry" 21969 #~ msgstr "Үзгәрешләргә язылу" 21970 21971 #~ msgid "The subscription request failed." 21972 #~ msgstr "Язылу хатасы." 21973 21974 #~ msgid "The rating was submitted successfully." 21975 #~ msgstr "Бәяне күтәрү таләбе теркәлде." 21976 21977 #~ msgid "Rating for entry" 21978 #~ msgstr "Бәя" 21979 21980 #~ msgid "The comment was submitted successfully." 21981 #~ msgstr "Фикер теркәлде." 21982 21983 #~ msgid "The comment could not be submitted." 21984 #~ msgstr "Фикерне бирү таләбен эшкәрткәндә хата килеп чыкты." 21985 21986 #~ msgid "KNewStuff contributions" 21987 #~ msgstr "Яхшыртуда ярдәм" 21988 21989 #~ msgid "This operation requires authentication." 21990 #~ msgstr "Гамәл тиңләштерүне таләп итә." 21991 21992 #~ msgid "Version %1" 21993 #~ msgstr "Юрама %1" 21994 21995 #~ msgid "Leave a comment" 21996 #~ msgstr "Фикерне калдыру" 21997 21998 #~ msgid "User comments" 21999 #~ msgstr "Кулланучы фикерләре" 22000 22001 #~ msgid "Rate this entry" 22002 #~ msgstr "Әсбапның бәясе" 22003 22004 #~ msgid "Translate this entry" 22005 #~ msgstr "Бү язманы тәрҗемә итү" 22006 22007 #~ msgid "Payload" 22008 #~ msgstr "Йөкләү дәрәҗәсе" 22009 22010 #~ msgid "Download New Stuff..." 22011 #~ msgstr "Әсбапларны кабул итү..." 22012 22013 #~ msgid "Hot New Stuff Providers" 22014 #~ msgstr "Әсбаплар белән тәэмин итүчеләр" 22015 22016 #~ msgid "Please select one of the providers listed below:" 22017 #~ msgstr "Тәэмин итүчене исемлектән сайлагыз:" 22018 22019 #~ msgid "No provider selected." 22020 #~ msgstr "Тәэмин итүче сайланмаган." 22021 22022 #~ msgid "Share Hot New Stuff" 22023 #~ msgstr "Әсбапны нәшер итү" 22024 22025 #~ msgctxt "Program name followed by 'Add On Uploader'" 22026 #~ msgid "%1 Add-On Uploader" 22027 #~ msgstr "%1 объектының өстәлмәләрне бастыру кушымтасы" 22028 22029 #~ msgid "Please put in a name." 22030 #~ msgstr "Исем кертегез." 22031 22032 #~ msgid "Old upload information found, fill out fields?" 22033 #~ msgstr "Баштагы нәшер итүнең параметрлары табылды. Аларны кулланыргамы?" 22034 22035 #~ msgid "Fill Out" 22036 #~ msgstr "Әйе" 22037 22038 #~ msgid "Do Not Fill Out" 22039 #~ msgstr "Юк" 22040 22041 #~ msgid "Author:" 22042 #~ msgstr "Автор:" 22043 22044 #~ msgid "Email address:" 22045 #~ msgstr "E-Mail адресы:" 22046 22047 #~ msgid "License:" 22048 #~ msgstr "Лицензия:" 22049 22050 #~ msgid "GPL" 22051 #~ msgstr "GPL" 22052 22053 #~ msgid "LGPL" 22054 #~ msgstr "LGPL" 22055 22056 #~ msgid "BSD" 22057 #~ msgstr "BSD" 22058 22059 #~ msgid "Preview URL:" 22060 #~ msgstr "Кече сүрәтнең адресы:" 22061 22062 #~ msgid "Language:" 22063 #~ msgstr "Тел:" 22064 22065 #~ msgid "In which language did you describe the above?" 22066 #~ msgstr "Өстәрәк булган текст нинди телдә язылган?" 22067 22068 #~ msgid "Please describe your upload." 22069 #~ msgstr "Йөкләнүче әсбапларны тасвирлагыз." 22070 22071 #~ msgid "Summary:" 22072 #~ msgstr "Кыска тасвир:" 22073 22074 #~ msgid "Please give some information about yourself." 22075 #~ msgstr "Үзегез турында мәгълүмат бирегез." 22076 22077 #, fuzzy 22078 #~| msgctxt "" 22079 #~| "the price of a download item, parameter 1 is the currency, 2 is the price" 22080 #~| msgid "" 22081 #~| "This items costs %1 %2.\n" 22082 #~| "Do you want to buy it?" 22083 #~ msgctxt "" 22084 #~ "the price of a download item, parameter 1 is the currency, 2 is the price" 22085 #~ msgid "" 22086 #~ "This item costs %1 %2.\n" 22087 #~ "Do you want to buy it?" 22088 #~ msgstr "" 22089 #~ "Әсбапның бәясе %1 %2.\n" 22090 #~ "Сатыа аласыгыз киләме?" 22091 22092 #~ msgid "" 22093 #~ "Your account balance is too low:\n" 22094 #~ "Your balance: %1\n" 22095 #~ "Price: %2" 22096 #~ msgstr "" 22097 #~ "Счётыгыздагы булган акча күәте җитми.\n" 22098 #~ "Хәзер счётта: %1\n" 22099 #~ "Бәя: %2" 22100 22101 #~ msgctxt "voting for an item (good/bad)" 22102 #~ msgid "Your vote was recorded." 22103 #~ msgstr "Сезнең тавышыгыз теркәлде." 22104 22105 #~ msgid "You are now a fan." 22106 #~ msgstr "Хәзер сез бу өстәлмәнең яратучысы." 22107 22108 #~ msgid "Network error. (%1)" 22109 #~ msgstr "Челтәр хатасы. (%1)" 22110 22111 #~ msgid "Too many requests to server. Please try again in a few minutes." 22112 #~ msgstr "" 22113 #~ "Серверга килгән элемтә саны артык зур. Берничә минуттан соң яңадан кереп " 22114 #~ "карагыз." 22115 22116 #~ msgid "Unknown Open Collaboration Service API error. (%1)" 22117 #~ msgstr "Open Collaboration Service хезмәтенең хатасы. (%1)" 22118 22119 #~ msgid "Initializing" 22120 #~ msgstr "Башлап җибәрү" 22121 22122 #~ msgid "Configuration file not found: \"%1\"" 22123 #~ msgstr "Көйләү файлы табылмады: «%1»" 22124 22125 #~ msgid "Configuration file is invalid: \"%1\"" 22126 #~ msgstr "Көйләү файлы хаталы: «%1»" 22127 22128 #~ msgid "Loading provider information" 22129 #~ msgstr "Сервер турында мәгълуматны кабул итү" 22130 22131 #~ msgid "Could not load get hot new stuff providers from file: %1" 22132 #~ msgstr "Тәэмин итүчеләр исемлеген файлдан алып булмады: %1" 22133 22134 #~ msgid "Error initializing provider." 22135 #~ msgstr "Тәэмин итәчесен башлап җибәреп булмады." 22136 22137 #~ msgid "Loading data" 22138 #~ msgstr "Мәгълуматны кабул итү" 22139 22140 #~ msgid "Loading data from provider" 22141 #~ msgstr "Тәэмин итүчедән мәгүлуматны кабул итү" 22142 22143 #~ msgid "Loading of providers from file: %1 failed" 22144 #~ msgstr "Тәэмин итүчеләрен файлдан алып булмады: %1" 22145 22146 #~ msgid "Loading one preview" 22147 #~ msgid_plural "Loading %1 previews" 22148 #~ msgstr[0] "%1 кече сүрәтне кабул итү..." 22149 #~ msgstr[1] "%1 кече сүрәтне кабул итү..." 22150 22151 #~ msgid "Installing" 22152 #~ msgstr "Урнаштыру" 22153 22154 #~ msgid "Invalid item." 22155 #~ msgstr "Тотылмаган элемент." 