Warning, /frameworks/kdelibs4support/po/ne/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Nepali 0002 # Mahesh Subedi <submanesh@gmail.com>, 2006, 2007. 0003 # Shiva Prasad Pokharel <pokharelshiva@hotmail.com>, 2006, 2007. 0004 # shyam krishna ball <shyam@mpp.org.np>, 2006. 0005 # shyam krishna bal <shyamkrishna_bal@yahoo.com>, 2006, 2007. 0006 # Shiva Pokharel <shiva@mpp.org.np>, 2007. 0007 # Nabin Gautam <nabin@mpp.org.np>, 2007. 0008 # Shiva Prasad Pokharel <pokharelshiv@gmail.com>, 2007. 0009 # Shyam Krishna Bal <shyamkrishna_bal@yahoo.com>, 2007. 0010 msgid "" 0011 msgstr "" 0012 "Project-Id-Version: kdelibs4\n" 0013 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0014 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0015 "PO-Revision-Date: 2007-11-05 15:41+0545\n" 0016 "Last-Translator: Shyam Krishna Bal <shyamkrishna_bal@yahoo.com>\n" 0017 "Language-Team: Nepali <info@mpp.org.np>\n" 0018 "Language: ne\n" 0019 "MIME-Version: 1.0\n" 0020 "Content-Type: text/plain; charset=UTF-8\n" 0021 "Content-Transfer-Encoding: 8bit\n" 0022 "Plural-Forms: nplurals=2; plural=n !=1\n" 0023 "X-Generator: KBabel 1.11.4\n" 0024 0025 #, kde-format 0026 msgctxt "NAME OF TRANSLATORS" 0027 msgid "Your names" 0028 msgstr "Nabin Gautam,श्यामकृष्ण बल" 0029 0030 #, kde-format 0031 msgctxt "EMAIL OF TRANSLATORS" 0032 msgid "Your emails" 0033 msgstr "nabin@mpp.org.np,shyam@mpp.org.np" 0034 0035 #, kde-format 0036 msgctxt "color" 0037 msgid "AliceBlue" 0038 msgstr "अलाइस नीलो" 0039 0040 #, kde-format 0041 msgctxt "color" 0042 msgid "AntiqueWhite" 0043 msgstr "एन्टिक सेतो" 0044 0045 #, kde-format 0046 msgctxt "color" 0047 msgid "AntiqueWhite1" 0048 msgstr "एन्टिक सेतो१" 0049 0050 #, kde-format 0051 msgctxt "color" 0052 msgid "AntiqueWhite2" 0053 msgstr "एन्टिक सेतो२" 0054 0055 #, kde-format 0056 msgctxt "color" 0057 msgid "AntiqueWhite3" 0058 msgstr "एन्टिक सेतो ३" 0059 0060 #, kde-format 0061 msgctxt "color" 0062 msgid "AntiqueWhite4" 0063 msgstr "एन्टिक सेतो४" 0064 0065 #, kde-format 0066 msgctxt "color" 0067 msgid "BlanchedAlmond" 0068 msgstr "फिका बदाम" 0069 0070 #, kde-format 0071 msgctxt "color" 0072 msgid "BlueViolet" 0073 msgstr "नीलो भाइलेट" 0074 0075 #, kde-format 0076 msgctxt "color" 0077 msgid "CadetBlue" 0078 msgstr "क्याडेटनीलो" 0079 0080 #, kde-format 0081 msgctxt "color" 0082 msgid "CadetBlue1" 0083 msgstr "क्याडेटनीलो१" 0084 0085 #, kde-format 0086 msgctxt "color" 0087 msgid "CadetBlue2" 0088 msgstr "क्याडेटनीलो२" 0089 0090 #, kde-format 0091 msgctxt "color" 0092 msgid "CadetBlue3" 0093 msgstr "क्याडेटनीलो३" 0094 0095 #, kde-format 0096 msgctxt "color" 0097 msgid "CadetBlue4" 0098 msgstr "क्याडेटनीलो४" 0099 0100 #, kde-format 0101 msgctxt "color" 0102 msgid "CornflowerBlue" 0103 msgstr "मकैफूलनीलो" 0104 0105 #, kde-format 0106 msgctxt "color" 0107 msgid "DarkBlue" 0108 msgstr "गाढा नीलो" 0109 0110 #, kde-format 0111 msgctxt "color" 0112 msgid "DarkCyan" 0113 msgstr "गाढा सायन" 0114 0115 #, kde-format 0116 msgctxt "color" 0117 msgid "DarkGoldenrod" 0118 msgstr "गाढा गोल्डेनरड" 0119 0120 #, kde-format 0121 msgctxt "color" 0122 msgid "DarkGoldenrod1" 0123 msgstr "गाढा गोल्डेनरड१" 0124 0125 #, kde-format 0126 msgctxt "color" 0127 msgid "DarkGoldenrod2" 0128 msgstr "गाढा गोल्डेनरड२" 0129 0130 #, kde-format 0131 msgctxt "color" 0132 msgid "DarkGoldenrod3" 0133 msgstr "गाढा गोल्डेनरड३" 0134 0135 #, kde-format 0136 msgctxt "color" 0137 msgid "DarkGoldenrod4" 0138 msgstr "गाढा गोल्डेनरड४" 0139 0140 #, kde-format 0141 msgctxt "color" 0142 msgid "DarkGray" 0143 msgstr "गाढाखैरो" 0144 0145 #, kde-format 0146 msgctxt "color" 0147 msgid "DarkGreen" 0148 msgstr "गाढा हरियो" 0149 0150 #, kde-format 0151 msgctxt "color" 0152 msgid "DarkGrey" 0153 msgstr "गाढाखैरो" 0154 0155 #, kde-format 0156 msgctxt "color" 0157 msgid "DarkKhaki" 0158 msgstr "गाढाखाकी" 0159 0160 #, kde-format 0161 msgctxt "color" 0162 msgid "DarkMagenta" 0163 msgstr "गाढा म्याजेन्टा" 0164 0165 #, kde-format 0166 msgctxt "color" 0167 msgid "DarkOliveGreen" 0168 msgstr "गाढा ओलिभ हरियो" 0169 0170 #, kde-format 0171 msgctxt "color" 0172 msgid "DarkOliveGreen1" 0173 msgstr "गाढा ओलिभ हरियो१" 0174 0175 #, kde-format 0176 msgctxt "color" 0177 msgid "DarkOliveGreen2" 0178 msgstr "गाढा ओलिभ हरियो२" 0179 0180 #, kde-format 0181 msgctxt "color" 0182 msgid "DarkOliveGreen3" 0183 msgstr "गाढा ओलिभ हरियो३" 0184 0185 #, kde-format 0186 msgctxt "color" 0187 msgid "DarkOliveGreen4" 0188 msgstr "गाढा ओलिभ हरियो४" 0189 0190 #, kde-format 0191 msgctxt "color" 0192 msgid "DarkOrange" 0193 msgstr "गाढा सुन्तले रङ" 0194 0195 #, kde-format 0196 msgctxt "color" 0197 msgid "DarkOrange1" 0198 msgstr "गाढा सुन्तले रङ१" 0199 0200 #, kde-format 0201 msgctxt "color" 0202 msgid "DarkOrange2" 0203 msgstr "गाढा सुन्तले रङ२" 0204 0205 #, kde-format 0206 msgctxt "color" 0207 msgid "DarkOrange3" 0208 msgstr "गाढा सुन्तले रङ३" 0209 0210 #, kde-format 0211 msgctxt "color" 0212 msgid "DarkOrange4" 0213 msgstr "गाढा सुन्तले रङ४" 0214 0215 #, kde-format 0216 msgctxt "color" 0217 msgid "DarkOrchid" 0218 msgstr "गाढा आर्किड" 0219 0220 #, kde-format 0221 msgctxt "color" 0222 msgid "DarkOrchid1" 0223 msgstr "गाढा आर्किड१" 0224 0225 #, kde-format 0226 msgctxt "color" 0227 msgid "DarkOrchid2" 0228 msgstr "गाढा आर्किड२" 0229 0230 #, kde-format 0231 msgctxt "color" 0232 msgid "DarkOrchid3" 0233 msgstr "गाढा आर्किड३" 0234 0235 #, kde-format 0236 msgctxt "color" 0237 msgid "DarkOrchid4" 0238 msgstr "गाढा आर्किड४" 0239 0240 #, kde-format 0241 msgctxt "color" 0242 msgid "DarkRed" 0243 msgstr "गाढा रातो" 0244 0245 #, kde-format 0246 msgctxt "color" 0247 msgid "DarkSalmon" 0248 msgstr "गाढास्यालमोन" 0249 0250 #, kde-format 0251 msgctxt "color" 0252 msgid "DarkSeaGreen" 0253 msgstr "गाढा सामुद्रिक हरियो" 0254 0255 #, kde-format 0256 msgctxt "color" 0257 msgid "DarkSeaGreen1" 0258 msgstr "गाढा सामुद्रिक हरियो१" 0259 0260 #, kde-format 0261 msgctxt "color" 0262 msgid "DarkSeaGreen2" 0263 msgstr "गाढा सामुद्रिक हरियो२" 0264 0265 #, kde-format 0266 msgctxt "color" 0267 msgid "DarkSeaGreen3" 0268 msgstr "गाढा सामुद्रिक हरियो३" 0269 0270 #, kde-format 0271 msgctxt "color" 0272 msgid "DarkSeaGreen4" 0273 msgstr "गाढा सामुद्रिक हरियो४" 0274 0275 #, kde-format 0276 msgctxt "color" 0277 msgid "DarkSlateBlue" 0278 msgstr "गाढा स्लेटनीलो" 0279 0280 #, kde-format 0281 msgctxt "color" 0282 msgid "DarkSlateGray" 0283 msgstr "गाढा स्लेट खैरो" 0284 0285 #, kde-format 0286 msgctxt "color" 0287 msgid "DarkSlateGray1" 0288 msgstr "गाढा स्लेट खैरो१" 0289 0290 #, kde-format 0291 msgctxt "color" 0292 msgid "DarkSlateGray2" 0293 msgstr "गाढा स्लेट खैरो२" 0294 0295 #, kde-format 0296 msgctxt "color" 0297 msgid "DarkSlateGray3" 0298 msgstr "गाढा स्लेट खैरो३" 0299 0300 #, kde-format 0301 msgctxt "color" 0302 msgid "DarkSlateGray4" 0303 msgstr "गाढा स्लेट खैरो४" 0304 0305 #, kde-format 0306 msgctxt "color" 0307 msgid "DarkSlateGrey" 0308 msgstr "गाढा स्लेट खैरो" 0309 0310 #, kde-format 0311 msgctxt "color" 0312 msgid "DarkTurquoise" 0313 msgstr "गाढा टरक्वाइज" 0314 0315 #, kde-format 0316 msgctxt "color" 0317 msgid "DarkViolet" 0318 msgstr "गाढा बैजनी रङ्ग" 0319 0320 #, kde-format 0321 msgctxt "color" 0322 msgid "DeepPink" 0323 msgstr "गाढा गुलाबी रङ्ग" 0324 0325 #, kde-format 0326 msgctxt "color" 0327 msgid "DeepPink1" 0328 msgstr "गाढा गुलाबी रङ्ग१" 0329 0330 #, kde-format 0331 msgctxt "color" 0332 msgid "DeepPink2" 0333 msgstr "गाढा गुलाबी रङ्ग२" 0334 0335 #, kde-format 0336 msgctxt "color" 0337 msgid "DeepPink3" 0338 msgstr "गाढा गुलाबी रङ्ग३" 0339 0340 #, kde-format 0341 msgctxt "color" 0342 msgid "DeepPink4" 0343 msgstr "गाढा गुलाबी रङ्ग४" 0344 0345 #, kde-format 0346 msgctxt "color" 0347 msgid "DeepSkyBlue" 0348 msgstr "गाढा आकाशे रङ" 0349 0350 #, kde-format 0351 msgctxt "color" 0352 msgid "DeepSkyBlue1" 0353 msgstr "गाढा आकाशे रङ१" 0354 0355 #, kde-format 0356 msgctxt "color" 0357 msgid "DeepSkyBlue2" 0358 msgstr "गाढा आकाशे रङ२" 0359 0360 #, kde-format 0361 msgctxt "color" 0362 msgid "DeepSkyBlue3" 0363 msgstr "गाढा आकाशे रङ३" 0364 0365 #, kde-format 0366 msgctxt "color" 0367 msgid "DeepSkyBlue4" 0368 msgstr "गाढा आकाशे रङ४" 0369 0370 #, kde-format 0371 msgctxt "color" 0372 msgid "DimGray" 0373 msgstr "मधुरोखैरो" 0374 0375 #, kde-format 0376 msgctxt "color" 0377 msgid "DimGrey" 0378 msgstr "मधुरोखैरो" 0379 0380 #, kde-format 0381 msgctxt "color" 0382 msgid "DodgerBlue" 0383 msgstr "नीलोपाउडर" 0384 0385 #, kde-format 0386 msgctxt "color" 0387 msgid "DodgerBlue1" 0388 msgstr "डगरब्ल्यु१" 0389 0390 #, kde-format 0391 msgctxt "color" 0392 msgid "DodgerBlue2" 0393 msgstr "डगरब्लयु२" 0394 0395 #, kde-format 0396 msgctxt "color" 0397 msgid "DodgerBlue3" 0398 msgstr "डगरब्ल्यु३" 0399 0400 #, kde-format 0401 msgctxt "color" 0402 msgid "DodgerBlue4" 0403 msgstr "डगरब्ल्यु४" 0404 0405 #, kde-format 0406 msgctxt "color" 0407 msgid "FloralWhite" 0408 msgstr "स्वेतपुष्प" 0409 0410 #, kde-format 0411 msgctxt "color" 0412 msgid "ForestGreen" 0413 msgstr "हरियो वन" 0414 0415 #, kde-format 0416 msgctxt "color" 0417 msgid "GhostWhite" 0418 msgstr "घोस्टवाइट" 0419 0420 #, kde-format 0421 msgctxt "color" 0422 msgid "GreenYellow" 0423 msgstr "हरियो पहेंलो" 0424 0425 #, kde-format 0426 msgctxt "color" 0427 msgid "HotPink" 0428 msgstr "गुलाबीराप" 0429 0430 #, kde-format 0431 msgctxt "color" 0432 msgid "HotPink1" 0433 msgstr "गुलाबीराप१" 0434 0435 #, kde-format 0436 msgctxt "color" 0437 msgid "HotPink2" 0438 msgstr "गुलाबीराप२" 0439 0440 #, kde-format 0441 msgctxt "color" 0442 msgid "HotPink3" 0443 msgstr "गुलाबीराप३" 0444 0445 #, kde-format 0446 msgctxt "color" 0447 msgid "HotPink4" 0448 msgstr "गुलाबीराप४" 0449 0450 #, kde-format 0451 msgctxt "color" 0452 msgid "IndianRed" 0453 msgstr "इन्डियनरातो" 0454 0455 #, kde-format 0456 msgctxt "color" 0457 msgid "IndianRed1" 0458 msgstr "इन्डियनरातो१" 0459 0460 #, kde-format 0461 msgctxt "color" 0462 msgid "IndianRed2" 0463 msgstr "इन्डियनरातो२" 0464 0465 #, kde-format 0466 msgctxt "color" 0467 msgid "IndianRed3" 0468 msgstr "इन्डियनरातो३" 0469 0470 #, kde-format 0471 msgctxt "color" 0472 msgid "IndianRed4" 0473 msgstr "इन्डियनरातो४" 0474 0475 #, kde-format 0476 msgctxt "color" 0477 msgid "LavenderBlush" 0478 msgstr "ल्याभेन्डर ब्लस" 0479 0480 #, kde-format 0481 msgctxt "color" 0482 msgid "LavenderBlush1" 0483 msgstr "ल्याभेन्डर ब्लस१" 0484 0485 #, kde-format 0486 msgctxt "color" 0487 msgid "LavenderBlush2" 0488 msgstr "ल्याभेन्डर ब्लस२" 0489 0490 #, kde-format 0491 msgctxt "color" 0492 msgid "LavenderBlush3" 0493 msgstr "ल्याभेन्डर ब्लस३" 0494 0495 #, kde-format 0496 msgctxt "color" 0497 msgid "LavenderBlush4" 0498 msgstr "ल्याभेन्डर ब्लस४" 0499 0500 #, kde-format 0501 msgctxt "color" 0502 msgid "LawnGreen" 0503 msgstr "फिकाहरियो" 0504 0505 #, kde-format 0506 msgctxt "color" 0507 msgid "LemonChiffon" 0508 msgstr "लेमन चिफन" 0509 0510 #, kde-format 0511 msgctxt "color" 0512 msgid "LemonChiffon1" 0513 msgstr "लेमन चिफन१" 0514 0515 #, kde-format 0516 msgctxt "color" 0517 msgid "LemonChiffon2" 0518 msgstr "लेमन चिफन२" 0519 0520 #, kde-format 0521 msgctxt "color" 0522 msgid "LemonChiffon3" 0523 msgstr "लेमन चिफन३" 0524 0525 #, kde-format 0526 msgctxt "color" 0527 