22156 22157 #~ msgid "Download of item failed: no download URL for \"%1\"." 22158 #~ msgstr "Кабул итүдә хата: «%1» объектының адресы юк." 22159 22160 #~ msgid "Download of \"%1\" failed, error: %2" 22161 #~ msgstr "«%1» объектын кабул иткәндә хата: %2" 22162 22163 #~ msgid "" 22164 #~ "The downloaded file is a html file. This indicates a link to a website " 22165 #~ "instead of the actual download. Would you like to open the site with a " 22166 #~ "browser instead?" 22167 #~ msgstr "" 22168 #~ "Сез HTML файлын кабул итәргә омтыласыз. Димәк, бу сылтама файлга түгел, а " 22169 #~ "веб сәхифәсенә күрсәтә. Сылтаманы браузерда ачаргамы?" 22170 22171 #~ msgid "Possibly bad download link" 22172 #~ msgstr "Сылтама хаталы булуы ихтимал" 22173 22174 #~ msgid "Downloaded file was a HTML file. Opened in browser." 22175 #~ msgstr "" 22176 #~ "HTML файлын кабул итү омтылышы күзәтелә. Сылтама браузерда ачылачак." 22177 22178 #~ msgid "Could not install \"%1\": file not found." 22179 #~ msgstr "«%1» объектын урнаштырып булмады: файл табылмады." 22180 22181 #~ msgid "Overwrite existing file?" 22182 #~ msgstr "Булган файлны алыштырыргамы?" 22183 22184 #, fuzzy 22185 #~| msgid "Download File:" 22186 #~ msgid "Download File" 22187 #~ msgstr "Файлны кабул итү: " 22188 22189 #~ msgid "Icons view mode" 22190 #~ msgstr "Билгечекләр" 22191 22192 #~ msgid "Details view mode" 22193 #~ msgstr "Исемлек" 22194 22195 #~ msgid "All Providers" 22196 #~ msgstr "Булган тәэмин итүчеләр" 22197 22198 #~ msgid "All Categories" 22199 #~ msgstr "Барлык төркемнәр" 22200 22201 #~ msgid "Provider:" 22202 #~ msgstr "Тәэмин итүче:" 22203 22204 #~ msgid "Category:" 22205 #~ msgstr "Төркем:" 22206 22207 #~ msgid "Newest" 22208 #~ msgstr "Иң яңалары" 22209 22210 #~ msgid "Most downloads" 22211 #~ msgstr "Иң таныклы" 22212 22213 #~ msgid "Installed" 22214 #~ msgstr "Урнаштырылган" 22215 22216 #~ msgid "Order by:" 22217 #~ msgstr "Өстәрәк урнаштыру:" 22218 22219 #~ msgid "Search:" 22220 #~ msgstr "Эзләү:" 22221 22222 #~ msgid "<a href=\"http://opendesktop.org\">Homepage</a>" 22223 #~ msgstr "<a href=\"http://opendesktop.org\">Албит</a>" 22224 22225 #~ msgid "Become a Fan" 22226 #~ msgstr "Яратучы булу" 22227 22228 #~ msgid "Details for %1" 22229 #~ msgstr "%1 турында мәгълумат" 22230 22231 #~ msgctxt "A link to the description of this Get Hot New Stuff item" 22232 #~ msgid "Homepage" 22233 #~ msgstr "Албит" 22234 22235 #~ msgctxt "" 22236 #~ "A link to make a donation for a Get Hot New Stuff item (opens a web " 22237 #~ "browser)" 22238 #~ msgid "Make a donation" 22239 #~ msgstr "Иганә ясау" 22240 22241 #~ msgctxt "A link to the knowledgebase (like a forum) (opens a web browser)" 22242 #~ msgid "Knowledgebase (no entries)" 22243 #~ msgid_plural "Knowledgebase (%1 entries)" 22244 #~ msgstr[0] "Белү үзәге (язулар юк)" 22245 #~ msgstr[1] "База знаний (%1 язу)" 22246 22247 #~ msgctxt "Tooltip for a link in a dialog" 22248 #~ msgid "Opens in a browser window" 22249 #~ msgstr "Браузерда ачу" 22250 22251 #~ msgid "Rating: %1%" 22252 #~ msgstr "Бәя: %1%" 22253 22254 #~ msgctxt "Show the author of this item in a list" 22255 #~ msgid "By <i>%1</i>" 22256 #~ msgstr "Автор: <i>%1</i>" 22257 22258 #~ msgctxt "fan as in supporter" 22259 #~ msgid "1 fan" 22260 #~ msgid_plural "%1 fans" 22261 #~ msgstr[0] "%1 яратучы" 22262 #~ msgstr[1] "%1 яратучы" 22263 22264 #~ msgid "1 download" 22265 #~ msgid_plural "%1 downloads" 22266 #~ msgstr[0] "%1 кабул итү" 22267 #~ msgstr[1] "%1 кабул итү" 22268 22269 #~ msgid "Updating" 22270 #~ msgstr "Яңарту" 22271 22272 #~ msgid "Install Again" 22273 #~ msgstr "Яңадан урнаштыру" 22274 22275 #~ msgid "Fetching license data from server..." 22276 #~ msgstr "Сервердан лицензияне кабул итү..." 22277 22278 #~ msgid "Fetching content data from server..." 22279 #~ msgstr "Сервердан мәгълуматны кабул итү..." 22280 22281 #~ msgid "Checking login..." 22282 #~ msgstr "Кереп карау..." 22283 22284 #~ msgid "Fetching your previously updated content..." 22285 #~ msgstr "Элегрәк яңартылган эчтәлекне кабул итү..." 22286 22287 #~ msgid "Could not verify login, please try again." 22288 #~ msgstr "Теркәлү мәгълуматын тикшереп булмады. Соңрак кереп карагыз." 22289 22290 #~ msgid "Fetching your previously updated content finished." 22291 #~ msgstr "Элегрәк яңартылган эчтәлекне кабул итүе тәмамланды." 22292 22293 #~ msgid "Fetching content data from server finished." 22294 #~ msgstr "Сервердан эчтәлекне кабул итүе тәмамланды..." 22295 22296 #~ msgctxt "" 22297 #~ "A link to the website where the get hot new stuff upload can be seen" 22298 #~ msgid "Visit website" 22299 #~ msgstr "Веб сәхифәсенә кереп чыгу" 22300 22301 #~ msgid "File not found: %1" 22302 #~ msgstr "%1 файлы табылмады." 22303 22304 #~ msgid "Upload Failed" 22305 #~ msgstr "Файлны серверга тапшырганда хата килеп чыкты." 22306 22307 #~ msgid "" 22308 #~ "The server does not recognize the category %2 to which you are trying to " 22309 #~ "upload." 22310 #~ msgid_plural "" 22311 #~ "The server does not recognize any of the categories to which you are " 22312 #~ "trying to upload: %2" 22313 #~ msgstr[0] "" 22314 #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " 22315 #~ "загрузку." 22316 #~ msgstr[1] "" 22317 #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " 22318 #~ "загрузку.Сервер не поддерживает категорий (%2), в которые вы хотите " 22319 #~ "выполнить загрузку.Сервер не поддерживает категорию (%2), в которую вы " 22320 #~ "хотите выполнить загрузку." 22321 22322 #~ msgid "The selected category \"%1\" is invalid." 22323 #~ msgstr "«%1» исемле хаталы төркем сайланды." 22324 22325 #~ msgid "Select preview image" 22326 #~ msgstr "Кече сүрәт өчен рәсем сайлау" 22327 22328 #~ msgid "There was a network error." 22329 #~ msgstr "Челтәр хатасы килеп чыкты." 22330 22331 #~ msgid "Uploading Failed" 22332 #~ msgstr "Файлны серверга тапшырып булмады." 22333 22334 #~ msgid "Authentication error." 22335 #~ msgstr "Тиңләштерү хатасы килеп чыкты." 22336 22337 #~ msgid "Upload failed: %1" 22338 #~ msgstr "Серверга тапшырып булмады: %1" 22339 22340 #~ msgid "File to upload:" 22341 #~ msgstr "Бастырылучы файл:" 22342 22343 #~ msgid "New Upload" 22344 #~ msgstr "Яңа әсбап" 22345 22346 #~ msgid "Please fill out the information about your upload in English." 22347 #~ msgstr "Бастырып чыгаручы әсбапны инглизчә тасвирлагыз." 22348 22349 #~ msgid "Name of the file as it will appear on the website" 22350 #~ msgstr "Сайтта чагылдыручы файл исеме" 22351 22352 #~ msgid "" 22353 #~ "This should clearly describe the file content. It can be the same text as " 22354 #~ "the title of the kvtml file." 22355 #~ msgstr "Файлның исеме аның эчтәлеген ачык тасвирларга тиеш." 22356 22357 #~ msgid "Preview Images" 22358 #~ msgstr "Кечерәйтелгән күчермә" 22359 22360 #~ msgid "Select Preview..." 22361 #~ msgstr "Сайлау..." 22362 22363 #~ msgid "Set a price for this item" 22364 #~ msgstr "Бәяне билгеләү" 22365 22366 #~ msgid "Price" 22367 #~ msgstr "Бәя" 22368 22369 #~ msgid "Price:" 22370 #~ msgstr "Бәя:" 22371 22372 #~ msgid "Reason for price:" 22373 #~ msgstr "Бәяне дәлилләү:" 22374 22375 #~ msgid "Fetch content link from server" 22376 #~ msgstr "Әсбапның сылтамасын сервердан кабул итү" 22377 22378 #~ msgid "Create content on server" 22379 #~ msgstr "Әсбапларны серверда ясау" 22380 22381 #~ msgid "Upload content" 22382 #~ msgstr "Әсбапларны серверга тапшыру" 22383 22384 #~ msgid "Upload first preview" 22385 #~ msgstr "Кече сүрәтнең беренчесен серверга тапшыру" 22386 22387 #~ msgid "Note: You can edit, update and delete your content on the website." 22388 #~ msgstr "" 22389 #~ "Искәрмә: сез веб сәхифәсендә үзегезнең әсбапыгызны үзгәртә, яңарта, " 22390 #~ "бетерә аласыз." 22391 22392 #~ msgid "Upload second preview" 22393 #~ msgstr "Кече сүрәтнең икенчесен серверга тапшыру" 22394 22395 #~ msgid "Upload third preview" 22396 #~ msgstr "Кече сүрәтнең өченчесен серверга тапшыру" 22397 22398 #~ msgid "" 22399 #~ "I ensure that this content does not violate any existing copyright, law " 22400 #~ "or trademark. I agree for my IP address to be logged. (Distributing " 22401 #~ "content without the permission of the copyright holder is illegal.)" 22402 #~ msgstr "" 22403 #~ "Бу әсбапларның бастыруы бернинди автор хакын, канун һәм сәүдә маркасын " 22404 #~ "бозмавын раслыйм. Үземнең IP-адресын язып калдырырга рөхсәт итәм. (Хак " 22405 #~ "тотучының рөхсәтеннән кала әсбапларны тарату канунсыз.)" 22406 22407 #~ msgid "Start Upload" 22408 #~ msgstr "Тапшыруны башлау" 22409 22410 #~ msgid "Play a &sound" 22411 #~ msgstr "&Тавышны уйнату" 22412 22413 #~ msgid "Select the sound to play" 22414 #~ msgstr "Тавыш файлын сайлау" 22415 22416 #~ msgid "Show a message in a &popup" 22417 #~ msgstr "Калкымда хәбәрне күрсәтү" 22418 22419 #~ msgid "Log to a file" 22420 #~ msgstr "Журналның файлына язу" 22421 22422 #~ msgid "Mark &taskbar entry" 22423 #~ msgstr "Мәсьәлә панелендә кушымтаны сайлау" 22424 22425 #~ msgid "Run &command" 22426 #~ msgstr "Кушымтаны җибәрү" 22427 22428 #~ msgid "Select the command to run" 22429 #~ msgstr "Җибәрелүче кушымтаны сайлагыз" 22430 22431 #~ msgid "Sp&eech" 22432 #~ msgstr "Уку" 22433 22434 #~ msgid "" 22435 #~ "<qt>Specifies how Jovie should speak the event when received. If you " 22436 #~ "select \"Speak custom text\", enter the text in the box. You may use the " 22437 #~ "following substitution strings in the text:<dl><dt>%e</dt><dd>Name of the " 22438 #~ "event</dd><dt>%a</dt><dd>Application that sent the event</dd><dt>%m</" 22439 #~ "dt><dd>The message sent by the application</dd></dl></qt>" 22440 #~ msgstr "" 22441 #~ "<qt>Вакыйга килеп чыкканда нәрсә әйтүен билгеләгез. Әгәр сез \"Минем " 22442 #~ "тексты уку\" вариантын сайласагыз, туры килгән кырга текстны җыегыз. Сез " 22443 #~ "мондый тамгаларны куллана аласыз<dl><dt>%e</dt><dd>вакыйганың төре</" 22444 #~ "dd><dt>%a</dt><dd>вакыйганы тудырган кушымта</dd><dt>%m</dt><dd>кушымтада " 22445 #~ "алынган хәбәр</dd></dl></qt>" 22446 22447 #~ msgid "Speak Event Message" 22448 #~ msgstr "Вакыйганың эчтәлеген уку" 22449 22450 #~ msgid "Speak Event Name" 22451 #~ msgstr "Вакыйганың исемен уку" 22452 22453 #~ msgid "Speak Custom Text" 22454 #~ msgstr "Минем текстны уку" 22455 22456 #~ msgid "Configure Notifications" 22457 #~ msgstr "Белдерүләрне көйләү" 22458 22459 #~ msgctxt "Description of the notified event" 22460 #~ msgid "Description" 22461 #~ msgstr "Тасвирлама" 22462 22463 #~ msgid "<qt>Do you want to search the Internet for <b>%1</b>?</qt>" 22464 #~ msgstr "<qt> <b>%1</b> соравын Интернетта эзләргәме?</qt>" 22465 22466 #~ msgid "Internet Search" 22467 #~ msgstr "Интернетта эзләү" 22468 22469 #~ msgid "&Search" 22470 #~ msgstr "&Эзләү" 22471 22472 #~ msgctxt "@label:checkbox" 22473 #~ msgid "Remember action for files of this type" 22474 #~ msgstr "Файлның бу төре өчен гамәлне саклау" 22475 22476 #~ msgctxt "@label:button" 22477 #~ msgid "&Open with %1" 22478 #~ msgstr "«%1» кушымтасы аша &ачу" 22479 22480 #~ msgctxt "@action:inmenu" 22481 #~ msgid "Open &with %1" 22482 #~ msgstr "«%1» кушымтасы &аша ачу" 22483 22484 #~ msgctxt "@info" 22485 #~ msgid "Open '%1'?" 