msgid "LemonChiffon4" 0528 msgstr "लेमन चिफन४" 0529 0530 #, kde-format 0531 msgctxt "color" 0532 msgid "LightBlue" 0533 msgstr "हल्कानीलो" 0534 0535 #, kde-format 0536 msgctxt "color" 0537 msgid "LightBlue1" 0538 msgstr "हल्कानीलो१" 0539 0540 #, kde-format 0541 msgctxt "color" 0542 msgid "LightBlue2" 0543 msgstr "हल्कानीलो२" 0544 0545 #, kde-format 0546 msgctxt "color" 0547 msgid "LightBlue3" 0548 msgstr "हल्कानीलो३" 0549 0550 #, kde-format 0551 msgctxt "color" 0552 msgid "LightBlue4" 0553 msgstr "हल्कानीलो४" 0554 0555 #, kde-format 0556 msgctxt "color" 0557 msgid "LightCoral" 0558 msgstr "हल्कामूँगी" 0559 0560 #, kde-format 0561 msgctxt "color" 0562 msgid "LightCyan" 0563 msgstr "हल्कासायन" 0564 0565 #, kde-format 0566 msgctxt "color" 0567 msgid "LightCyan1" 0568 msgstr "हल्कासायन१" 0569 0570 #, kde-format 0571 msgctxt "color" 0572 msgid "LightCyan2" 0573 msgstr "हल्कासायन२" 0574 0575 #, kde-format 0576 msgctxt "color" 0577 msgid "LightCyan3" 0578 msgstr "हल्कासायन३" 0579 0580 #, kde-format 0581 msgctxt "color" 0582 msgid "LightCyan4" 0583 msgstr "हल्कासायन४" 0584 0585 #, kde-format 0586 msgctxt "color" 0587 msgid "LightGoldenrod" 0588 msgstr "लाइटगोल्डेन रड" 0589 0590 #, kde-format 0591 msgctxt "color" 0592 msgid "LightGoldenrod1" 0593 msgstr "लाइटगोल्डेन रड१" 0594 0595 #, kde-format 0596 msgctxt "color" 0597 msgid "LightGoldenrod2" 0598 msgstr "लाइटगोल्डेन रड२" 0599 0600 #, kde-format 0601 msgctxt "color" 0602 msgid "LightGoldenrod3" 0603 msgstr "लाइटगोल्डेन रड३" 0604 0605 #, kde-format 0606 msgctxt "color" 0607 msgid "LightGoldenrod4" 0608 msgstr "लाइटगोल्डेन रड४" 0609 0610 #, kde-format 0611 msgctxt "color" 0612 msgid "LightGoldenrodYellow" 0613 msgstr "हल्का गोल्डेन रड पहेँलो" 0614 0615 #, kde-format 0616 msgctxt "color" 0617 msgid "LightGray" 0618 msgstr "हल्काखैरो" 0619 0620 #, kde-format 0621 msgctxt "color" 0622 msgid "LightGreen" 0623 msgstr "हल्काहरियो" 0624 0625 #, kde-format 0626 msgctxt "color" 0627 msgid "LightGrey" 0628 msgstr "हल्काखैरो" 0629 0630 #, kde-format 0631 msgctxt "color" 0632 msgid "LightPink" 0633 msgstr "हल्कागुलाबी" 0634 0635 #, kde-format 0636 msgctxt "color" 0637 msgid "LightPink1" 0638 msgstr "हल्कागुलाबी१" 0639 0640 #, kde-format 0641 msgctxt "color" 0642 msgid "LightPink2" 0643 msgstr "हल्कागुलाबी२" 0644 0645 #, kde-format 0646 msgctxt "color" 0647 msgid "LightPink3" 0648 msgstr "हल्कागुलाबी३" 0649 0650 #, kde-format 0651 msgctxt "color" 0652 msgid "LightPink4" 0653 msgstr "हल्कागुलाबी४" 0654 0655 #, kde-format 0656 msgctxt "color" 0657 msgid "LightSalmon" 0658 msgstr "हल्कास्यालमोन" 0659 0660 #, kde-format 0661 msgctxt "color" 0662 msgid "LightSalmon1" 0663 msgstr "हल्कास्यालमोन१" 0664 0665 #, kde-format 0666 msgctxt "color" 0667 msgid "LightSalmon2" 0668 msgstr "हल्कास्यालमोन२" 0669 0670 #, kde-format 0671 msgctxt "color" 0672 msgid "LightSalmon3" 0673 msgstr "हल्कास्यालमोन३" 0674 0675 #, kde-format 0676 msgctxt "color" 0677 msgid "LightSalmon4" 0678 msgstr "हल्कास्यालमोन४" 0679 0680 #, kde-format 0681 msgctxt "color" 0682 msgid "LightSeaGreen" 0683 msgstr "हल्का सामुद्रिक हरियो" 0684 0685 #, kde-format 0686 msgctxt "color" 0687 msgid "LightSkyBlue" 0688 msgstr "हल्काआकाशे रङ" 0689 0690 #, kde-format 0691 msgctxt "color" 0692 msgid "LightSkyBlue1" 0693 msgstr "हल्काआकाशे रङ१" 0694 0695 #, kde-format 0696 msgctxt "color" 0697 msgid "LightSkyBlue2" 0698 msgstr "हल्काआकाशे रङ२" 0699 0700 #, kde-format 0701 msgctxt "color" 0702 msgid "LightSkyBlue3" 0703 msgstr "हल्काआकाशे रङ३" 0704 0705 #, kde-format 0706 msgctxt "color" 0707 msgid "LightSkyBlue4" 0708 msgstr "हल्काआकाशे रङ४" 0709 0710 #, kde-format 0711 msgctxt "color" 0712 msgid "LightSlateBlue" 0713 msgstr "हल्का स्लेट नीलो" 0714 0715 #, kde-format 0716 msgctxt "color" 0717 msgid "LightSlateGray" 0718 msgstr "हल्का स्लेट खैरो" 0719 0720 #, kde-format 0721 msgctxt "color" 0722 msgid "LightSlateGrey" 0723 msgstr "हल्का स्लेट खैरो" 0724 0725 #, kde-format 0726 msgctxt "color" 0727 msgid "LightSteelBlue" 0728 msgstr "हल्का स्टिल नीलो" 0729 0730 #, kde-format 0731 msgctxt "color" 0732 msgid "LightSteelBlue1" 0733 msgstr "हल्का स्टिल नीलो१" 0734 0735 #, kde-format 0736 msgctxt "color" 0737 msgid "LightSteelBlue2" 0738 msgstr "हल्का स्टिल नीलो२" 0739 0740 #, kde-format 0741 msgctxt "color" 0742 msgid "LightSteelBlue3" 0743 msgstr "हल्का स्टिल नीलो३" 0744 0745 #, kde-format 0746 msgctxt "color" 0747 msgid "LightSteelBlue4" 0748 msgstr "हल्का स्टिल नीलो४" 0749 0750 #, kde-format 0751 msgctxt "color" 0752 msgid "LightYellow" 0753 msgstr "हल्कापहेंलो" 0754 0755 #, kde-format 0756 msgctxt "color" 0757 msgid "LightYellow1" 0758 msgstr "हल्कापहेंलो१" 0759 0760 #, kde-format 0761 msgctxt "color" 0762 msgid "LightYellow2" 0763 msgstr "हल्कापहेंलो२" 0764 0765 #, kde-format 0766 msgctxt "color" 0767 msgid "LightYellow3" 0768 msgstr "हल्कापहेंलो३" 0769 0770 #, kde-format 0771 msgctxt "color" 0772 msgid "LightYellow4" 0773 msgstr "हल्कापहेंलो४" 0774 0775 #, kde-format 0776 msgctxt "color" 0777 msgid "LimeGreen" 0778 msgstr "हल्काहरियो" 0779 0780 #, kde-format 0781 msgctxt "color" 0782 msgid "MediumAquamarine" 0783 msgstr "मध्यम बेरूज" 0784 0785 #, kde-format 0786 msgctxt "color" 0787 msgid "MediumBlue" 0788 msgstr "मध्यम नीलो" 0789 0790 #, kde-format 0791 msgctxt "color" 0792 msgid "MediumOrchid" 0793 msgstr "मध्यम ऑर्किड" 0794 0795 #, kde-format 0796 msgctxt "color" 0797 msgid "MediumOrchid1" 0798 msgstr "मध्यम ऑर्किड१" 0799 0800 #, kde-format 0801 msgctxt "color" 0802 msgid "MediumOrchid2" 0803 msgstr "मध्यम ऑर्किड१" 0804 0805 #, kde-format 0806 msgctxt "color" 0807 msgid "MediumOrchid3" 0808 msgstr "मध्यम ऑर्किड३" 0809 0810 #, kde-format 0811 msgctxt "color" 0812 msgid "MediumOrchid4" 0813 msgstr "मध्यम ऑर्किड४" 0814 0815 #, kde-format 0816 msgctxt "color" 0817 msgid "MediumPurple" 0818 msgstr "मध्यबैजनी" 0819 0820 #, kde-format 0821 msgctxt "color" 0822 msgid "MediumPurple1" 0823 msgstr "मध्यबैजनी१" 0824 0825 #, kde-format 0826 msgctxt "color" 0827 msgid "MediumPurple2" 0828 msgstr "मध्यबैजनी२" 0829 0830 #, kde-format 0831 msgctxt "color" 0832 msgid "MediumPurple3" 0833 msgstr "मध्यबैजनी३" 0834 0835 #, kde-format 0836 msgctxt "color" 0837 msgid "MediumPurple4" 0838 msgstr "मध्यबैजनी४" 0839 0840 #, kde-format 0841 msgctxt "color" 0842 msgid "MediumSeaGreen" 0843 msgstr "मध्यम सामुद्रिक हरियो" 0844 0845 #, kde-format 0846 msgctxt "color" 0847 msgid "MediumSlateBlue" 0848 msgstr "मध्यम स्लेट नीलो" 0849 0850 #, kde-format 0851 msgctxt "color" 0852 msgid "MediumSpringGreen" 0853 msgstr "मध्यम स्प्रिङ हरियो" 0854 0855 #, kde-format 0856 msgctxt "color" 0857 msgid "MediumTurquoise" 0858 msgstr "मध्यम टर्क्वाइज" 0859 0860 #, kde-format 0861 msgctxt "color" 0862 msgid "MediumVioletRed" 0863 msgstr "मध्यम भाइलेट रातो" 0864 0865 #, kde-format 0866 msgctxt "color" 0867 msgid "MidnightBlue" 0868 msgstr "मध्यरात्री नीलो" 0869 0870 #, kde-format 0871 msgctxt "color" 0872 msgid "MintCream" 0873 msgstr "मिन्टक्रिम" 0874 0875 #, kde-format 0876 msgctxt "color" 0877 msgid "MistyRose" 0878 msgstr "असुगम गुलाब" 0879 0880 #, kde-format 0881 msgctxt "color" 0882 msgid "MistyRose1" 0883 msgstr "असुगम गुलाब१" 0884 0885 #, kde-format 0886 msgctxt "color" 0887 msgid "MistyRose2" 0888 msgstr "असुगम गुलाब२" 0889 0890 #, kde-format 0891 msgctxt "color" 0892 msgid "MistyRose3" 0893 msgstr "असुगम गुलाब३" 0894 0895 #, kde-format 0896 msgctxt "color" 0897 msgid "MistyRose4" 0898 msgstr "असुगम गुलाब४" 0899 0900 #, kde-format 0901 msgctxt "color" 0902 msgid "NavajoWhite" 0903 msgstr "नाभाजो वाइट" 0904 0905 #, kde-format 0906 msgctxt "color" 0907 msgid "NavajoWhite1" 0908 msgstr "नाभाजो वाइट१" 0909 0910 #, kde-format 0911 msgctxt "color" 0912 msgid "NavajoWhite2" 0913 msgstr "नाभाजो वाइट२" 0914 0915 #, kde-format 0916 msgctxt "color" 0917 msgid "NavajoWhite3" 0918 msgstr "नाभाजो वाइट३" 0919 0920 #, kde-format 0921 msgctxt "color" 0922 msgid "NavajoWhite4" 0923 msgstr "नाभाजो वाइट४" 0924 0925 #, kde-format 0926 msgctxt "color" 0927 msgid "NavyBlue" 0928 msgstr "नेभीब्ल्यु" 0929 0930 #, kde-format 0931 msgctxt "color" 0932 msgid "OldLace" 0933 msgstr "पुरानोडोरी" 0934 0935 #, kde-format 0936 msgctxt "color" 0937 msgid "OliveDrab" 0938 msgstr "ओलिभड्रयाब" 0939 0940 #, kde-format 0941 msgctxt "color" 0942 msgid "OliveDrab1" 0943 msgstr "ओलिभड्रयाब१" 0944 0945 #, kde-format 0946 msgctxt "color" 0947 msgid "OliveDrab2" 0948 msgstr "ओलिभड्रयाब२" 0949 0950 #, kde-format 0951 msgctxt "color" 0952 msgid "OliveDrab3" 0953 msgstr "ओलिभड्रयाब३" 0954 0955 #, kde-format 0956 msgctxt "color" 0957 msgid "OliveDrab4" 0958 msgstr "ओलिभड्रयाब४" 0959 0960 #, kde-format 0961 msgctxt "color" 0962 msgid "OrangeRed" 0963 msgstr "सुन्तले रातो" 0964 0965 #, kde-format 0966 msgctxt "color" 0967 msgid "OrangeRed1" 0968 msgstr "सुन्तले रातो१" 0969 0970 #, kde-format 0971 msgctxt "color" 0972 msgid "OrangeRed2" 0973 msgstr "सुन्तले रातो२" 0974 0975 #, kde-format 0976 msgctxt "color" 0977 msgid "OrangeRed3" 0978 msgstr "सुन्तले रातो३" 0979 0980 #, kde-format 0981 msgctxt "color" 0982 msgid "OrangeRed4" 0983 msgstr "सुन्तले रातो४" 0984 0985 #, kde-format 0986 msgctxt "color" 0987 msgid "PaleGoldenrod" 0988 msgstr "फिक्का गोल्डेनरड" 0989 0990 #, kde-format 0991 msgctxt "color" 0992 msgid "PaleGreen" 0993 msgstr "फिकाहरियो" 0994 0995 #, kde-format 0996 msgctxt "color" 0997 msgid "PaleGreen1" 0998 msgstr "फिकाहरियो१" 0999 1000 #, kde-format 1001 msgctxt "color" 1002 msgid "PaleGreen2" 1003 msgstr "फिकाहरियो२" 1004 1005 #, kde-format 1006 msgctxt "color" 1007 msgid "PaleGreen3" 1008 msgstr "फिकाहरियो३" 1009 1010 #, kde-format 1011 msgctxt "color" 1012 msgid "PaleGreen4" 1013 msgstr "फिकाहरियो४" 1014 1015 #, kde-format 1016 msgctxt "color" 1017 msgid "PaleTurquoise" 1018 msgstr "फिक्का पीरोजा" 1019 1020 #, kde-format 1021 msgctxt "color" 1022 msgid "PaleTurquoise1" 1023 msgstr "फिक्का पीरोजा१" 1024 1025 #, kde-format 1026 msgctxt "color" 1027 msgid "PaleTurquoise2" 1028 msgstr "फिक्का पीरोजा२" 1029 1030 #, kde-format 1031 msgctxt "color" 1032 msgid "PaleTurquoise3" 1033 msgstr "फिक्का पीरोजा३" 1034 1035 #, kde-format 1036 msgctxt "color" 1037 msgid "PaleTurquoise4" 1038 msgstr "फिक्का पीरोजा४" 1039 1040 #, kde-format 1041 msgctxt "color" 1042 msgid "PaleVioletRed" 1043 msgstr "फिक्का भाइलेट रातो" 1044 1045 #, kde-format 1046 msgctxt "color" 1047 msgid "PaleVioletRed1" 1048 msgstr "फिक्का भाइलेट रातो१" 1049 1050 #, kde-format 1051 msgctxt "color" 1052 msgid "PaleVioletRed2" 1053 msgstr "फिक्का भाइलेट रातो२" 1054 1055 #, kde-format 1056 msgctxt "color" 1057 msgid "PaleVioletRed3" 1058 msgstr "फिक्का भाइलेट रातो३" 1059 1060 #, kde-format 1061 msgctxt "color" 1062 msgid "PaleVioletRed4" 1063 msgstr "फिक्का भाइलेट रातो४" 1064 1065 #, kde-format 1066 msgctxt "color" 1067 msgid "PapayaWhip" 1068 msgstr "पपयाविप" 1069 1070 #, kde-format 1071 msgctxt "color" 1072 msgid "PeachPuff" 1073 msgstr "पिचपफ" 1074 1075 #, kde-format 1076 msgctxt "color" 1077 msgid "PeachPuff1" 1078 msgstr "पिचपफ१" 1079 1080 #, kde-format 1081 msgctxt "color" 1082 msgid "PeachPuff2" 1083 msgstr "पिचपफ२" 1084 1085 #, kde-format 1086 msgctxt "color" 1087 msgid "PeachPuff3" 1088 msgstr "पिचपफ३" 1089 1090 #, kde-format 1091 msgctxt "color" 1092 msgid "PeachPuff4" 1093 msgstr "पिचपफ४" 1094 1095 #, kde-format 1096 msgctxt "color" 1097 msgid "PowderBlue" 1098 msgstr "नीलोपाउडर" 1099 1100 #, kde-format 1101 msgctxt "color" 1102 msgid "RosyBrown" 1103 msgstr "गुलाबीखैरो" 1104 1105 #, kde-format 1106 msgctxt "color" 1107 msgid "RosyBrown1" 1108 msgstr "गुलाबीखैरो१" 1109 1110 #, kde-format 1111 msgctxt "color" 1112 msgid "RosyBrown2" 1113 msgstr "गुलाबीखैरो२" 1114 1115 #, kde-format 1116 msgctxt "color" 1117 msgid "RosyBrown3" 1118 msgstr "गुलाबीखैरो३" 1119 1120 #, kde-format 1121 msgctxt "color" 1122 msgid "RosyBrown4" 1123 msgstr "गुलाबीखैरो४" 1124 1125 #, kde-format 1126 msgctxt "color" 1127 msgid "RoyalBlue" 1128 msgstr "रोयलब्ल्यु" 1129 1130 #, kde-format 1131 msgctxt "color" 1132 msgid "RoyalBlue1" 1133 msgstr "रोयलब्ल्यु१" 1134 1135 #, kde-format 1136 msgctxt "color" 1137 msgid "RoyalBlue2" 1138 msgstr "रोयलब्ल्यु२" 1139 1140 #, kde-format 1141 msgctxt "color" 1142 msgid "RoyalBlue3" 1143 msgstr "रोयलब्ल्यु३" 1144 1145 #, kde-format 1146 msgctxt "color" 1147 msgid "RoyalBlue4" 1148 msgstr "रोयलब्ल्यु४" 1149 1150 #, kde-format 1151 msgctxt "color" 1152 msgid "SaddleBrown" 1153 msgstr "काठीखैरो" 1154 1155 #, kde-format 1156 msgctxt "color" 1157 msgid "SandyBrown" 1158 msgstr "बलौटेखैरो" 1159 1160 #, kde-format 1161 msgctxt "color" 1162 msgid "SeaGreen" 1163 msgstr "सामुद्रिक हरियो" 1164 1165 #, kde-format 1166 msgctxt "color" 1167 msgid "SeaGreen1" 1168 msgstr "सामुद्रिक हरियो१" 1169 1170 #, kde-format 1171 msgctxt "color" 1172 msgid "SeaGreen2" 1173 msgstr "सामुद्रिक हरियो२" 1174 1175 #, kde-format 1176 msgctxt "color" 1177 msgid "SeaGreen3" 1178 msgstr "सामुद्रिक हरियो३" 1179 1180 #, kde-format 1181 msgctxt "color" 1182 msgid "SeaGreen4" 1183 msgstr "सामुद्रिक हरियो४" 1184 1185 #, kde-format 1186 msgctxt "color" 1187 msgid "SkyBlue" 1188 msgstr "आकाशीनीलो" 1189 1190 #, kde-format 1191 msgctxt "color" 1192 msgid "SkyBlue1" 1193 msgstr "आकाशीनीलो१" 1194 1195 #, kde-format 1196 msgctxt "color" 1197 msgid "SkyBlue2" 1198 msgstr "आकाशीनीलो२" 1199 1200 #, kde-format 1201 msgctxt "color" 1202 msgid "SkyBlue3" 1203 msgstr "आकाशीनीलो३" 1204 1205 #, kde-format 1206 msgctxt "color" 1207 msgid "SkyBlue4" 1208 msgstr "आकाशीनीलो४" 1209 1210 #, kde-format 1211 msgctxt "color" 1212 msgid "SlateBlue" 1213 msgstr "स्लेटनीलो" 1214 1215 #, kde-format 1216 msgctxt "color" 1217 msgid "SlateBlue1" 1218 msgstr "स्लेटनीलो१" 1219 1220 #, kde-format 1221 msgctxt "color" 1222 msgid "SlateBlue2" 1223 msgstr "स्लेटनीलो२" 1224 1225 #, kde-format 1226 msgctxt "color" 1227 msgid "SlateBlue3" 1228 msgstr "स्लेटनीलो३" 1229 1230 #, kde-format 1231 msgctxt "color" 1232 msgid "SlateBlue4" 1233 msgstr "स्लेटनीलो४" 1234 1235 #, kde-format 1236 msgctxt "color" 1237 msgid "SlateGray" 1238 msgstr "स्लेटखैरो" 1239 1240 #, kde-format 1241 msgctxt "color" 1242 msgid "SlateGray1" 1243 msgstr "स्लेटखैरो१" 1244 1245 #, kde-format 1246 msgctxt "color" 1247 msgid "SlateGray2" 1248 msgstr "स्लेटखैरो२" 1249 1250 #, kde-format 1251 msgctxt "color" 1252 msgid "SlateGray3" 1253 msgstr "स्लेटखैरो३" 1254 1255 #, kde-format 1256 msgctxt "color" 1257 msgid "SlateGray4" 1258 msgstr "स्लेटखैरो४" 1259 1260 #, kde-format 1261 msgctxt "color" 1262 msgid "SlateGrey" 1263 msgstr "स्लेटखैरो" 1264 1265 #, kde-format 1266 msgctxt "color" 1267 msgid "SpringGreen" 1268 msgstr "हल्काहरियो" 1269 1270 #, kde-format 1271 msgctxt "color" 1272 msgid "SpringGreen1" 1273 msgstr "हल्काहरियो१" 1274 1275 #, kde-format 1276 msgctxt "color" 1277 msgid "SpringGreen2" 1278 msgstr "हल्काहरियो२" 1279 1280 #, kde-format 1281 msgctxt "color" 1282 msgid "SpringGreen3" 1283 msgstr "हल्काहरियो३" 1284 1285 #, kde-format 1286 msgctxt "color" 1287 msgid "SpringGreen4" 1288 msgstr "हल्काहरियो४" 1289 1290 #, kde-format 1291 msgctxt "color" 1292 msgid "SteelBlue" 1293 msgstr "स्टिल नीलो" 1294 1295 #, kde-format 1296 msgctxt "color" 1297 msgid "SteelBlue1" 1298 msgstr "स्टिल नीलो१" 1299 1300 #, kde-format 1301 msgctxt "color" 1302 msgid "SteelBlue2" 1303 msgstr "स्टिल नीलो२" 1304 1305 #, kde-format 1306 msgctxt "color" 1307 msgid "SteelBlue3" 1308 msgstr "स्टिल नीलो३" 1309 1310 #, kde-format 1311 msgctxt "color" 1312 msgid "SteelBlue4" 1313 msgstr "स्टिल नीलो४" 1314 1315 #, kde-format 1316 msgctxt "color" 1317 msgid "VioletRed" 1318 msgstr "भाइलेट रातो" 1319 1320 #, kde-format 1321 msgctxt "color" 1322 msgid "VioletRed1" 1323 msgstr "भाइलेट रातो१" 1324 1325 #, kde-format 1326 msgctxt "color" 1327 msgid "VioletRed2" 1328 msgstr "भाइलेट रातो२" 1329 1330 #, kde-format 1331 msgctxt "color" 1332 msgid "VioletRed3" 1333 msgstr "भाइलेट रातो३" 1334 1335 #, kde-format 1336 msgctxt "color" 1337 msgid "VioletRed4" 1338 msgstr "भाइलेट रातो४" 1339 1340 #, kde-format 1341 msgctxt "color" 1342 msgid "WhiteSmoke" 1343 msgstr "सेतोधुँवा" 1344 1345 #, kde-format 1346 msgctxt "color" 1347 msgid "YellowGreen" 1348 msgstr "पहेँलोहरियो" 1349 1350 #, kde-format 1351 msgctxt "color" 1352 msgid "aquamarine" 1353 msgstr "बेरूज" 1354 1355 #, kde-format 1356 msgctxt "color" 1357 msgid "aquamarine1" 1358 msgstr "बेरूज१" 1359 1360 #, kde-format 1361 msgctxt "color" 1362 msgid "aquamarine2" 1363 msgstr "बेरूज२" 1364 1365 #, kde-format 1366 msgctxt "color" 1367 msgid "aquamarine3" 1368 msgstr "बेरूज३" 1369 1370 #, kde-format 1371 msgctxt "color" 1372 msgid "aquamarine4" 1373 msgstr "बेरूज४" 1374 1375 #, kde-format 1376 msgctxt "color" 1377 msgid "azure" 1378 msgstr "नीलाकाश" 1379 1380 #, kde-format 1381 msgctxt "color" 1382 msgid "azure1" 1383 msgstr "नीलाकाश१" 1384 1385 #, kde-format 1386 msgctxt "color" 1387 msgid "azure2" 1388 msgstr "नीलाकाश२" 1389 1390 #, kde-format 1391 msgctxt "color" 1392 msgid "azure3" 1393 msgstr "नीलाकाश३" 1394 1395 #, kde-format 1396 msgctxt "color" 1397 msgid "azure4" 1398 msgstr "नीलाकाश४" 1399 1400 #, kde-format 1401 msgctxt "color" 1402 msgid "beige" 1403 msgstr "मटमैळा" 1404 1405 #, kde-format 1406 msgctxt "color" 1407 msgid "bisque" 1408 msgstr "बिस्की" 1409 1410 #, kde-format 1411 msgctxt "color" 1412 msgid "bisque1" 1413 msgstr "बिस्की१" 1414 1415 #, kde-format 1416 msgctxt "color" 1417 msgid "bisque2" 1418 msgstr "बिस्की२" 1419 1420 #, kde-format 1421 msgctxt "color" 1422 msgid "bisque3" 1423 msgstr "बिस्की३" 1424 1425 #, kde-format 1426 msgctxt "color" 1427 msgid "bisque4" 1428 msgstr "बिस्की४" 1429 1430 #, kde-format 1431 msgctxt "color" 1432 msgid "black" 1433 msgstr "कालो" 1434 1435 #, kde-format 1436 msgctxt "color" 1437 msgid "blue" 1438 msgstr "नीलो" 1439 1440 #, kde-format 1441 msgctxt "color" 1442 msgid "blue1" 1443 msgstr "नीलो१" 1444 1445 #, kde-format 1446 msgctxt "color" 1447 msgid "blue2" 1448 msgstr "नीलो२" 1449 1450 #, kde-format 1451 msgctxt "color" 1452 msgid "blue3" 1453 msgstr "नीलो३" 1454 1455 #, kde-format 1456 msgctxt "color" 1457 msgid "blue4" 1458 msgstr "नीलो४" 1459 1460 #, kde-format 1461 msgctxt "color" 1462 msgid "brown" 1463 msgstr "खैरो" 1464 1465 #, kde-format 1466 msgctxt "color" 1467 msgid "brown1" 1468 msgstr "खैरो१" 1469 1470 #, kde-format 1471 msgctxt "color" 1472 msgid "brown2" 1473 msgstr "खैरो२" 1474 1475 #, kde-format 1476 msgctxt "color" 1477 msgid "brown3" 1478 msgstr "खैरो३" 1479 1480 #, kde-format 1481 msgctxt "color" 1482 msgid "brown4" 1483 msgstr "खैरो४" 1484 1485 #, kde-format 1486 msgctxt "color" 1487 msgid "burlywood" 1488 msgstr "बर्लिउड" 1489 1490 #, kde-format 1491 msgctxt "color" 1492 msgid "burlywood1" 1493 msgstr "बर्लिउड१" 1494 1495 #, kde-format 1496 msgctxt "color" 1497 msgid "burlywood2" 1498 msgstr "बर्लिउड२" 1499 1500 #, kde-format 1501 msgctxt "color" 1502 msgid "burlywood3" 1503 msgstr "बर्लिउड३" 1504 1505 #, kde-format 1506 msgctxt "color" 1507 msgid "burlywood4" 1508 msgstr "बर्लिउड४" 1509 1510 #, kde-format 1511 msgctxt "color" 1512 msgid "chartreuse" 1513 msgstr "चार्टरयुज" 1514 1515 #, kde-format 1516 msgctxt "color" 1517 msgid "chartreuse1" 1518 msgstr "चार्टरयुज१" 1519 1520 #, kde-format 1521 msgctxt "color" 1522 msgid "chartreuse2" 1523 msgstr "चार्टरयुज२" 1524 1525 #, kde-format 1526 msgctxt "color" 1527 msgid "chartreuse3" 1528 msgstr "चार्टरयुज३" 1529 1530 #, kde-format 1531 msgctxt "color" 1532 msgid "chartreuse4" 1533 msgstr "चार्टरयुज४" 1534 1535 #, kde-format 1536 msgctxt "color" 1537 msgid "chocolate" 1538 msgstr "चकलेट" 1539 1540 #, kde-format 1541 msgctxt "color" 1542 msgid "chocolate1" 1543 msgstr "चकलेट१" 1544 1545 #, kde-format 1546 msgctxt "color" 1547 msgid "chocolate2" 1548 msgstr "चकलेट२" 1549 1550 #, kde-format 1551 msgctxt "color" 1552 msgid "chocolate3" 1553 msgstr "चकलेट३" 1554 1555 #, kde-format 1556 msgctxt "color" 1557 msgid "chocolate4" 1558 msgstr "चकलेट४" 1559 1560 #, kde-format 1561 msgctxt "color" 1562 msgid "coral" 1563 msgstr "कोरल" 1564 1565 #, kde-format 1566 msgctxt "color" 1567 msgid "coral1" 1568 msgstr "कोरल१" 1569 1570 #, kde-format 1571 msgctxt "color" 1572 msgid "coral2" 1573 msgstr "कोरल२" 1574 1575 #, kde-format 1576 msgctxt "color" 1577 msgid "coral3" 1578 msgstr "कोरल३" 1579 1580 #, kde-format 1581 msgctxt "color" 1582 msgid "coral4" 1583 msgstr "कोरल४" 1584 1585 #, kde-format 1586 msgctxt "color" 1587 msgid "cornsilk" 1588 msgstr "रेश्मीमकै" 1589 1590 #, kde-format 1591 msgctxt "color" 1592 msgid "cornsilk1" 1593 msgstr "रेश्मीमकै१" 1594 1595 #, kde-format 1596 msgctxt "color" 1597 msgid "cornsilk2" 1598 msgstr "रेश्मीमकै२" 1599 1600 #, kde-format 1601 msgctxt "color" 1602 msgid "cornsilk3" 1603 msgstr "रेश्मीमकै३" 1604 1605 #, kde-format 1606 msgctxt "color" 1607 msgid "cornsilk4" 1608 msgstr "रेश्मीमकै४" 1609 1610 #, kde-format 1611 msgctxt "color" 1612 msgid "cyan" 1613 msgstr "सायन" 1614 1615 #, kde-format 1616 msgctxt "color" 1617 msgid "cyan1" 1618 msgstr "सायन१" 1619 1620 #, kde-format 1621 msgctxt "color" 1622 msgid "cyan2" 1623 msgstr "सायन२" 1624 1625 #, kde-format 1626 msgctxt "color" 1627 msgid "cyan3" 1628 msgstr "सायन३" 1629 1630 #, kde-format 1631 msgctxt "color" 1632 msgid "cyan4" 1633 msgstr "सायन४" 1634 1635 #, kde-format 1636 msgctxt "color" 1637 msgid "firebrick" 1638 msgstr "फायरब्रिक" 1639 1640 #, kde-format 1641 msgctxt "color" 1642 msgid "firebrick1" 1643 msgstr "फायरब्रिक१" 1644 1645 #, kde-format 1646 msgctxt "color" 1647 msgid "firebrick2" 1648 msgstr "फायरब्रिक२" 1649 1650 #, kde-format 1651 msgctxt "color" 1652 msgid "firebrick3" 1653 msgstr "फायरब्रिक३" 1654 1655 #, kde-format 1656 msgctxt "color" 1657 msgid "firebrick4" 1658 msgstr "फायरब्रिक४" 1659 1660 #, kde-format 1661 msgctxt "color" 1662 msgid "gainsboro" 1663 msgstr "गेन्सबोरो" 1664 1665 #, kde-format 1666 msgctxt "color" 1667 msgid "gold" 1668 msgstr "गोल्ड" 1669 1670 #, kde-format 1671 msgctxt "color" 1672 msgid "gold1" 1673 msgstr "गोल्ड१" 1674 1675 #, kde-format 1676 msgctxt "color" 1677 msgid "gold2" 1678 msgstr "गोल्ड२" 1679 1680 #, kde-format 1681 msgctxt "color" 1682 msgid "gold3" 1683 msgstr "गोल्ड३" 1684 1685 #, kde-format 1686 msgctxt "color" 1687 msgid "gold4" 1688 msgstr "गोल्ड४" 1689 1690 #, kde-format 1691 msgctxt "color" 1692 msgid "goldenrod" 1693 msgstr "गोल्डेनरड" 1694 1695 #, kde-format 1696 msgctxt "color" 1697 msgid "goldenrod1" 