22486 #~ msgstr "«%1» файлын ачаргамы?" 22487 22488 #~ msgctxt "@label:button" 22489 #~ msgid "&Open with..." 22490 #~ msgstr "Кушымта аша &ачу..." 22491 22492 #~ msgctxt "@label:button" 22493 #~ msgid "&Open with" 22494 #~ msgstr "Кушымта аша &ачу..." 22495 22496 #~ msgctxt "@label:button" 22497 #~ msgid "&Open" 22498 #~ msgstr "&Ачу" 22499 22500 #~ msgctxt "@label File name" 22501 #~ msgid "Name: %1" 22502 #~ msgstr "Файлның исеме: %1" 22503 22504 #~ msgctxt "@info:whatsthis" 22505 #~ msgid "This is the file name suggested by the server" 22506 #~ msgstr "Сервер белән тәкъдим ителгән файлның исеме." 22507 22508 #~ msgid "Do you really want to execute '%1'?" 22509 #~ msgstr "«%1» объектын башкарырга телисезме?" 22510 22511 #~ msgid "Execute File?" 22512 #~ msgstr "Файлны башкарыргамы?" 22513 22514 #~ msgid "Accept" 22515 #~ msgstr "Рөхсәт итү" 22516 22517 #~ msgid "Reject" 22518 #~ msgstr "Кире кагу" 22519 22520 #~ msgid "Untitled" 22521 #~ msgstr "Документ" 22522 22523 #~ msgid "" 22524 #~ "The document \"%1\" has been modified.\n" 22525 #~ "Do you want to save your changes or discard them?" 22526 #~ msgstr "" 22527 #~ "Документ \"%1\" үзгәртелгән иде.\n" 22528 #~ "Саклауны калдырыргамы яки кире кагыргамы?" 22529 22530 #~ msgid "Close Document" 22531 #~ msgstr "Документны ябу" 22532 22533 #~ msgid "Error reading from PTY" 22534 #~ msgstr "PTY'ны укып булмады" 22535 22536 #~ msgid "Error writing to PTY" 22537 #~ msgstr "PTY'га язып булмады" 22538 22539 #~ msgid "PTY operation timed out" 22540 #~ msgstr "PTY гамәленең ахырын көтү вакыты үтте" 22541 22542 #~ msgid "Error opening PTY" 22543 #~ msgstr "PTY'ны ачу хатасы" 22544 22545 #~ msgid "Kross" 22546 #~ msgstr "Kross" 22547 22548 #~ msgid "KDE application to run Kross scripts." 22549 #~ msgstr "Kross скриптларын башкаручы KDE кушымтасы" 22550 22551 #~ msgid "(C) 2006 Sebastian Sauer" 22552 #~ msgstr "© Sebastian Sauer, 2006" 22553 22554 #~ msgid "Run Kross scripts." 22555 #~ msgstr "Kross скриптларын башкару." 22556 22557 #~ msgid "Sebastian Sauer" 22558 #~ msgstr "Sebastian Sauer" 22559 22560 #~ msgid "Scriptfile" 22561 #~ msgstr "Скрипт" 22562 22563 #~ msgid "Scriptfile \"%1\" does not exist." 22564 #~ msgstr "«%1» скриптының файлы табылмады." 22565 22566 #~ msgid "Failed to determine interpreter for scriptfile \"%1\"" 22567 #~ msgstr "«%1» скриптының интепретаторы билгеләп булмады." 22568 22569 #~ msgid "Failed to open scriptfile \"%1\"" 22570 #~ msgstr "«%1» скриптының файлын ачып булмады" 22571 22572 #~ msgid "Failed to load interpreter \"%1\"" 22573 #~ msgstr "«%1» интерпретаторын йөкләп булмады." 22574 22575 #~ msgid "No such interpreter \"%1\"" 22576 #~ msgstr "«%1» интерпретаторы билгесез." 22577 22578 #~ msgid "Failed to create script for interpreter \"%1\"" 22579 #~ msgstr "«%1» интепретаторының скриптын ясап булмады" 22580 22581 #~ msgid "Level of safety of the Ruby interpreter" 22582 #~ msgstr "Ruby интепретаторының иминлек дәрәҗәсе" 22583 22584 #~ msgid "Cancel?" 22585 #~ msgstr "Үткәрмәскәме?" 22586 22587 #~ msgid "No such function \"%1\"" 22588 #~ msgstr "«%1» функциясе юк." 22589 22590 #~ msgid "Text:" 22591 #~ msgstr "Текст:" 22592 22593 #~ msgid "Comment:" 22594 #~ msgstr "Тасвирлама:" 22595 22596 #~ msgid "Icon:" 22597 #~ msgstr "Билгечек:" 22598 22599 #~ msgid "Interpreter:" 22600 #~ msgstr "Интерпретатор:" 22601 22602 #~ msgid "Execute the selected script." 22603 #~ msgstr "Сайланып алынган скриптны башкару." 22604 22605 #~ msgid "Stop execution of the selected script." 22606 #~ msgstr "Сайланып алынган скриптны туктату." 22607 22608 #~ msgid "Edit..." 22609 #~ msgstr "Үзгәртү..." 22610 22611 #~ msgid "Edit selected script." 22612 #~ msgstr "Сайланып алынган скриптны үзгәртү." 22613 22614 #~ msgid "Add a new script." 22615 #~ msgstr "Яңа скриптны төзү." 22616 22617 #~ msgid "Remove selected script." 22618 #~ msgstr "Сайланып алынган скриптны бетерү." 22619 22620 #~ msgid "Edit" 22621 #~ msgstr "Үзгәртү" 22622 22623 #~ msgctxt "@title:group Script properties" 22624 #~ msgid "General" 22625 #~ msgstr "Төп" 22626 22627 #~ msgid "The module %1 could not be found." 22628 #~ msgstr "%1 модуле табылмады." 22629 22630 #~ msgid "" 22631 #~ "<qt><p>The diagnosis is:<br />The desktop file %1 could not be found.</" 22632 #~ "p></qt>" 22633 #~ msgstr "<qt><p>Тоткарлык:<br />%1 файлын табып булмады.</p></qt>" 22634 22635 #~ msgid "The module %1 is disabled." 22636 #~ msgstr "%1 модуле сүнек." 22637 22638 #~ msgid "" 22639 #~ "<qt><p>Either the hardware/software the module configures is not " 22640 #~ "available or the module has been disabled by the administrator.</p></qt>" 22641 #~ msgstr "" 22642 #~ "<qt><p>Не найдено оборудование или программное обеспечение для работы " 22643 #~ "модуля или использование модуля отключено администратором.</p></qt>" 22644 22645 #~ msgid "The module %1 is not a valid configuration module." 22646 #~ msgstr "Модуль %1 KDE көйләүнең дөрес модуле түгел." 22647 22648 #~ msgid "" 22649 #~ "<qt>The diagnosis is:<br />The desktop file %1 does not specify a library." 22650 #~ "</qt>" 22651 #~ msgstr "<qt>Проблема:<br />файл %1 не содержит имя библиотеки.</qt>" 22652 22653 #~ msgid "There was an error loading the module." 22654 #~ msgstr "Модульне йөкләндергәндә хата килеп чыкты." 22655 22656 #~ msgid "" 22657 #~ "<qt>The diagnosis is:<br />%1<p>Possible reasons:</p><ul><li>An error " 22658 #~ "occurred during your last KDE upgrade leaving an orphaned control module</" 22659 #~ "li><li>You have old third party modules lying around.