1698 msgstr "गोल्डेनरड१" 1699 1700 #, kde-format 1701 msgctxt "color" 1702 msgid "goldenrod2" 1703 msgstr "गोल्डेनरड२" 1704 1705 #, kde-format 1706 msgctxt "color" 1707 msgid "goldenrod3" 1708 msgstr "गोल्डेनरड३" 1709 1710 #, kde-format 1711 msgctxt "color" 1712 msgid "goldenrod4" 1713 msgstr "गोल्डेन रड४" 1714 1715 #, kde-format 1716 msgctxt "color" 1717 msgid "green" 1718 msgstr "हरियो" 1719 1720 #, kde-format 1721 msgctxt "color" 1722 msgid "green1" 1723 msgstr "हरियो१" 1724 1725 #, kde-format 1726 msgctxt "color" 1727 msgid "green2" 1728 msgstr "हरियो२" 1729 1730 #, kde-format 1731 msgctxt "color" 1732 msgid "green3" 1733 msgstr "हरियो३" 1734 1735 #, kde-format 1736 msgctxt "color" 1737 msgid "green4" 1738 msgstr "हरियो४" 1739 1740 #, kde-format 1741 msgctxt "color" 1742 msgid "honeydew" 1743 msgstr "ओसिलोमह" 1744 1745 #, kde-format 1746 msgctxt "color" 1747 msgid "honeydew1" 1748 msgstr "ओसिलोमह१" 1749 1750 #, kde-format 1751 msgctxt "color" 1752 msgid "honeydew2" 1753 msgstr "ओसिलोमह२" 1754 1755 #, kde-format 1756 msgctxt "color" 1757 msgid "honeydew3" 1758 msgstr "ओसिलोमह३" 1759 1760 #, kde-format 1761 msgctxt "color" 1762 msgid "honeydew4" 1763 msgstr "ओसिलोमह४" 1764 1765 #, kde-format 1766 msgctxt "color" 1767 msgid "ivory" 1768 msgstr "गजदन्त" 1769 1770 #, kde-format 1771 msgctxt "color" 1772 msgid "ivory1" 1773 msgstr "गजदन्त१" 1774 1775 #, kde-format 1776 msgctxt "color" 1777 msgid "ivory2" 1778 msgstr "गजदन्त२" 1779 1780 #, kde-format 1781 msgctxt "color" 1782 msgid "ivory3" 1783 msgstr "गजदन्त३" 1784 1785 #, kde-format 1786 msgctxt "color" 1787 msgid "ivory4" 1788 msgstr "गजदन्त४" 1789 1790 #, kde-format 1791 msgctxt "color" 1792 msgid "khaki" 1793 msgstr "खाकी" 1794 1795 #, kde-format 1796 msgctxt "color" 1797 msgid "khaki1" 1798 msgstr "खाकी१" 1799 1800 #, kde-format 1801 msgctxt "color" 1802 msgid "khaki2" 1803 msgstr "खाकी२" 1804 1805 #, kde-format 1806 msgctxt "color" 1807 msgid "khaki3" 1808 msgstr "खाकी३" 1809 1810 #, kde-format 1811 msgctxt "color" 1812 msgid "khaki4" 1813 msgstr "खाकी४" 1814 1815 #, kde-format 1816 msgctxt "color" 1817 msgid "lavender" 1818 msgstr "ल्याभेन्डर" 1819 1820 #, kde-format 1821 msgctxt "color" 1822 msgid "linen" 1823 msgstr "लिनेन" 1824 1825 #, kde-format 1826 msgctxt "color" 1827 msgid "magenta" 1828 msgstr "म्याजेन्टा" 1829 1830 #, kde-format 1831 msgctxt "color" 1832 msgid "magenta1" 1833 msgstr "म्याजेन्टा१" 1834 1835 #, kde-format 1836 msgctxt "color" 1837 msgid "magenta2" 1838 msgstr "म्याजेन्टा२" 1839 1840 #, kde-format 1841 msgctxt "color" 1842 msgid "magenta3" 1843 msgstr "म्याजेन्टा३" 1844 1845 #, kde-format 1846 msgctxt "color" 1847 msgid "magenta4" 1848 msgstr "म्याजेन्टा४" 1849 1850 #, kde-format 1851 msgctxt "color" 1852 msgid "maroon" 1853 msgstr "मारोन" 1854 1855 #, kde-format 1856 msgctxt "color" 1857 msgid "maroon1" 1858 msgstr "मारोन१" 1859 1860 #, kde-format 1861 msgctxt "color" 1862 msgid "maroon2" 1863 msgstr "मारोन२" 1864 1865 #, kde-format 1866 msgctxt "color" 1867 msgid "maroon3" 1868 msgstr "मारोन३" 1869 1870 #, kde-format 1871 msgctxt "color" 1872 msgid "maroon4" 1873 msgstr "मारोन४" 1874 1875 #, kde-format 1876 msgctxt "color" 1877 msgid "moccasin" 1878 msgstr "मोक्कासिन" 1879 1880 #, kde-format 1881 msgctxt "color" 1882 msgid "navy" 1883 msgstr "नेभी" 1884 1885 #, kde-format 1886 msgctxt "color" 1887 msgid "orange" 1888 msgstr "सुन्तले रङ" 1889 1890 #, kde-format 1891 msgctxt "color" 1892 msgid "orange1" 1893 msgstr "सुन्तले रङ१" 1894 1895 #, kde-format 1896 msgctxt "color" 1897 msgid "orange2" 1898 msgstr "सुन्तले रङ२" 1899 1900 #, kde-format 1901 msgctxt "color" 1902 msgid "orange3" 1903 msgstr "सुन्तले रङ३" 1904 1905 #, kde-format 1906 msgctxt "color" 1907 msgid "orange4" 1908 msgstr "सुन्तले रङ४" 1909 1910 #, kde-format 1911 msgctxt "color" 1912 msgid "orchid" 1913 msgstr "आँर्किड" 1914 1915 #, kde-format 1916 msgctxt "color" 1917 msgid "orchid1" 1918 msgstr "आँर्किड१" 1919 1920 #, kde-format 1921 msgctxt "color" 1922 msgid "orchid2" 1923 msgstr "आँर्किड२" 1924 1925 #, kde-format 1926 msgctxt "color" 1927 msgid "orchid3" 1928 msgstr "आँर्किड३" 1929 1930 #, kde-format 1931 msgctxt "color" 1932 msgid "orchid4" 1933 msgstr "आँर्किड४" 1934 1935 #, kde-format 1936 msgctxt "color" 1937 msgid "peru" 1938 msgstr "पेरू" 1939 1940 #, kde-format 1941 msgctxt "color" 1942 msgid "pink" 1943 msgstr "गुलाबीरङ्ग" 1944 1945 #, kde-format 1946 msgctxt "color" 1947 msgid "pink1" 1948 msgstr "गुलाबीरङ्ग१" 1949 1950 #, kde-format 1951 msgctxt "color" 1952 msgid "pink2" 1953 msgstr "गुलाबीरङ्ग२" 1954 1955 #, kde-format 1956 msgctxt "color" 1957 msgid "pink3" 1958 msgstr "गुलाबीरङ्ग३" 1959 1960 #, kde-format 1961 msgctxt "color" 1962 msgid "pink4" 1963 msgstr "गुलाबीरङ्ग४" 1964 1965 #, kde-format 1966 msgctxt "color" 1967 msgid "plum" 1968 msgstr "आलुबखरा" 1969 1970 #, kde-format 1971 msgctxt "color" 1972 msgid "plum1" 1973 msgstr "आलुबखरा१" 1974 1975 #, kde-format 1976 msgctxt "color" 1977 msgid "plum2" 1978 msgstr "आलुबखरा२" 1979 1980 #, kde-format 1981 msgctxt "color" 1982 msgid "plum3" 1983 msgstr "आलुबखरा३" 1984 1985 #, kde-format 1986 msgctxt "color" 1987 msgid "plum4" 1988 msgstr "आलुबखरा४" 1989 1990 #, kde-format 1991 msgctxt "color" 1992 msgid "purple" 1993 msgstr "बैजनी रङ" 1994 1995 #, kde-format 1996 msgctxt "color" 1997 msgid "purple1" 1998 msgstr "बैजनी रङ१" 1999 2000 #, kde-format 2001 msgctxt "color" 2002 msgid "purple2" 2003 msgstr "बैजनी रङ२" 2004 2005 #, kde-format 2006 msgctxt "color" 2007 msgid "purple3" 2008 msgstr "बैजनी रङ३" 2009 2010 #, kde-format 2011 msgctxt "color" 2012 msgid "purple4" 2013 msgstr "बैजनी रङ४" 2014 2015 #, fuzzy, kde-format 2016 msgctxt "color" 2017 msgid "red" 2018 msgstr "बुध" 2019 2020 #, kde-format 2021 msgctxt "color" 2022 msgid "red1" 2023 msgstr "रातो१" 2024 2025 #, kde-format 2026 msgctxt "color" 2027 msgid "red2" 2028 msgstr "रातो२" 2029 2030 #, kde-format 2031 msgctxt "color" 2032 msgid "red3" 2033 msgstr "रातो३" 2034 2035 #, kde-format 2036 msgctxt "color" 2037 msgid "red4" 2038 msgstr "रातो४" 2039 2040 #, kde-format 2041 msgctxt "color" 2042 msgid "salmon" 2043 msgstr "स्यालमोन" 2044 2045 #, kde-format 2046 msgctxt "color" 2047 msgid "salmon1" 2048 msgstr "स्यालमोन१" 2049 2050 #, kde-format 2051 msgctxt "color" 2052 msgid "salmon2" 2053 msgstr "स्यालमोन२" 2054 2055 #, kde-format 2056 msgctxt "color" 2057 msgid "salmon3" 2058 msgstr "स्यालमोन३" 2059 2060 #, kde-format 2061 msgctxt "color" 2062 msgid "salmon4" 2063 msgstr "स्यालमोन४" 2064 2065 #, kde-format 2066 msgctxt "color" 2067 msgid "seashell" 2068 msgstr "जहाज" 2069 2070 #, kde-format 2071 msgctxt "color" 2072 msgid "seashell1" 2073 msgstr "जहाज१" 2074 2075 #, kde-format 2076 msgctxt "color" 2077 msgid "seashell2" 2078 msgstr "जहाज२" 2079 2080 #, kde-format 2081 msgctxt "color" 2082 msgid "seashell3" 2083 msgstr "जहाज३" 2084 2085 #, kde-format 2086 msgctxt "color" 2087 msgid "seashell4" 2088 msgstr "जहाज४" 2089 2090 #, kde-format 2091 msgctxt "color" 2092 msgid "sienna" 2093 msgstr "रातोमाटो" 2094 2095 #, kde-format 2096 msgctxt "color" 2097 msgid "sienna1" 2098 msgstr "रातोमाटो१" 2099 2100 #, kde-format 2101 msgctxt "color" 2102 msgid "sienna2" 2103 msgstr "रातोमाटो२" 2104 2105 #, kde-format 2106 msgctxt "color" 2107 msgid "sienna3" 2108 msgstr "रातोमाटो३" 2109 2110 #, kde-format 2111 msgctxt "color" 2112 msgid "sienna4" 2113 msgstr "रातोमाटो४" 2114 2115 #, kde-format 2116 msgctxt "color" 2117 msgid "snow" 2118 msgstr "हिउँ" 2119 2120 #, kde-format 2121 msgctxt "color" 2122 msgid "snow1" 2123 msgstr "हिउँ१" 2124 2125 #, kde-format 2126 msgctxt "color" 2127 msgid "snow2" 2128 msgstr "हिउँ२" 2129 2130 #, kde-format 2131 msgctxt "color" 2132 msgid "snow3" 2133 msgstr "हिउँ३" 2134 2135 #, kde-format 2136 msgctxt "color" 2137 msgid "snow4" 2138 msgstr "हिउँ४" 2139 2140 #, fuzzy, kde-format 2141 msgctxt "color" 2142 msgid "tan" 2143 msgstr "जनवरी" 2144 2145 #, kde-format 2146 msgctxt "color" 2147 msgid "tan1" 2148 msgstr "ट्यान१" 2149 2150 #, kde-format 2151 msgctxt "color" 2152 msgid "tan2" 2153 msgstr "ट्यान२" 2154 2155 #, kde-format 2156 msgctxt "color" 2157 msgid "tan3" 2158 msgstr "ट्यान३" 2159 2160 #, kde-format 2161 msgctxt "color" 2162 msgid "tan4" 2163 msgstr "ट्यान४" 2164 2165 #, kde-format 2166 msgctxt "color" 2167 msgid "thistle" 2168 msgstr "थिस्टल" 2169 2170 #, kde-format 2171 msgctxt "color" 2172 msgid "thistle1" 2173 msgstr "थिस्टल१" 2174 2175 #, kde-format 2176 msgctxt "color" 2177 msgid "thistle2" 2178 msgstr "थिस्टल२" 2179 2180 #, kde-format 2181 msgctxt "color" 2182 msgid "thistle3" 2183 msgstr "थिस्टल३" 2184 2185 #, kde-format 2186 msgctxt "color" 2187 msgid "thistle4" 2188 msgstr "थिस्टल४" 2189 2190 #, kde-format 2191 msgctxt "color" 2192 msgid "tomato" 2193 msgstr "टोमाटो" 2194 2195 #, kde-format 2196 msgctxt "color" 2197 msgid "tomato1" 2198 msgstr "टोमाटो१" 2199 2200 #, kde-format 2201 msgctxt "color" 2202 msgid "tomato2" 2203 msgstr "टोमाटो२" 2204 2205 #, kde-format 2206 msgctxt "color" 2207 msgid "tomato3" 2208 msgstr "टोमाटो३" 2209 2210 #, kde-format 2211 msgctxt "color" 2212 msgid "tomato4" 2213 msgstr "टोमाटो४" 2214 2215 #, kde-format 2216 msgctxt "color" 2217 msgid "turquoise" 2218 msgstr "टरक्वाईज" 2219 2220 #, kde-format 2221 msgctxt "color" 2222 msgid "turquoise1" 2223 msgstr "टरक्वाईज१" 2224 2225 #, kde-format 2226 msgctxt "color" 2227 msgid "turquoise2" 2228 msgstr "टरक्वाईज२" 2229 2230 #, kde-format 2231 msgctxt "color" 2232 msgid "turquoise3" 2233 msgstr "टरक्वाईज३" 2234 2235 #, kde-format 2236 msgctxt "color" 2237 msgid "turquoise4" 2238 msgstr "टरक्वाईज४" 2239 2240 #, kde-format 2241 msgctxt "color" 2242 msgid "violet" 2243 msgstr "भाइलेट" 2244 2245 #, kde-format 2246 msgctxt "color" 2247 msgid "wheat" 2248 msgstr "गहुँ" 2249 2250 #, kde-format 2251 msgctxt "color" 2252 msgid "wheat1" 2253 msgstr "गहुँ१" 2254 2255 #, kde-format 2256 msgctxt "color" 2257 msgid "wheat2" 2258 msgstr "गहुँ२" 2259 2260 #, kde-format 2261 msgctxt "color" 2262 msgid "wheat3" 2263 msgstr "गहुँ३" 2264 2265 #, kde-format 2266 msgctxt "color" 2267 msgid "wheat4" 2268 msgstr "गहुँ४" 2269 2270 #, kde-format 2271 msgctxt "color" 2272 msgid "white" 2273 msgstr "सेतो" 2274 2275 #, kde-format 2276 msgctxt "color" 2277 msgid "yellow" 2278 msgstr "पहेँलो" 2279 2280 #, kde-format 2281 msgctxt "color" 2282 msgid "yellow1" 2283 msgstr "पहेंलो१" 2284 2285 #, kde-format 2286 msgctxt "color" 2287 msgid "yellow2" 2288 msgstr "पहेंलो२" 2289 2290 #, kde-format 2291 msgctxt "color" 2292 msgid "yellow3" 2293 msgstr "पहेंलो३" 2294 2295 #, kde-format 2296 msgctxt "color" 2297 msgid "yellow4" 2298 msgstr "पहेंलो४" 2299 2300 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2301 #, kde-format 2302 msgid "Debug Settings" 2303 msgstr "त्रुटि सच्याउने सेटिङ" 2304 2305 #: kdebugdialog/kdebugdialog.cpp:59 2306 #, kde-format 2307 msgid "File" 2308 msgstr "फाइल:" 2309 2310 #: kdebugdialog/kdebugdialog.cpp:60 2311 #, kde-format 2312 msgid "Message Box" 2313 msgstr "सन्देश बाकस" 2314 2315 #: kdebugdialog/kdebugdialog.cpp:61 2316 #, kde-format 2317 msgid "Shell" 2318 msgstr "शेल" 2319 2320 #: kdebugdialog/kdebugdialog.cpp:62 2321 #, kde-format 2322 msgid "Syslog" 2323 msgstr "प्रणाली लग" 2324 2325 #: kdebugdialog/kdebugdialog.cpp:63 2326 #, kde-format 2327 msgid "None" 2328 msgstr "कुनै पनि होइन" 2329 2330 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2331 #: kdebugdialog/kdebugdialog.ui:48 2332 #, kde-format 2333 msgid "Information" 2334 msgstr "सूचना" 2335 2336 #. i18n: ectx: property (text), widget (QLabel, label_2) 2337 #. i18n: ectx: property (text), widget (QLabel, label_8) 2338 #. i18n: ectx: property (text), widget (QLabel, label_4) 2339 #. i18n: ectx: property (text), widget (QLabel, label_6) 2340 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2341 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2342 #, kde-format 2343 msgid "Output to:" 2344 msgstr "निर्गत गर्ने स्थान:" 2345 2346 #. i18n: ectx: property (text), widget (QLabel, label_3) 2347 #. i18n: ectx: property (text), widget (QLabel, label_9) 2348 #. i18n: ectx: property (text), widget (QLabel, label_5) 2349 #. i18n: ectx: property (text), widget (QLabel, label_7) 2350 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2351 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2352 #, kde-format 2353 msgid "Filename:" 2354 msgstr "फाइलनाम:" 2355 2356 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2357 #: kdebugdialog/kdebugdialog.ui:83 2358 #, kde-format 2359 msgid "Error" 2360 msgstr "त्रुटि" 2361 2362 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2363 #: kdebugdialog/kdebugdialog.ui:118 2364 #, kde-format 2365 msgid "Abort on fatal errors" 2366 msgstr "घातक त्रुटिमा परित्याग गर्नुहोस्" 2367 2368 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2369 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2370 #, kde-format 2371 msgid "Disable all debug output" 2372 msgstr "" 2373 2374 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2375 #: kdebugdialog/kdebugdialog.ui:145 2376 #, kde-format 2377 msgid "Warning" 2378 msgstr "चेतावनी" 2379 2380 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2381 #: kdebugdialog/kdebugdialog.ui:180 2382 #, kde-format 2383 msgid "Fatal Error" 2384 msgstr "घातक त्रुटि" 2385 2386 #: kdebugdialog/klistdebugdialog.cpp:69 2387 #, kde-format 2388 msgid "&Select All" 2389 msgstr "सबै चयन गर्नुहोस्" 2390 2391 #: kdebugdialog/klistdebugdialog.cpp:70 2392 #, kde-format 2393 msgid "&Deselect All" 2394 msgstr "सबै चयनबाट हटाउनुहोस्" 2395 2396 #: kdebugdialog/main.cpp:100 2397 #, kde-format 2398 msgid "KDebugDialog" 2399 msgstr "केडीई त्रुटि सच्याउने संवाद" 2400 2401 #: kdebugdialog/main.cpp:101 2402 #, kde-format 2403 msgid "A dialog box for setting preferences for debug output" 2404 msgstr "त्रुटि सच्याउने निर्गतका लागि प्राथमिकता सेटिङ गर्न संवाद बाकस" 2405 2406 #: kdebugdialog/main.cpp:102 2407 #, fuzzy, kde-format 2408 #| msgid "Copyright 1999-2000, David Faure <email>faure@kde.org</email>" 2409 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2410 msgstr "प्रतिलिपिअधिकार १९९९-२०००, डेभिड फउरे <email>faure@kde.org</email>" 2411 2412 #: kdebugdialog/main.cpp:103 2413 #, kde-format 2414 msgid "David Faure" 2415 msgstr "डेभिड फाउरे" 2416 2417 #: kdebugdialog/main.cpp:103 2418 #, kde-format 2419 msgid "Maintainer" 2420 msgstr "मर्मतकर्ता" 2421 2422 #: kdebugdialog/main.cpp:108 2423 #, kde-format 2424 msgid "Show the fully-fledged dialog instead of the default list dialog" 2425 msgstr "पूर्वानिर्धारित सूची संवादको सट्टा पूरै हटाएको संवाद देखाउनुहोस्" 2426 2427 #: kdebugdialog/main.cpp:109 2428 #, kde-format 2429 msgid "Turn area on" 2430 msgstr "घुम्ने क्षेत्र खोल्नुहोस्" 2431 2432 #: kdebugdialog/main.cpp:110 2433 #, kde-format 2434 msgid "Turn area off" 2435 msgstr "घुम्ने क्षेत्र बन्द गर्नुहोस्" 2436 2437 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2438 #, kde-format 2439 msgid "no error" 2440 msgstr "त्रुटि छैन" 2441 2442 #: kdecore/k3resolver.cpp:534 2443 #, kde-format 2444 msgid "requested family not supported for this host name" 2445 msgstr "यो होस्ट नामका लागि अनुरोध गरिएको परिवार समर्थन गर्दैन" 2446 2447 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2448 #, kde-format 2449 msgid "temporary failure in name resolution" 2450 msgstr "नाम रिजोल्युसनमा अस्थायी असफलता" 2451 2452 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2453 #, kde-format 2454 msgid "non-recoverable failure in name resolution" 2455 msgstr "नाम रिजोल्युसनमा पुन: अप्राप्य असफलता" 2456 2457 #: kdecore/k3resolver.cpp:537 2458 #, kde-format 2459 msgid "invalid flags" 2460 msgstr "अवैध ध्वजाजा" 2461 2462 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2463 #, kde-format 2464 msgid "memory allocation failure" 2465 msgstr "स्मृति बाँडफाँट असफलता" 2466 2467 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2468 #, kde-format 2469 msgid "name or service not known" 2470 msgstr "नाम वा सेवा परिचित छैन" 2471 2472 #: kdecore/k3resolver.cpp:540 2473 #, kde-format 2474 msgid "requested family not supported" 2475 msgstr "अनुरोध गरिएको परिवार समर्थित छैन" 2476 2477 #: kdecore/k3resolver.cpp:541 2478 #, kde-format 2479 msgid "requested service not supported for this socket type" 2480 msgstr "सकेट प्रकारका लागि अनुरोध गरिएको सेवा समर्थित छैन" 2481 2482 #: kdecore/k3resolver.cpp:542 2483 #, kde-format 2484 msgid "requested socket type not supported" 2485 msgstr "अनुरोध गरिएको सकेट प्रकार समर्थित छैन" 2486 2487 #: kdecore/k3resolver.cpp:543 2488 #, kde-format 2489 msgid "unknown error" 2490 msgstr "अज्ञात त्रुटि" 2491 2492 #: kdecore/k3resolver.cpp:545 2493 #, kde-format 2494 msgctxt "1: the i18n'ed system error code, from errno" 2495 msgid "system error: %1" 2496 msgstr "प्रणाली त्रुटि: %1" 2497 2498 #: kdecore/k3resolver.cpp:556 2499 #, kde-format 2500 msgid "request was canceled" 2501 msgstr "अनुरोध रद्द गरियो" 2502 2503 #: kdecore/k3socketaddress.cpp:631 2504 #, kde-format 2505 msgctxt "1: the unknown socket address family number" 2506 msgid "Unknown family %1" 2507 msgstr "अज्ञात परिवार %1" 2508 2509 #: kdecore/k3socketbase.cpp:215 2510 #, kde-format 2511 msgctxt "Socket error code NoError" 2512 msgid "no error" 2513 msgstr "त्रुटि छैन" 2514 2515 #: kdecore/k3socketbase.cpp:220 2516 #, kde-format 2517 msgctxt "Socket error code LookupFailure" 2518 msgid "name lookup has failed" 2519 msgstr "नाम खोजी असफल भयो" 2520 2521 #: kdecore/k3socketbase.cpp:225 2522 #, kde-format 2523 msgctxt "Socket error code AddressInUse" 2524 msgid "address already in use" 2525 msgstr "ठेगाना पहिल्यै प्रयोगमा छ" 2526 2527 #: kdecore/k3socketbase.cpp:230 2528 #, kde-format 2529 msgctxt "Socket error code AlreadyBound" 2530 msgid "socket is already bound" 2531 msgstr "सकेट पहिल्यै बाउन्ड छ" 2532 2533 #: kdecore/k3socketbase.cpp:235 2534 #, kde-format 2535 msgctxt "Socket error code AlreadyCreated" 2536 msgid "socket is already created" 2537 msgstr "सकेट पहिल्यै सिर्जना गरिएको छ" 2538 2539 #: kdecore/k3socketbase.cpp:240 2540 #, kde-format 2541 msgctxt "Socket error code NotBound" 2542 msgid "socket is not bound" 2543 msgstr "सकेट बाउन्ड छैन" 2544 2545 #: kdecore/k3socketbase.cpp:245 2546 #, kde-format 2547 msgctxt "Socket error code NotCreated" 2548 msgid "socket has not been created" 2549 msgstr "सकेट सिर्जना गरिएको छैन" 2550 2551 #: kdecore/k3socketbase.cpp:250 2552 #, kde-format 2553 msgctxt "Socket error code WouldBlock" 2554 msgid "operation would block" 2555 msgstr "कार्य बन्द गर्नेछ" 2556 2557 #: kdecore/k3socketbase.cpp:255 2558 #, kde-format 2559 msgctxt "Socket error code ConnectionRefused" 2560 msgid "connection actively refused" 2561 msgstr "जडान सक्रिय रूपमा अस्वीकृत भयो" 2562 2563 #: kdecore/k3socketbase.cpp:260 2564 #, kde-format 2565 msgctxt "Socket error code ConnectionTimedOut" 2566 msgid "connection timed out" 2567 msgstr "जडान समय समाप्त" 2568 2569 #: kdecore/k3socketbase.cpp:265 2570 #, kde-format 2571 msgctxt "Socket error code InProgress" 2572 msgid "operation is already in progress" 2573 msgstr "सञ्चालन पहिल्यै प्रगतिमा छ" 2574 2575 #: kdecore/k3socketbase.cpp:270 2576 #, kde-format 2577 msgctxt "Socket error code NetFailure" 2578 msgid "network failure occurred" 2579 msgstr "सञ्जाल असफलता उत्पन्न भयो" 2580 2581 #: kdecore/k3socketbase.cpp:275 2582 #, kde-format 2583 msgctxt "Socket error code NotSupported" 2584 msgid "operation is not supported" 2585 msgstr "सञ्चालन समर्थित छैन" 2586 2587 #: kdecore/k3socketbase.cpp:280 2588 #, kde-format 2589 msgctxt "Socket error code Timeout" 2590 msgid "timed operation timed out" 2591 msgstr "समय सञ्चालन समय समाप्त" 2592 2593 #: kdecore/k3socketbase.cpp:285 2594 #, kde-format 2595 msgctxt "Socket error code UnknownError" 2596 msgid "an unknown/unexpected error has happened" 2597 msgstr "एउटा अज्ञात/अनपेक्षित त्रुटि भयो" 2598 2599 #: kdecore/k3socketbase.cpp:290 2600 #, kde-format 2601 msgctxt "Socket error code RemotelyDisconnected" 2602 msgid "remote host closed connection" 2603 msgstr "टाढाको होस्टले जडान बन्द गर्यो" 2604 2605 #: kdecore/k4aboutdata.cpp:267 2606 #, kde-format 2607 msgid "" 2608 "No licensing terms for this program have been specified.\n" 2609 "Please check the documentation or the source for any\n" 2610 "licensing terms.\n" 2611 msgstr "" 2612 2613 #: kdecore/k4aboutdata.cpp:273 2614 #, kde-format 2615 msgid "This program is distributed under the terms of the %1." 2616 msgstr "" 2617 2618 #: kdecore/k4aboutdata.cpp:297 2619 #, fuzzy, kde-format 2620 #| msgid "GPL" 2621 msgctxt "@item license (short name)" 2622 msgid "GPL v2" 2623 msgstr "GPL" 2624 2625 #: kdecore/k4aboutdata.cpp:298 2626 #, kde-format 2627 msgctxt "@item license" 2628 msgid "GNU General Public License Version 2" 2629 msgstr "GNU साधारण सार्वजनिक इजाजतपत्र संस्करण 2" 2630 2631 #: kdecore/k4aboutdata.cpp:301 2632 #, fuzzy, kde-format 2633 #| msgid "LGPL" 2634 msgctxt "@item license (short name)" 2635 msgid "LGPL v2" 2636 msgstr "LGPL" 2637 2638 #: kdecore/k4aboutdata.cpp:302 2639 #, fuzzy, kde-format 2640 #| msgctxt "@item license" 2641 #| msgid "GNU General Public License Version 2" 2642 msgctxt "@item license" 2643 msgid "GNU Lesser General Public License Version 2" 2644 msgstr "GNU साधारण सार्वजनिक इजाजतपत्र संस्करण 2" 2645 2646 #: kdecore/k4aboutdata.cpp:305 2647 #, fuzzy, kde-format 2648 #| msgctxt "@item license" 2649 #| msgid "BSD License" 2650 msgctxt "@item license (short name)" 2651 msgid "BSD License" 2652 msgstr "BSD इजाजतपत्र" 2653 2654 #: kdecore/k4aboutdata.cpp:306 2655 #, kde-format 2656 msgctxt "@item license" 2657 msgid "BSD License" 2658 msgstr "BSD इजाजतपत्र" 2659 2660 #: kdecore/k4aboutdata.cpp:309 2661 #, fuzzy, kde-format 2662 #| msgctxt "@item license" 2663 #| msgid "Artistic License" 2664 msgctxt "@item license (short name)" 2665 msgid "Artistic License" 2666 msgstr "कलात्मक इजाजतपत्र" 2667 2668 #: kdecore/k4aboutdata.cpp:310 2669 #, kde-format 2670 msgctxt "@item license" 2671 msgid "Artistic License" 2672 msgstr "कलात्मक इजाजतपत्र" 2673 2674 #: kdecore/k4aboutdata.cpp:313 2675 #, kde-format 2676 msgctxt "@item license (short name)" 2677 msgid "QPL v1.0" 2678 msgstr "" 2679 2680 #: kdecore/k4aboutdata.cpp:314 2681 #, kde-format 2682 msgctxt "@item license" 2683 msgid "Q Public License" 2684 msgstr "Q सार्वजनिक इजाजतपत्र" 2685 2686 #: kdecore/k4aboutdata.cpp:317 2687 #, fuzzy, kde-format 2688 #| msgid "GPL" 2689 msgctxt "@item license (short name)" 2690 msgid "GPL v3" 2691 msgstr "GPL" 2692 2693 #: kdecore/k4aboutdata.cpp:318 2694 #, fuzzy, kde-format 2695 #| msgctxt "@item license" 2696 #| msgid "GNU General Public License Version 2" 2697 msgctxt "@item license" 2698 msgid "GNU General Public License Version 3" 2699 msgstr "GNU साधारण सार्वजनिक इजाजतपत्र संस्करण 2" 2700 2701 #: kdecore/k4aboutdata.cpp:321 2702 #, fuzzy, kde-format 2703 #| msgid "LGPL" 2704 msgctxt "@item license (short name)" 2705 msgid "LGPL v3" 2706 msgstr "LGPL" 2707 2708 #: kdecore/k4aboutdata.cpp:322 2709 #, fuzzy, kde-format 2710 #| msgctxt "@item license" 2711 #| msgid "GNU General Public License Version 2" 2712 msgctxt "@item license" 2713 msgid "GNU Lesser General Public License Version 3" 2714 msgstr "GNU साधारण सार्वजनिक इजाजतपत्र संस्करण 2" 2715 2716 #: kdecore/k4aboutdata.cpp:326 2717 #, kde-format 2718 msgctxt "@item license" 2719 msgid "Custom" 2720 msgstr "अनुकूल" 2721 2722 #: kdecore/k4aboutdata.cpp:329 2723 #, kde-format 2724 msgctxt "@item license" 2725 msgid "Not specified" 2726 msgstr "निर्दिष्ट नगरिएको" 2727 2728 #: kdecore/k4aboutdata.cpp:891 2729 #, kde-format 2730 msgctxt "replace this with information about your translation team" 2731 msgid "" 2732 "<p>KDE is translated into many languages thanks to the work of the " 2733 "translation teams all over the world.