</li></ul><p>Check " 22660 #~ "these points carefully and try to remove the module mentioned in the " 22661 #~ "error message. If this fails, consider contacting your distributor or " 22662 #~ "packager.</p></qt>" 22663 #~ msgstr "" 22664 #~ "<qt>Проблема:<br />%1<p>Возможные причины:</p><ul><li>Ошибка при " 22665 #~ "последнем обновлении KDE, в результате которой остался модуль управления " 22666 #~ "от предыдущей версии;</li><li>У вас установлены сторонние модули " 22667 #~ "настройки.</li></ul><p>Внимательно проверьте эти пункты и удалите " 22668 #~ "перечисленные выше модули. Если ошибка повторяется, обратитесь к " 22669 #~ "поставщику пакетов.</p></qt>" 22670 22671 #~ msgid "" 22672 #~ "<qt><p>Possible reasons:<ul><li>An error occurred during your last KDE " 22673 #~ "upgrade leaving an orphaned control module</li><li>You have old third " 22674 #~ "party modules lying around.</li></ul></p><p>Check these points carefully " 22675 #~ "and try to remove the module mentioned in the error message. If this " 22676 #~ "fails, consider contacting your distributor or packager.</p></qt>" 22677 #~ msgstr "" 22678 #~ "<qt><p>Возможные причины:<ul><li>Ошибка при последнем обновлении KDE, в " 22679 #~ "результате которой остался модуль настройки от предыдущей версии</" 22680 #~ "li><li>У вас установлены сторонние модули настройки.</li></ul></" 22681 #~ "p><p>Внимательно проверьте эти пункты и удалите перечисленные выше " 22682 #~ "модули. Если ошибка повторяется, обратитесь к поставщику пакетов.</p></qt>" 22683 22684 #~ msgctxt "Argument is application name" 22685 #~ msgid "This configuration section is already opened in %1" 22686 #~ msgstr "Бу көйләү бүлеге %1" 22687 22688 #~ msgid "" 22689 #~ "The settings of the current module have changed.\n" 22690 #~ "Do you want to apply the changes or discard them?" 22691 #~ msgstr "" 22692 #~ "Бу модульнең көйләүләре үзгәртелде.\n" 22693 #~ "Сез бу үзгерешләрне кулланырга телисезме?" 22694 22695 #~ msgid "Apply Settings" 22696 #~ msgstr "Көйләүләрне куллану" 22697 22698 #~ msgid "Distance between desktop icons" 22699 #~ msgstr "Эш өстәлендәге билгечекләрнең арасы" 22700 22701 #~ msgid "The distance between icons specified in pixels." 22702 #~ msgstr "Нокталар саны аша билгеләүче билгечекләрнең арасы." 22703 22704 #~ msgid "Widget style to use" 22705 #~ msgstr "Виджетның кыяфәте" 22706 22707 #~ msgid "" 22708 #~ "The name of the widget style, for example \"keramik\" or \"plastik\". " 22709 #~ "Without quotes." 22710 #~ msgstr "" 22711 #~ "Виджет кыяфәтенең исеме, мәсәлән, «keramik» яки «plastik» (куш тырнаксыз)." 22712 22713 #~ msgid "Use the PC speaker" 22714 #~ msgstr "ПК динамигы белән куллану" 22715 22716 #~ msgid "" 22717 #~ "Whether the ordinary PC speaker should be used instead of KDE's own " 22718 #~ "notifications system." 22719 #~ msgstr "KDE белдерү системасы урынына ПК динамигы белән куллану" 22720 22721 #~ msgid "What terminal application to use" 22722 #~ msgstr "Терминалҗ кушымтаны билгеләү" 22723 22724 #~ msgid "" 22725 #~ "Whenever a terminal application is launched this terminal emulator " 22726 #~ "program will be used.\n" 22727 #~ msgstr "Терминал өчен нинди кушымта белән кулланырга\n" 22728 22729 #~ msgid "Fixed width font" 22730 #~ msgstr "Бер киңлектәге хәреф" 22731 22732 #~ msgid "" 22733 #~ "This font is used when a fixed font is needed. A fixed font has a " 22734 #~ "constant width.\n" 22735 #~ msgstr "" 22736 #~ "Бу хәреф бер киңлектәге хәреф белән язылган текст өчен кулланылачак.\n" 22737 22738 #~ msgid "System wide font" 22739 #~ msgstr "Система хәрефе" 22740 22741 #~ msgid "Font for menus" 22742 #~ msgstr "Менюның хәрефе" 22743 22744 #~ msgid "What font to use for menus in applications." 22745 #~ msgstr "Менюларда кулланылучы хәреф" 22746 22747 #~ msgid "Color for links" 22748 #~ msgstr "Сылтаманың төсе" 22749 22750 #~ msgid "What color links should be that have not yet been clicked on" 22751 #~ msgstr "Басылмаган сылтаманың төсе" 22752 22753 #~ msgid "Color for visited links" 22754 #~ msgstr "Басылган сылтаманың төсе" 22755 22756 #~ msgid "Font for the taskbar" 22757 #~ msgstr "Мәсьәлә панеленең хәрефе" 22758 22759 #~ msgid "" 22760 #~ "What font to use for the panel at the bottom of the screen, where the " 22761 #~ "currently running applications are." 22762 #~ msgstr "Җибәрелгән кушымталарның исемлеге панеле өчен хәреф" 22763 22764 #~ msgid "Fonts for toolbars" 22765 #~ msgstr "Корал панеленең хәрефе" 22766 22767 #~ msgid "Shortcut for taking screenshot" 22768 #~ msgstr "Экран сүрәтен ясаучы төймә тезмәсе" 22769 22770 #~ msgid "Shortcut for toggling Clipboard Actions on and off" 22771 #~ msgstr "Алыштуру буферы элементларын эшкә китерүче төймә тезмәсе" 22772 22773 #~ msgid "Shortcut for shutting down the computer without confirmation" 22774 #~ msgstr "Компьютерны раслаусыз сүндерүче төймә тезмәсе" 22775 22776 #~ msgid "Show directories first" 22777 #~ msgstr "Каталоглар баштан" 22778 22779 #~ msgid "" 22780 #~ "Whether directories should be placed at the top when displaying files" 22781 #~ msgstr "Каталогларны файллар алдыннан урнаштыру." 22782 22783 #~ msgid "The URLs recently visited" 22784 #~ msgstr "Басылган сылтамалар" 22785 22786 #~ msgid "Used for auto-completion in file dialogs, for example" 22787 #~ msgstr "Мәсәлән, диалогта сүзне автоматик рәвештә тәмам итү өчен кулланыла" 22788 22789 #~ msgid "Show file preview in file dialog" 22790 #~ msgstr "Файл сайлау диалогында кече сүрәтне чагылдыру" 22791 22792 #~ msgid "" 22793 #~ "Whether files starting with a dot (convention for hidden files) should be " 22794 #~ "shown" 22795 #~ msgstr "" 22796 #~ "Бу көйләүне гамәл иткәндә качырылган (исеме ноктадан башланган) файлларны " 22797 #~ "чагылдыра" 22798 22799 #~ msgid "Show speedbar" 22800 #~ msgstr "Тизләткеч панелен чагылдыру" 22801 22802 #~ msgid "" 22803 #~ "Whether the shortcut icons to the left in the file dialog should be shown" 22804 #~ msgstr "Файл сайлау диалогының сул ягында тизләткеч панелен күрсәтү" 22805 22806 #~ msgid "What country" 22807 #~ msgstr "Ил" 22808 22809 #~ msgid "" 22810 #~ "Used to determine how to display numbers, currency and time/date, for " 22811 #~ "example" 22812 #~ msgstr "" 22813 #~ "Сан, акча җәмгысы, көн һәм вакытны күрсәтү форматын билгеләүдә кулланыла" 22814 22815 #~ msgid "What language to use to display text" 22816 #~ msgstr "Текстның теле" 22817 22818 #~ msgid "Character used for indicating positive numbers" 22819 #~ msgstr "Уңай санны күрсәтүче тамга" 22820 22821 #~ msgid "Most countries have no character for this" 22822 #~ msgstr "Күпчелек ил бу тамганы кулланмый" 22823 22824 #~ msgid "Path to the autostart directory" 22825 #~ msgstr "Автоматик рәвештә җибәрү каталогын билгеләү" 22826 22827 #~ msgid "" 22828 #~ "Path to the directory containing executables to be run on session login" 22829 #~ msgstr "KDE сеансын башлаганда җибәрелә торган кушымталар каталогын күрсәтү" 22830 22831 #~ msgid "Enable SOCKS support" 22832 #~ msgstr "SOCKS коралын тоту" 22833 22834 #~ msgid "Whether SOCKS version 4 and 5 should be enabled in KDE's sub systems" 22835 #~ msgstr "KDE чолгалынышында SOCKS коралының 4 һәм 5 юрамасын куллану" 22836 22837 #~ msgid "Path to custom SOCKS library" 22838 #~ msgstr "SOCKS китапханәсен билгеләү" 22839 22840 #~ msgid "Highlight toolbar buttons on mouse over" 22841 #~ msgstr "Тычкан угы юнәлткән кораллар панелендәге төймәне яктырту" 22842 22843 #~ msgid "Show text on toolbar icons " 22844 #~ msgstr "Кораллар панелендәге текст белән билгечекләрне күрсәтү " 22845 22846 #~ msgid "Whether text should be shown in addition to icons on toolbar icons" 22847 #~ msgstr "" 22848 #~ "Өстәмә булып корал панеленең билгечекләре янына аның язуын чагылдыру" 22849 22850 #~ msgid "Password echo type" 22851 #~ msgstr "Серсүзне керткәндә аны чагылдыру" 22852 22853 #~ msgid "The size of the dialog" 22854 #~ msgstr "Диалогның зурлыгы" 22855 22856 #~ msgid "" 22857 #~ "Automatic changes have been performed due to plugin dependencies. Click " 22858 #~ "here for further information" 22859 #~ msgstr "" 22860 #~ "Для удовлетворения зависимости расширения будут предприняты некоторые " 22861 #~ "автоматические изменения. Нажмите здесь для получения дополнительной " 22862 #~ "информации" 22863 22864 #~ msgid "" 22865 #~ "Automatic changes have been performed in order to satisfy plugin " 22866 #~ "dependencies:\n" 22867 #~ msgstr "" 22868 #~ "Для удовлетворения зависимости расширения будут предприняты следующие " 22869 #~ "автоматические изменения:\n" 22870 22871 #~ msgid "" 22872 #~ "\n" 22873 #~ " %1 plugin has been automatically checked because of the dependency of " 22874 #~ "%2 plugin" 22875 #~ msgstr "" 22876 #~ "\n" 22877 #~ " Расширение %1 будет выбрано, так как от него зависит расширение %2" 22878 22879 #~ msgid "" 22880 #~ "\n" 22881 #~ " %1 plugin has been automatically unchecked because of its dependency " 22882 #~ "on %2 plugin" 22883 #~ msgstr "" 22884 #~ "\n" 22885 #~ " Расширение %1 не будет выбрано, так как зависит от расширения %2" 22886 22887 #~ msgid "Dependency Check" 22888 #~ msgstr "Буйсынучыларга тикшерү" 22889 22890 #~ msgid "%1 plugin automatically added due to plugin dependencies" 22891 #~ msgid_plural "%1 plugins automatically added due to plugin dependencies" 22892 #~ msgstr[0] "%1 расширение автоматически добавлено при проверке зависимостей" 22893 #~ msgstr[1] "%1 расширения автоматически добавлены при проверке зависимостей" 22894 22895 #~ msgid ", " 22896 #~ msgstr ", " 22897 22898 #~ msgid "%1 plugin automatically removed due to plugin dependencies" 22899 #~ msgid_plural "%1 plugins automatically removed due to plugin dependencies" 22900 #~ msgstr[0] "%1 расширение автоматически удалено при проверке зависимостей" 22901 #~ msgstr[1] "%1 расширения автоматически удалены при проверке зависимостей" 22902 22903 #~ msgid "Search Plugins" 22904 #~ msgstr "Өстәлмәләрне эзләү" 22905 22906 #~ msgctxt "Used only for plugins" 22907 #~ msgid "About %1" 22908 #~ msgstr "%1 турында" 22909 22910 #~ msgid "Select Components" 22911 #~ msgstr "Компонентларны сайлагыз" 22912 22913 #~ msgid "Enable component" 22914 #~ msgstr "Компонентны эшләтү" 22915 22916 #~ msgid "Success" 22917 #~ msgstr "Уңышлы" 22918 22919 #~ msgid "Communication error" 22920 #~ msgstr "Элемтә хатасы" 22921 22922 #~ msgid "Invalid type in Database" 22923 #~ msgstr "Мәгълумат базасында хаталы төр" 22924 22925 #~ msgctxt "" 22926 #~ "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the " 22927 #~ "user entered." 