</p><p>For more information on KDE " 2734 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2735 "org</a></p>" 2736 msgstr "" 2737 "<p>केडीई धेरै भाषामा अनुवाद गरिएको छ । संसार भरीका सबै अनुवादक समूहलाई कामका लागि " 2738 "धन्यवाद ।</p><p>केडीई अन्तराष्ट्रियकरणको बारेमा अधिक जानकारीका लागि यो साइट हेर्नुहोस् " 2739 "<a href=\"http://l10n.kde.org\">http://l10n.kde.org</a></p>" 2740 2741 #: kdecore/kcalendarsystem.cpp:108 2742 #, kde-format 2743 msgctxt "@item Calendar system" 2744 msgid "Gregorian" 2745 msgstr "जर्जियाली" 2746 2747 #: kdecore/kcalendarsystem.cpp:110 2748 #, fuzzy, kde-format 2749 msgctxt "@item Calendar system" 2750 msgid "Coptic" 2751 msgstr "कोप्टिक" 2752 2753 #: kdecore/kcalendarsystem.cpp:112 2754 #, fuzzy, kde-format 2755 msgctxt "@item Calendar system" 2756 msgid "Ethiopian" 2757 msgstr "इथोपियाली" 2758 2759 #: kdecore/kcalendarsystem.cpp:114 2760 #, kde-format 2761 msgctxt "@item Calendar system" 2762 msgid "Hebrew" 2763 msgstr "हिब्रु" 2764 2765 #: kdecore/kcalendarsystem.cpp:116 2766 #, kde-format 2767 msgctxt "@item Calendar system" 2768 msgid "Islamic / Hijri (Civil)" 2769 msgstr "" 2770 2771 #: kdecore/kcalendarsystem.cpp:118 2772 #, kde-format 2773 msgctxt "@item Calendar system" 2774 msgid "Indian National" 2775 msgstr "" 2776 2777 #: kdecore/kcalendarsystem.cpp:120 2778 #, kde-format 2779 msgctxt "@item Calendar system" 2780 msgid "Jalali" 2781 msgstr "जालली" 2782 2783 #: kdecore/kcalendarsystem.cpp:122 2784 #, kde-format 2785 msgctxt "@item Calendar system" 2786 msgid "Japanese" 2787 msgstr "" 2788 2789 #: kdecore/kcalendarsystem.cpp:124 2790 #, fuzzy, kde-format 2791 msgctxt "@item Calendar system" 2792 msgid "Julian" 2793 msgstr "जनवरी" 2794 2795 #: kdecore/kcalendarsystem.cpp:126 2796 #, kde-format 2797 msgctxt "@item Calendar system" 2798 msgid "Taiwanese" 2799 msgstr "" 2800 2801 #: kdecore/kcalendarsystem.cpp:128 2802 #, fuzzy, kde-format 2803 #| msgid "R. Thaani" 2804 msgctxt "@item Calendar system" 2805 msgid "Thai" 2806 msgstr "आर. थानी" 2807 2808 #: kdecore/kcalendarsystem.cpp:131 2809 #, kde-format 2810 msgctxt "@item Calendar system" 2811 msgid "Invalid Calendar Type" 2812 msgstr "अवैध क्यालेन्डर प्रकार" 2813 2814 #: kdecore/kcalendarsystem.cpp:1495 2815 #, kde-format 2816 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2817 msgid "-" 2818 msgstr "" 2819 2820 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2821 #: kio/kfilemetadataprovider.cpp:199 2822 #, kde-format 2823 msgid "Today" 2824 msgstr "आज" 2825 2826 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2827 #: kio/kfilemetadataprovider.cpp:202 2828 #, kde-format 2829 msgid "Yesterday" 2830 msgstr "हिजो" 2831 2832 #: kdecore/kcalendarsystemcoptic.cpp:45 2833 #, kde-format 2834 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2835 msgid "Anno Martyrum" 2836 msgstr "" 2837 2838 #: kdecore/kcalendarsystemcoptic.cpp:46 2839 #, kde-format 2840 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2841 msgid "AM" 2842 msgstr "" 2843 2844 #: kdecore/kcalendarsystemcoptic.cpp:47 2845 #, kde-format 2846 msgctxt "" 2847 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2848 msgid "%Ey %EC" 2849 msgstr "" 2850 2851 #: kdecore/kcalendarsystemcoptic.cpp:153 2852 #, kde-format 2853 msgctxt "Coptic month 1 - KLocale::NarrowName" 2854 msgid "T" 2855 msgstr "" 2856 2857 #: kdecore/kcalendarsystemcoptic.cpp:155 2858 #, kde-format 2859 msgctxt "Coptic month 2 - KLocale::NarrowName" 2860 msgid "P" 2861 msgstr "" 2862 2863 #: kdecore/kcalendarsystemcoptic.cpp:157 2864 #, kde-format 2865 msgctxt "Coptic month 3 - KLocale::NarrowName" 2866 msgid "H" 2867 msgstr "" 2868 2869 #: kdecore/kcalendarsystemcoptic.cpp:159 2870 #, kde-format 2871 msgctxt "Coptic month 4 - KLocale::NarrowName" 2872 msgid "K" 2873 msgstr "" 2874 2875 #: kdecore/kcalendarsystemcoptic.cpp:161 2876 #, kde-format 2877 msgctxt "Coptic month 5 - KLocale::NarrowName" 2878 msgid "T" 2879 msgstr "" 2880 2881 #: kdecore/kcalendarsystemcoptic.cpp:163 2882 #, kde-format 2883 msgctxt "Coptic month 6 - KLocale::NarrowName" 2884 msgid "M" 2885 msgstr "" 2886 2887 #: kdecore/kcalendarsystemcoptic.cpp:165 2888 #, kde-format 2889 msgctxt "Coptic month 7 - KLocale::NarrowName" 2890 msgid "P" 2891 msgstr "" 2892 2893 #: kdecore/kcalendarsystemcoptic.cpp:167 2894 #, kde-format 2895 msgctxt "Coptic month 8 - KLocale::NarrowName" 2896 msgid "P" 2897 msgstr "" 2898 2899 #: kdecore/kcalendarsystemcoptic.cpp:169 2900 #, kde-format 2901 msgctxt "Coptic month 9 - KLocale::NarrowName" 2902 msgid "P" 2903 msgstr "" 2904 2905 #: kdecore/kcalendarsystemcoptic.cpp:171 2906 #, kde-format 2907 msgctxt "Coptic month 10 - KLocale::NarrowName" 2908 msgid "P" 2909 msgstr "" 2910 2911 #: kdecore/kcalendarsystemcoptic.cpp:173 2912 #, kde-format 2913 msgctxt "Coptic month 11 - KLocale::NarrowName" 2914 msgid "E" 2915 msgstr "" 2916 2917 #: kdecore/kcalendarsystemcoptic.cpp:175 2918 #, kde-format 2919 msgctxt "Coptic month 12 - KLocale::NarrowName" 2920 msgid "M" 2921 msgstr "" 2922 2923 #: kdecore/kcalendarsystemcoptic.cpp:177 2924 #, kde-format 2925 msgctxt "Coptic month 13 - KLocale::NarrowName" 2926 msgid "K" 2927 msgstr "" 2928 2929 #: kdecore/kcalendarsystemcoptic.cpp:186 2930 #, fuzzy, kde-format 2931 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2932 msgid "of Tho" 2933 msgstr "of Kho" 2934 2935 #: kdecore/kcalendarsystemcoptic.cpp:188 2936 #, fuzzy, kde-format 2937 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2938 msgid "of Pao" 2939 msgstr "of Tamuz" 2940 2941 #: kdecore/kcalendarsystemcoptic.cpp:190 2942 #, fuzzy, kde-format 2943 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2944 msgid "of Hat" 2945 msgstr "of Shvat" 2946 2947 #: kdecore/kcalendarsystemcoptic.cpp:192 2948 #, fuzzy, kde-format 2949 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2950 msgid "of Kia" 2951 msgstr "of Nisan" 2952 2953 #: kdecore/kcalendarsystemcoptic.cpp:194 2954 #, fuzzy, kde-format 2955 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2956 msgid "of Tob" 2957 msgstr "फेब्रुअरीको" 2958 2959 #: kdecore/kcalendarsystemcoptic.cpp:196 2960 #, fuzzy, kde-format 2961 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2962 msgid "of Mes" 2963 msgstr "of Meh" 2964 2965 #: kdecore/kcalendarsystemcoptic.cpp:198 2966 #, fuzzy, kde-format 2967 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2968 msgid "of Par" 2969 msgstr "मार्चको" 2970 2971 #: kdecore/kcalendarsystemcoptic.cpp:200 2972 #, fuzzy, kde-format 2973 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2974 msgid "of Pam" 2975 msgstr "of Tamuz" 2976 2977 #: kdecore/kcalendarsystemcoptic.cpp:202 2978 #, fuzzy, kde-format 2979 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2980 msgid "of Pas" 2981 msgstr "of Bah" 2982 2983 #: kdecore/kcalendarsystemcoptic.cpp:204 2984 #, fuzzy, kde-format 2985 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2986 msgid "of Pan" 2987 msgstr "जनवरीको" 2988 2989 #: kdecore/kcalendarsystemcoptic.cpp:206 2990 #, fuzzy, kde-format 2991 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2992 msgid "of Epe" 2993 msgstr "फेब्रुअरीको" 2994 2995 #: kdecore/kcalendarsystemcoptic.cpp:208 2996 #, fuzzy, kde-format 2997 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2998 msgid "of Meo" 2999 msgstr "of Mor" 3000 3001 #: kdecore/kcalendarsystemcoptic.cpp:210 3002 #, fuzzy, kde-format 3003 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3004 msgid "of Kou" 3005 msgstr "of Kho" 3006 3007 #: kdecore/kcalendarsystemcoptic.cpp:219 3008 #, fuzzy, kde-format 3009 msgctxt "Coptic month 1 - KLocale::ShortName" 3010 msgid "Tho" 3011 msgstr "Thl" 3012 3013 #: kdecore/kcalendarsystemcoptic.cpp:221 3014 #, fuzzy, kde-format 3015 msgctxt "Coptic month 2 - KLocale::ShortName" 3016 msgid "Pao" 3017 msgstr "पज गर्नुहोस्" 3018 3019 #: kdecore/kcalendarsystemcoptic.cpp:223 3020 #, fuzzy, kde-format 3021 msgctxt "Coptic month 3 - KLocale::ShortName" 3022 msgid "Hat" 3023 msgstr "शनि" 3024 3025 #: kdecore/kcalendarsystemcoptic.cpp:225 3026 #, fuzzy, kde-format 3027 msgctxt "Coptic month 4 - KLocale::ShortName" 3028 msgid "Kia" 3029 msgstr "खा" 3030 3031 #: kdecore/kcalendarsystemcoptic.cpp:227 3032 #, fuzzy, kde-format 3033 msgctxt "Coptic month 5 - KLocale::ShortName" 3034 msgid "Tob" 3035 msgstr "Jom" 3036 3037 #: kdecore/kcalendarsystemcoptic.cpp:229 3038 #, fuzzy, kde-format 3039 msgctxt "Coptic month 6 - KLocale::ShortName" 3040 msgid "Mes" 3041 msgstr "हो" 3042 3043 #: kdecore/kcalendarsystemcoptic.cpp:231 3044 #, fuzzy, kde-format 3045 msgctxt "Coptic month 7 - KLocale::ShortName" 3046 msgid "Par" 3047 msgstr "मार्च" 3048 3049 #: kdecore/kcalendarsystemcoptic.cpp:233 3050 #, fuzzy, kde-format 3051 msgctxt "Coptic month 8 - KLocale::ShortName" 3052 msgid "Pam" 3053 msgstr "पूर्वान्ह" 3054 3055 #: kdecore/kcalendarsystemcoptic.cpp:235 3056 #, fuzzy, kde-format 3057 msgctxt "Coptic month 9 - KLocale::ShortName" 3058 msgid "Pas" 3059 msgstr "PageUp" 3060 3061 #: kdecore/kcalendarsystemcoptic.cpp:237 3062 #, fuzzy, kde-format 3063 msgctxt "Coptic month 10 - KLocale::ShortName" 3064 msgid "Pan" 3065 msgstr "जनवरी" 3066 3067 #: kdecore/kcalendarsystemcoptic.cpp:239 3068 #, fuzzy, kde-format 3069 msgctxt "Coptic month 11 - KLocale::ShortName" 3070 msgid "Epe" 3071 msgstr "Escape" 3072 3073 #: kdecore/kcalendarsystemcoptic.cpp:241 3074 #, fuzzy, kde-format 3075 msgctxt "Coptic month 12 - KLocale::ShortName" 3076 msgid "Meo" 3077 msgstr "सोम" 3078 3079 #: kdecore/kcalendarsystemcoptic.cpp:243 3080 #, fuzzy, kde-format 3081 msgctxt "Coptic month 12 - KLocale::ShortName" 3082 msgid "Kou" 3083 