22928 #~ msgid "Query Results from '%1'" 22929 #~ msgstr "Результаты поиска «%1»" 22930 22931 #~ msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing." 22932 #~ msgid "Query Results" 22933 #~ msgstr "Таләпнең нәтиҗәләре" 22934 22935 #~ msgid "Nepomuk Resource Class Generator" 22936 #~ msgstr "Генератор классов ресурсов Nepomuk" 22937 22938 #~ msgid "(c) 2006-2009, Sebastian Trüg" 22939 #~ msgstr "(c) 2006-2009, Sebastian Trüg" 22940 22941 #~ msgid "Sebastian Trüg" 22942 #~ msgstr "Sebastian Trüg" 22943 22944 #~ msgid "Tobias Koenig" 22945 #~ msgstr "Tobias Koenig" 22946 22947 #~ msgid "Major cleanup - Personal hero of maintainer" 22948 #~ msgstr "Подчистка кода; личный герой сопровождающего" 22949 22950 #~ msgid "Verbose output debugging mode." 22951 #~ msgstr "Төзәткечнең җентекле беркетү режимы" 22952 22953 #~ msgid "" 22954 #~ "Generate simple and fast wrapper classes not based on Nepomuk::Resource " 22955 #~ "which do not provide any data integrity checking" 22956 #~ msgstr "" 22957 #~ "Генерация компактных и быстрых классов, не базирующихся на Nepomuk::" 22958 #~ "Resource, который не обеспечивает проверки целостности данных." 22959 22960 #~ msgid "Actually generate the code." 22961 #~ msgstr "Генерация кода." 22962 22963 #~ msgid "List all includes (deprecated)." 22964 #~ msgstr "Список всех включаемых файлов (устаревшее)." 22965 22966 #~ msgid "" 22967 #~ "List all header files that will be generated via the --writeall command." 22968 #~ msgstr "Список всех включаемых файлов, генерируемых командой --writeall." 22969 22970 #~ msgid "" 22971 #~ "List all source files that will be generated via the --writeall command." 22972 #~ msgstr "Список всех файлов кода, генерируемых командой --writeall." 22973 22974 #~ msgid "" 22975 #~ "The ontology files containing the ontologies to be generated, a space " 22976 #~ "separated list (deprecated: use arguments instead.)" 22977 #~ msgstr "" 22978 #~ "Файл онтологий, для которых нужно сгенерировать онтологии. Файлы " 22979 #~ "указываются в виде разделённого пробелами списка (устаревшее, вместо " 22980 #~ "этого используйте отдельные параметры командной строки)." 22981 22982 #~ msgid "Include path prefix (deprecated)" 22983 #~ msgstr "Юл префиксын кушу (искерде)" 22984 22985 #~ msgid "Specify the target folder to store generated files into." 22986 #~ msgstr "Папка для генерируемых файлов." 22987 22988 #~ msgid "Templates to be used (deprecated)." 22989 #~ msgstr "Куллануга калыплар (искерде)" 22990 22991 #~ msgid "" 22992 #~ "Optionally specify the classes to be generated. Use option multiple times " 22993 #~ "(defaults to all classes)" 22994 #~ msgstr "" 22995 #~ "Необязательное указание генерируемых классов (по умолчанию — все классы). " 22996 #~ "Этот ключ можно использовать несколько раз для указания нескольких " 22997 #~ "классов." 22998 22999 #~ msgid "" 23000 #~ "Serialization used in the ontology files. Will default to primitive file " 23001 #~ "extension detection." 23002 #~ msgstr "" 23003 #~ "Используемый тип сериализации в файлах онтологий. По умолчанию " 23004 #~ "определяется по расширению файла." 23005 23006 #~ msgid "" 23007 #~ "Set the used visibility in case the classes are to be used in public API. " 23008 #~ "<visibility-name> will be used to construct the export macro name and the " 23009 #~ "export header. By default classes will not be exported." 23010 #~ msgstr "" 23011 #~ "Видимость классов для публичного API. Для генерации экспортирующего " 23012 #~ "заголовочного файла и имён макросов используется <visibility-name>. По " 23013 #~ "умолчанию классы не экспортируются." 23014 23015 #~ msgid "The ontology files containing the ontologies to be generated." 23016 #~ msgstr "Файлы онтологий для генерируемой онтологии." 23017 23018 #~ msgctxt "@title:window" 23019 #~ msgid "Change Tags" 23020 #~ msgstr "Тегларны үзгәртү" 23021 23022 #~ msgctxt "@title:window" 23023 #~ msgid "Add Tags" 23024 #~ msgstr "Тегларны өстәү" 23025 23026 #~ msgctxt "@label:textbox" 23027 #~ msgid "Configure which tags should be applied." 23028 #~ msgstr "Выберите метки для объектов." 23029 23030 #~ msgctxt "@label" 23031 #~ msgid "Create new tag:" 23032 #~ msgstr "Яңа тег:" 23033 23034 #~ msgctxt "@info" 23035 #~ msgid "Delete tag" 23036 #~ msgstr "Тегны бетерү" 23037 23038 #~ msgctxt "@info" 23039 #~ msgid "" 23040 #~ "Should the tag <resource>%1</resource> really be deleted for all files?" 23041 #~ msgstr "Убрать метку <resource>%1</resource> со всех файлов?" 23042 23043 #~ msgctxt "@title" 23044 #~ msgid "Delete tag" 23045 #~ msgstr "Тегны бетерү" 23046 23047 #~ msgctxt "@action:button" 23048 #~ msgid "Delete" 23049 #~ msgstr "Бетерү" 23050 23051 #~ msgctxt "@action:button" 23052 #~ msgid "Cancel" 23053 #~ msgstr "Үткәрмәү" 23054 23055 #~ msgid "Changing annotations" 23056 #~ msgstr "Изменение аннотаций" 23057 23058 #~ msgctxt "@label" 23059 #~ msgid "Show all tags..." 23060 #~ msgstr "Бар тегларны чагылдыру..." 23061 23062 #~ msgctxt "@label" 23063 #~ msgid "Add Tags..." 23064 #~ msgstr "Тегларны өстәү..." 23065 23066 #~ msgctxt "" 23067 #~ "referring to a filter on the modification and usage date of files/" 23068 #~ "resources" 23069 #~ msgid "Anytime" 23070 #~ msgstr "Һәрвакыт" 23071 23072 #~ msgctxt "" 23073 #~ "referring to a filter on the modification and usage date of files/" 23074 #~ "resources" 23075 #~ msgid "Today" 23076 #~ msgstr "Бүген" 23077 23078 #~ msgctxt "" 23079 #~ "referring to a filter on the modification and usage date of files/" 23080 #~ "resources" 23081 #~ msgid "Yesterday" 23082 #~ msgstr "Кичә" 23083 23084 #~ msgctxt "" 23085 #~ "referring to a filter on the modification and usage date of files/" 23086 #~ "resources" 23087 #~ msgid "This Week" 23088 #~ msgstr "Бу атна" 23089 23090 #~ msgctxt "" 23091 #~ "referring to a filter on the modification and usage date of files/" 23092 #~ "resources" 23093 #~ msgid "Last Week" 23094 #~ msgstr "Ахыргы атна" 23095 23096 #~ msgctxt "" 23097 #~ "referring to a filter on the modification and usage date of files/" 23098 #~ "resources" 23099 #~ msgid "This Month" 23100 #~ msgstr "Бу ай" 23101 23102 #~ msgctxt "" 23103 #~ "referring to a filter on the modification and usage date of files/" 23104 #~ "resources" 23105 #~ msgid "Last Month" 23106 #~ msgstr "Ахыргы ай" 23107 23108 #~ msgctxt "" 23109 #~ "referring to a filter on the modification and usage date of files/" 23110 #~ "resources" 23111 #~ msgid "This Year" 23112 #~ msgstr "Бу ел" 23113 23114 #~ msgctxt "" 23115 #~ "referring to a filter on the modification and usage date of files/" 23116 #~ "resources" 23117 #~ msgid "Last Year" 23118 #~ msgstr "Ахыргы ел" 23119 23120 #~ msgctxt "" 23121 #~ "referring to a filter on the modification and usage date of files/" 23122 #~ "resources that will open a dialog to choose a date range" 23123 #~ msgid "Custom..." 23124 #~ msgstr "Башка..." 23125 23126 #~ msgid "This Week" 23127 #~ msgstr "Бу атна" 23128 23129 #~ msgid "This Month" 23130 #~ msgstr "Бу ай" 23131 23132 #~ msgid "Anytime" 23133 #~ msgstr "Һәрвакыт" 23134 23135 #~ msgid "After" 23136 #~ msgstr "Моннан соң" 23137 23138 #~ msgctxt "" 23139 #~ "@option:check An item in a list of resources that allows to query for " 23140 #~ "more resources to put in the list" 23141 #~ msgid "More..." 23142 #~ msgstr "Е~щё..." 23143 23144 #~ msgctxt "@option:check A filter on file type" 23145 #~ msgid "Documents" 23146 #~ msgstr "Документы" 23147 23148 #~ msgctxt "@option:check A filter on file type - audio files" 23149 #~ msgid "Audio" 23150 #~ msgstr "Аудио" 23151 23152 #~ msgctxt "@option:check A filter on file type - media video" 23153 #~ msgid "Video" 23154 #~ msgstr "Видео" 23155 23156 #~ msgctxt "" 23157 #~ "@option:radio A filter on prioritizing/sorting a selection of resources" 23158 #~ msgid "No priority" 23159 #~ msgstr "Беренчелексез" 23160 23161 #~ msgctxt "" 23162 #~ "@option:radio A filter on prioritizing/sorting a selection of resources" 23163 #~ msgid "Last modified" 23164 #~ msgstr "Соңгы үзгәрешле" 23165 23166 #~ msgctxt "" 23167 #~ "@option:radio A filter on prioritizing/sorting a selection of resources" 23168 #~ msgid "Most important" 23169 #~ msgstr "Иң әһәмиятлеләре" 23170 23171 #~ msgctxt "" 23172 #~ "@option:radio A filter on prioritizing/sorting a selection of resources" 23173 #~ msgid "Never opened" 23174 #~ msgstr "Бервакытта да ачылмаган" 23175 23176 #~ msgctxt "@option:radio A filter on the rating of a resource" 23177 #~ msgid "Any Rating" 23178 #~ msgstr "Барлык бәя" 23179 23180 #~ msgctxt "@option:radio A filter on the rating of a resource" 23181 #~ msgid "1 or more" 23182 #~ msgstr "1 һәм артык" 23183 23184 #~ msgctxt "@option:radio A filter on the rating of a resource" 23185 #~ msgid "2 or more" 23186 #~ msgstr "2 һәм артык" 23187 23188 #~ msgctxt "@option:radio A filter on the rating of a resource" 23189 #~ msgid "3 or more" 23190 #~ msgstr "3 һәм артык" 23191 23192 #~ msgctxt "@option:radio A filter on the rating of a resource" 23193 #~ msgid "4 or more" 23194 #~ msgstr "4 һәм артык" 23195 23196 #~ msgctxt "@option:radio A filter on the rating of a resource" 23197 #~ msgid "Max Rating" 23198 #~ msgstr "Иң зур бәя" 23199 23200 #~ msgctxt "" 23201 #~ "@title KCategorizedSortFilterProxyModel grouping for all Nepomukj " 23202 #~ "resources that are of type rdfs:Resource" 23203 #~ msgid "Miscellaneous" 23204 #~ msgstr "Башкалар" 23205 23206 #~ msgid "Enter Search Terms..." 23207 #~ msgstr "Эзл торган сүзләрне кертегез..." 23208 23209 #~ msgctxt "@option:check A filter on resource type" 23210 #~ msgid "Contacts" 23211 #~ msgstr "Контакты" 23212 23213 #~ msgctxt "@option:check A filter on resource type" 23214 #~ msgid "Emails" 23215 #~ msgstr "Электрон почталар" 23216 23217 #~ msgctxt "@option:check A filter on resource type" 23218 #~ msgid "Tasks" 23219 #~ msgstr "Задачи" 23220 23221 #~ msgctxt "@option:check Do filter on type - show only files" 23222 #~ msgid "Files" 23223 #~ msgstr "Файллар" 23224 23225 #~ msgctxt "@option:check Do filter on type - show everything but files" 23226 #~ msgid "Other" 23227 #~ msgstr "Башкалар" 23228 23229 #~ msgid "ThreadWeaver Jobs Examples" 23230 #~ msgstr "ThreadWeaver хезмәтенең эш үрнәкләре" 23231 23232 #~ msgid "" 23233 #~ "The program executes 100 jobs in 4 threads. Each job waits for a random " 23234 #~ "number of milliseconds between 1 and 1000." 23235 #~ msgstr "" 23236 #~ "Кушымта 4 агымда 100 эшне җибәрә. һәр эш 1 һәм 1000 миллисекунд арасында " 23237 #~ "булган очраклы вакытны көтә." 23238 23239 #~ msgid "" 23240 #~ "Check to see logging information about thread activity. Watch the console " 23241 #~ "output to see the log information." 23242 #~ msgstr "" 23243 #~ "Кушымтаның агымнарының эшчәнлеге турында мәгълуматны терминалга чыгару " 23244 #~ "өчен тамганы урнаштырыгыз." 23245 23246 #~ msgid "Log thread activity" 23247 #~ msgstr "Агымнарның эшчәнлеге мәгълуматын чыгару" 23248 23249 #~ msgid "Displays Thread Activity" 23250 #~ msgstr "Агымнарның эшчәнлеге мәгълуматын чагылдыру" 23251 23252 #~ msgid "GUI based example for the Weaver Thread Manager" 23253 #~ msgstr "ThreadWeaver кушымтаның график интерфейсы белән куллану мисалы" 23254 23255 #~ msgid "Remaining number of jobs:" 23256 #~ msgstr "Калган эшләрнең саны:" 23257 23258 #~ msgid "What time is it? Click to update." 23259 #~ msgstr "Сәгать ничә? Яңарту өчен басыгыз." 23260 23261 #~ msgid "Select Files..." 23262 #~ msgstr "Файлны сайлау..." 23263 23264 #~ msgid "Cancel" 23265 #~ msgstr "Үткәрмәү" 23266 23267 #~ msgid "Suspend" 23268 #~ msgstr "Тыныш" 23269 23270 #~ msgid "Anonymous" 23271 #~ msgstr "Исемсез" 23272 23273 #~ msgid "What's &This" 23274 #~ msgstr "Нәрсә &бу?"