msgstr "Kho" 3084 3085 #: kdecore/kcalendarsystemcoptic.cpp:252 3086 #, fuzzy, kde-format 3087 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3088 msgid "of Thoout" 3089 msgstr "of Kho" 3090 3091 #: kdecore/kcalendarsystemcoptic.cpp:254 3092 #, fuzzy, kde-format 3093 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3094 msgid "of Paope" 3095 msgstr "of Tamuz" 3096 3097 #: kdecore/kcalendarsystemcoptic.cpp:256 3098 #, fuzzy, kde-format 3099 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3100 msgid "of Hathor" 3101 msgstr "of Hijjah" 3102 3103 #: kdecore/kcalendarsystemcoptic.cpp:258 3104 #, fuzzy, kde-format 3105 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3106 msgid "of Kiahk" 3107 msgstr "of Kho" 3108 3109 #: kdecore/kcalendarsystemcoptic.cpp:260 3110 #, fuzzy, kde-format 3111 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3112 msgid "of Tobe" 3113 msgstr "अक्टोबरको" 3114 3115 #: kdecore/kcalendarsystemcoptic.cpp:262 3116 #, fuzzy, kde-format 3117 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3118 msgid "of Meshir" 3119 msgstr "of Mehr" 3120 3121 #: kdecore/kcalendarsystemcoptic.cpp:264 3122 #, fuzzy, kde-format 3123 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3124 msgid "of Paremhotep" 3125 msgstr "परिमिति" 3126 3127 #: kdecore/kcalendarsystemcoptic.cpp:266 3128 #, fuzzy, kde-format 3129 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3130 msgid "of Parmoute" 3131 msgstr "of Tamuz" 3132 3133 #: kdecore/kcalendarsystemcoptic.cpp:268 3134 #, fuzzy, kde-format 3135 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3136 msgid "of Pashons" 3137 msgstr "of Bah" 3138 3139 #: kdecore/kcalendarsystemcoptic.cpp:270 3140 #, fuzzy, kde-format 3141 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3142 msgid "of Paone" 3143 msgstr "जनवरीको" 3144 3145 #: kdecore/kcalendarsystemcoptic.cpp:272 3146 #, fuzzy, kde-format 3147 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3148 msgid "of Epep" 3149 msgstr "सेप्टेम्बरको" 3150 3151 #: kdecore/kcalendarsystemcoptic.cpp:274 3152 #, fuzzy, kde-format 3153 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3154 msgid "of Mesore" 3155 msgstr "of Mor" 3156 3157 #: kdecore/kcalendarsystemcoptic.cpp:276 3158 #, fuzzy, kde-format 3159 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3160 msgid "of Kouji nabot" 3161 msgstr "फेब्रुअरीको" 3162 3163 #: kdecore/kcalendarsystemcoptic.cpp:285 3164 #, fuzzy, kde-format 3165 msgctxt "Coptic month 1 - KLocale::LongName" 3166 msgid "Thoout" 3167 msgstr "बिही" 3168 3169 #: kdecore/kcalendarsystemcoptic.cpp:287 3170 #, fuzzy, kde-format 3171 msgctxt "Coptic month 2 - KLocale::LongName" 3172 msgid "Paope" 3173 msgstr "गुण" 3174 3175 #: kdecore/kcalendarsystemcoptic.cpp:289 3176 #, fuzzy, kde-format 3177 msgctxt "Coptic month 3 - KLocale::LongName" 3178 msgid "Hathor" 3179 msgstr "लेखक" 3180 3181 #: kdecore/kcalendarsystemcoptic.cpp:291 3182 #, fuzzy, kde-format 3183 msgctxt "Coptic month 4 - KLocale::LongName" 3184 msgid "Kiahk" 3185 msgstr "of Kho" 3186 3187 #: kdecore/kcalendarsystemcoptic.cpp:293 3188 #, fuzzy, kde-format 3189 msgctxt "Coptic month 5 - KLocale::LongName" 3190 msgid "Tobe" 3191 msgstr "Jom" 3192 3193 #: kdecore/kcalendarsystemcoptic.cpp:295 3194 #, fuzzy, kde-format 3195 msgctxt "Coptic month 6 - KLocale::LongName" 3196 msgid "Meshir" 3197 msgstr "मेहर" 3198 3199 #: kdecore/kcalendarsystemcoptic.cpp:297 3200 #, fuzzy, kde-format 3201 msgctxt "Coptic month 7 - KLocale::LongName" 3202 msgid "Paremhotep" 3203 msgstr "परिमिति" 3204 3205 #: kdecore/kcalendarsystemcoptic.cpp:299 3206 #, fuzzy, kde-format 3207 msgctxt "Coptic month 8 - KLocale::LongName" 3208 msgid "Parmoute" 3209 msgstr "परिमिति" 3210 3211 #: kdecore/kcalendarsystemcoptic.cpp:301 3212 #, fuzzy, kde-format 3213 msgctxt "Coptic month 9 - KLocale::LongName" 3214 msgid "Pashons" 3215 msgstr "पज गर्नुहोस्" 3216 3217 #: kdecore/kcalendarsystemcoptic.cpp:303 3218 #, fuzzy, kde-format 3219 msgctxt "Coptic month 10 - KLocale::LongName" 3220 msgid "Paone" 3221 msgstr "कुनै पनि होइन" 3222 3223 #: kdecore/kcalendarsystemcoptic.cpp:305 3224 #, fuzzy, kde-format 3225 msgctxt "Coptic month 11 - KLocale::LongName" 3226 msgid "Epep" 3227 msgstr "Escape" 3228 3229 #: kdecore/kcalendarsystemcoptic.cpp:307 3230 #, fuzzy, kde-format 3231 msgctxt "Coptic month 12 - KLocale::LongName" 3232 msgid "Mesore" 3233 msgstr "पूर्वावस्थामा ल्याउनुहोस्" 3234 3235 #: kdecore/kcalendarsystemcoptic.cpp:309 3236 #, fuzzy, kde-format 3237 msgctxt "Coptic month 12 - KLocale::LongName" 3238 msgid "Kouji nabot" 3239 msgstr "फेब्रुअरीको" 3240 3241 #: kdecore/kcalendarsystemcoptic.cpp:324 3242 #, kde-format 3243 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3244 msgid "P" 3245 msgstr "" 3246 3247 #: kdecore/kcalendarsystemcoptic.cpp:326 3248 #, kde-format 3249 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3250 msgid "P" 3251 msgstr "" 3252 3253 #: kdecore/kcalendarsystemcoptic.cpp:328 3254 #, kde-format 3255 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3256 msgid "P" 3257 msgstr "" 3258 3259 #: kdecore/kcalendarsystemcoptic.cpp:330 3260 #, kde-format 3261 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3262 msgid "P" 3263 msgstr "" 3264 3265 #: kdecore/kcalendarsystemcoptic.cpp:332 3266 #, kde-format 3267 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3268 msgid "P" 3269 msgstr "" 3270 3271 #: kdecore/kcalendarsystemcoptic.cpp:334 3272 #, kde-format 3273 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3274 msgid "P" 3275 msgstr "" 3276 3277 #: kdecore/kcalendarsystemcoptic.cpp:336 3278 #, kde-format 3279 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3280 msgid "T" 3281 msgstr "" 3282 3283 #: kdecore/kcalendarsystemcoptic.cpp:345 3284 #, fuzzy, kde-format 3285 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3286 msgid "Pes" 3287 msgstr "PageUp" 3288 3289 #: kdecore/kcalendarsystemcoptic.cpp:347 3290 #, fuzzy, kde-format 3291 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3292 msgid "Psh" 3293 msgstr "पज गर्नुहोस्" 3294 3295 #: kdecore/kcalendarsystemcoptic.cpp:349 3296 #, fuzzy, kde-format 3297 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3298 msgid "Pef" 3299 msgstr "PageUp" 3300 3301 #: kdecore/kcalendarsystemcoptic.cpp:351 3302 #, kde-format 3303 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3304 msgid "Pti" 3305 msgstr "" 3306 3307 #: kdecore/kcalendarsystemcoptic.cpp:353 3308 #, fuzzy, kde-format 3309 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3310 msgid "Pso" 3311 msgstr "पज गर्नुहोस्" 3312 3313 #: kdecore/kcalendarsystemcoptic.cpp:355 3314 #, fuzzy, kde-format 3315 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3316 msgid "Psa" 3317 msgstr "पज गर्नुहोस्" 3318 3319 #: kdecore/kcalendarsystemcoptic.cpp:357 3320 #, kde-format 3321 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3322 msgid "Tky" 3323 msgstr "" 3324 3325 #: kdecore/kcalendarsystemcoptic.cpp:365 3326 #, fuzzy, kde-format 3327 msgctxt "Coptic weekday 1 - KLocale::LongName" 3328 msgid "Pesnau" 3329 msgstr "पज गर्नुहोस्" 3330 3331 #: kdecore/kcalendarsystemcoptic.cpp:367 3332 #, fuzzy, kde-format 3333 msgctxt "Coptic weekday 2 - KLocale::LongName" 3334 msgid "Pshoment" 3335 msgstr "टिप्पणी" 3336 3337 #: kdecore/kcalendarsystemcoptic.cpp:369 3338 #, kde-format 3339 msgctxt "Coptic weekday 3 - KLocale::LongName" 3340 msgid "Peftoou" 3341 msgstr "" 3342 3343 #: kdecore/kcalendarsystemcoptic.cpp:371 3344 #, kde-format 3345 msgctxt "Coptic weekday 4 - KLocale::LongName" 3346 msgid "Ptiou" 3347 msgstr "" 3348 3349 #: kdecore/kcalendarsystemcoptic.cpp:373 3350 #, fuzzy, kde-format 3351 msgctxt "Coptic weekday 5 - KLocale::LongName" 3352 msgid "Psoou" 3353 msgstr "पज गर्नुहोस्" 3354 3355 #: kdecore/kcalendarsystemcoptic.cpp:375 3356 #, kde-format 3357 msgctxt "Coptic weekday 6 - KLocale::LongName" 3358 msgid "Psabbaton" 3359 msgstr "" 3360 3361 #: kdecore/kcalendarsystemcoptic.cpp:377 3362 #, kde-format 3363 msgctxt "Coptic weekday 7 - KLocale::LongName" 3364 msgid "Tkyriakē" 3365 msgstr "" 3366 3367 #: kdecore/kcalendarsystemethiopian.cpp:50 3368 #, kde-format 3369 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3370 msgid "Amata Mehrat" 3371 msgstr "" 3372 3373 #: kdecore/kcalendarsystemethiopian.cpp:51 3374 #, kde-format 3375 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3376 msgid "AM" 3377 msgstr "" 3378 3379 #: kdecore/kcalendarsystemethiopian.cpp:52 3380 #, kde-format 3381 msgctxt "" 3382 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3383 msgid "%Ey %EC" 3384 msgstr "" 3385 3386 #: kdecore/kcalendarsystemethiopian.cpp:66 3387 #, kde-format 3388 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3389 msgid "M" 3390 msgstr "" 3391 3392 #: kdecore/kcalendarsystemethiopian.cpp:68 3393 #, kde-format 3394 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3395 msgid "T" 3396 msgstr "" 3397 3398 #: kdecore/kcalendarsystemethiopian.cpp:70 3399 #, kde-format 3400 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3401 msgid "H" 3402 msgstr "" 3403 3404 #: kdecore/kcalendarsystemethiopian.cpp:72 3405 #, kde-format 3406 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3407 msgid "T" 3408 msgstr "" 3409 3410 #: kdecore/kcalendarsystemethiopian.cpp:74 3411 #, kde-format 3412 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3413 msgid "T" 3414 msgstr "" 3415 3416 #: kdecore/kcalendarsystemethiopian.cpp:76 3417 #, kde-format 3418 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3419 msgid "Y" 3420 msgstr "" 3421 3422 #: kdecore/kcalendarsystemethiopian.cpp:78 3423 #, kde-format 3424 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3425 msgid "M" 3426 msgstr "" 3427 3428 #: kdecore/kcalendarsystemethiopian.cpp:80 3429 #, kde-format 3430 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3431 msgid "M" 3432 msgstr "" 3433 3434 #: kdecore/kcalendarsystemethiopian.cpp:82 3435 #, kde-format 3436 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3437 msgid "G" 3438 msgstr "" 3439 3440 #: kdecore/kcalendarsystemethiopian.cpp:84 3441 #, kde-format 3442 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3443 msgid "S" 3444 msgstr "" 3445 3446 #: kdecore/kcalendarsystemethiopian.cpp:86 3447 #, kde-format 3448 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3449 msgid "H" 3450 msgstr "" 3451 3452 #: kdecore/kcalendarsystemethiopian.cpp:88 3453 #, kde-format 3454 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3455 msgid "N" 3456 msgstr "" 3457 3458 #: kdecore/kcalendarsystemethiopian.cpp:90 3459 #, kde-format 3460 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3461 msgid "P" 3462 msgstr "" 3463 3464 #: kdecore/kcalendarsystemethiopian.cpp:99 3465 #, fuzzy, kde-format 3466 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3467 msgid "of Mes" 3468 msgstr "of Meh" 3469 3470 #: kdecore/kcalendarsystemethiopian.cpp:101 3471 #, fuzzy, kde-format 3472 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3473 msgid "of Teq" 3474 msgstr "of Tevet" 3475 3476 #: kdecore/kcalendarsystemethiopian.cpp:103 3477 #, fuzzy, kde-format 3478 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3479 msgid "of Hed" 3480 msgstr "फेब्रुअरीको" 3481 3482 #: kdecore/kcalendarsystemethiopian.cpp:105 3483 #, fuzzy, kde-format 3484 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3485 msgid "of Tah" 3486 msgstr "of Bah" 3487 3488 #: kdecore/kcalendarsystemethiopian.cpp:107 3489 #, fuzzy, kde-format 3490 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3491 msgid "of Ter" 3492 msgstr "of Tir" 3493 3494 #: kdecore/kcalendarsystemethiopian.cpp:109 3495 #, fuzzy, kde-format 3496 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3497 msgid "of Yak" 3498 msgstr "जनवरीको" 3499 3500 #: kdecore/kcalendarsystemethiopian.cpp:111 3501 #, fuzzy, kde-format 3502 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3503 msgid "of Mag" 3504 msgstr "मार्चको" 3505 3506 #: kdecore/kcalendarsystemethiopian.cpp:113 3507 #, fuzzy, kde-format 3508 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3509 msgid "of Miy" 3510 msgstr "मेको" 3511 3512 #: kdecore/kcalendarsystemethiopian.cpp:115 3513 #, fuzzy, kde-format 3514 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3515 msgid "of Gen" 3516 msgstr "जनवरीको" 3517 3518 #: kdecore/kcalendarsystemethiopian.cpp:117 3519 #, fuzzy, kde-format 3520 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3521 msgid "of Sen" 3522 msgstr "सेप्टेम्बरको" 3523 3524 #: kdecore/kcalendarsystemethiopian.cpp:119 3525 #, fuzzy, kde-format 3526 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3527 msgid "of Ham" 3528 msgstr "of Tamuz" 3529 3530 #: kdecore/kcalendarsystemethiopian.cpp:121 3531 #, fuzzy, kde-format 3532 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3533 msgid "of Neh" 3534 msgstr "of Meh" 3535 3536 #: kdecore/kcalendarsystemethiopian.cpp:123 3537 #, fuzzy, kde-format 3538 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3539 msgid "of Pag" 3540 msgstr "of Tamuz" 3541 3542 #: kdecore/kcalendarsystemethiopian.cpp:132 3543 #, fuzzy, kde-format 3544 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3545 msgid "Mes" 3546 msgstr "हो" 3547 3548 #: kdecore/kcalendarsystemethiopian.cpp:134 3549 #, fuzzy, kde-format 3550 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3551 msgid "Teq" 3552 msgstr "मङ्गल" 3553 3554 #: kdecore/kcalendarsystemethiopian.cpp:136 3555 #, fuzzy, kde-format 3556 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3557 msgid "Hed" 3558 msgstr "बुध" 3559 3560 #: kdecore/kcalendarsystemethiopian.cpp:138 3561 #, fuzzy, kde-format 3562 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3563 msgid "Tah" 3564 msgstr "रद्दीटोकरी" 3565 3566 #: kdecore/kcalendarsystemethiopian.cpp:140 3567 #, fuzzy, kde-format 3568 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3569 msgid "Ter" 3570 msgstr "मङ्गल" 3571 3572 #: kdecore/kcalendarsystemethiopian.cpp:142 3573 #, fuzzy, kde-format 3574 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3575 msgid "Yak" 3576 msgstr "जनवरीको" 3577 3578 #: kdecore/kcalendarsystemethiopian.cpp:144 3579 #, fuzzy, kde-format 3580 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3581 msgid "Mag" 3582 msgstr "मार्च" 3583 3584 #: kdecore/kcalendarsystemethiopian.cpp:146 3585 #, fuzzy, kde-format 3586 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3587 msgid "Miy" 3588 msgstr "मे" 3589 3590 #: kdecore/kcalendarsystemethiopian.cpp:148 3591 #, fuzzy, kde-format 3592 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3593 msgid "Gen" 3594 msgstr "हरियो:" 3595 3596 #: kdecore/kcalendarsystemethiopian.cpp:150 3597 #, fuzzy, kde-format 3598 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3599 msgid "Sen" 3600 msgstr "पठाउनुहोस्" 3601 3602 #: kdecore/kcalendarsystemethiopian.cpp:152 3603 #, fuzzy, kde-format 3604 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3605 msgid "Ham" 3606 msgstr "पूर्वान्ह" 3607 3608 #: kdecore/kcalendarsystemethiopian.cpp:154 3609 #, fuzzy, kde-format 3610 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3611 msgid "Neh" 3612 msgstr "Meh" 3613 3614 #: kdecore/kcalendarsystemethiopian.cpp:156 3615 #, fuzzy, kde-format 3616 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3617 msgid "Pag" 3618 msgstr "PageUp" 3619 3620 #: kdecore/kcalendarsystemethiopian.cpp:165 3621 #, fuzzy, kde-format 3622 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3623 msgid "of Meskerem" 3624 msgstr "of Mehr" 3625 3626 #: kdecore/kcalendarsystemethiopian.cpp:167 3627 #, fuzzy, kde-format 3628 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3629 msgid "of Tequemt" 3630 msgstr "of Tevet" 3631 3632 #: kdecore/kcalendarsystemethiopian.cpp:169 3633 #, fuzzy, kde-format 3634 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3635 msgid "of Hedar" 3636 msgstr "of Adar" 3637 3638 #: kdecore/kcalendarsystemethiopian.cpp:171 3639 #, fuzzy, kde-format 3640 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3641 msgid "of Tahsas" 3642 msgstr "of Bahman" 3643 3644 #: kdecore/kcalendarsystemethiopian.cpp:173 3645 #, fuzzy, kde-format 3646 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3647 msgid "of Ter" 3648 msgstr "of Tir" 3649 3650 #: kdecore/kcalendarsystemethiopian.cpp:175 3651 #, fuzzy, kde-format 3652 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3653 msgid "of Yakatit" 3654 msgstr "of Far" 3655 3656 #: kdecore/kcalendarsystemethiopian.cpp:177 3657 #, fuzzy, kde-format 3658 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3659 msgid "of Magabit" 3660 msgstr "of Rajab" 3661 3662 #: kdecore/kcalendarsystemethiopian.cpp:179 3663 #, fuzzy, kde-format 3664 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3665 msgid "of Miyazya" 3666 msgstr "मेको" 3667 3668 #: kdecore/kcalendarsystemethiopian.cpp:181 3669 #, fuzzy, kde-format 3670 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3671 msgid "of Genbot" 3672 msgstr "फेब्रुअरीको" 3673 3674 #: kdecore/kcalendarsystemethiopian.cpp:183 3675 #, fuzzy, kde-format 3676 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3677 msgid "of Sene" 3678 msgstr "सेप्टेम्बरको" 3679 3680 #: kdecore/kcalendarsystemethiopian.cpp:185 3681 #, fuzzy, kde-format 3682 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3683 msgid "of Hamle" 3684 msgstr "of Tamuz" 3685 3686 #: kdecore/kcalendarsystemethiopian.cpp:187 3687 #, fuzzy, kde-format 3688 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3689 msgid "of Nehase" 3690 msgstr "of Sha" 3691 3692 #: kdecore/kcalendarsystemethiopian.cpp:189 3693 #, fuzzy, kde-format 3694 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3695 msgid "of Pagumen" 3696 msgstr "of Tamuz" 3697 3698 #: kdecore/kcalendarsystemethiopian.cpp:198 3699 #, fuzzy, kde-format 3700 msgctxt "Ethiopian month 1 - KLocale::LongName" 3701 msgid "Meskerem" 3702 msgstr "of Mehr" 3703 3704 #: kdecore/kcalendarsystemethiopian.cpp:200 3705 #, fuzzy, kde-format 3706 msgctxt "Ethiopian month 2 - KLocale::LongName" 3707 msgid "Tequemt" 3708 msgstr "टेभेट" 3709 3710 #: kdecore/kcalendarsystemethiopian.cpp:202 3711 #, fuzzy, kde-format 3712 msgctxt "Ethiopian month 3 - KLocale::LongName" 3713 msgid "Hedar" 3714 msgstr "अडार" 3715 3716 #: kdecore/kcalendarsystemethiopian.cpp:204 3717 #, fuzzy, kde-format 3718 msgctxt "Ethiopian month 4 - KLocale::LongName" 3719 msgid "Tahsas" 3720 msgstr "कार्य" 3721 3722 #: kdecore/kcalendarsystemethiopian.cpp:206 3723 #, fuzzy, kde-format 3724 msgctxt "Ethiopian month 5 - KLocale::LongName" 3725 msgid "Ter" 3726 msgstr "मङ्गल" 3727 3728 #: kdecore/kcalendarsystemethiopian.cpp:208 3729 #, fuzzy, kde-format 3730 msgctxt "Ethiopian month 6 - KLocale::LongName" 3731 msgid "Yakatit" 3732 msgstr "of Far" 3733 3734 #: kdecore/kcalendarsystemethiopian.cpp:210 3735 #, fuzzy, kde-format 3736 msgctxt "Ethiopian month 7 - KLocale::LongName" 3737 msgid "Magabit" 3738 msgstr "of Rajab" 3739 3740 #: kdecore/kcalendarsystemethiopian.cpp:212 3741 #, fuzzy, kde-format 3742 msgctxt "Ethiopian month 8 - KLocale::LongName" 3743 msgid "Miyazya" 3744 msgstr "मेको" 3745 3746 #: kdecore/kcalendarsystemethiopian.cpp:214 3747 #, fuzzy, kde-format 3748 msgctxt "Ethiopian month 9 - KLocale::LongName" 3749 msgid "Genbot" 3750 msgstr "फेब्रुअरीको" 3751 3752 #: kdecore/kcalendarsystemethiopian.cpp:216 3753 #, fuzzy, kde-format 3754 msgctxt "Ethiopian month 10 - KLocale::LongName" 3755 msgid "Sene" 3756 msgstr "पठाउनुहोस्" 3757 3758 #: kdecore/kcalendarsystemethiopian.cpp:218 3759 #, fuzzy, kde-format 3760 msgctxt "Ethiopian month 11 - KLocale::LongName" 3761 msgid "Hamle" 3762 msgstr "नाम" 3763 3764 #: kdecore/kcalendarsystemethiopian.cpp:220 3765 #, fuzzy, kde-format 3766 msgctxt "Ethiopian month 12 - KLocale::LongName" 3767 msgid "Nehase" 3768 msgstr "नाम" 3769 3770 #: kdecore/kcalendarsystemethiopian.cpp:222 3771 #, fuzzy, kde-format 3772 msgctxt "Ethiopian month 13 - KLocale::LongName" 3773 msgid "Pagumen" 3774 msgstr "PageUp" 3775 3776 #: kdecore/kcalendarsystemethiopian.cpp:236 3777 #, kde-format 3778 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3779 msgid "S" 3780 msgstr "" 3781 3782 #: kdecore/kcalendarsystemethiopian.cpp:238 3783 #, kde-format 3784 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3785 msgid "M" 3786 msgstr "" 3787 3788 #: kdecore/kcalendarsystemethiopian.cpp:240 3789 #, kde-format 3790 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3791 msgid "R" 3792 msgstr "" 3793 3794 #: kdecore/kcalendarsystemethiopian.cpp:242 3795 #, kde-format 3796 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3797 msgid "H" 3798 msgstr "" 3799 3800 #: kdecore/kcalendarsystemethiopian.cpp:244 3801 #, fuzzy, kde-format 3802 #| msgid "Av" 3803 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3804 msgid "A" 3805 msgstr "एभ" 3806 3807 #: kdecore/kcalendarsystemethiopian.cpp:246 3808 #, kde-format 3809 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3810 msgid "Q" 3811 msgstr "" 3812 3813 #: kdecore/kcalendarsystemethiopian.cpp:248 3814 #, kde-format 3815 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3816 msgid "E" 3817 msgstr "" 3818 3819 #: kdecore/kcalendarsystemethiopian.cpp:257 3820 #, fuzzy, kde-format 3821 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3822 msgid "Seg" 3823 msgstr "सेप्टेम्बर" 3824 3825 #: kdecore/kcalendarsystemethiopian.cpp:259 3826 #, fuzzy, kde-format 3827 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3828 msgid "Mak" 3829 msgstr "मार्च" 3830 3831 #: kdecore/kcalendarsystemethiopian.cpp:261 3832 #, fuzzy, kde-format 3833 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3834 msgid "Rob" 3835 msgstr "Jom" 3836 3837 #: kdecore/kcalendarsystemethiopian.cpp:263 3838 #, fuzzy, kde-format 3839 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3840 msgid "Ham" 3841 msgstr "पूर्वान्ह" 3842 3843 #: kdecore/kcalendarsystemethiopian.cpp:265 3844 #, fuzzy, kde-format 3845 #| msgid "Arb" 3846 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3847 msgid "Arb" 3848 msgstr "Arb" 3849 3850 #: kdecore/kcalendarsystemethiopian.cpp:267 3851 #, fuzzy, kde-format 3852 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3853 msgid "Qed" 3854 msgstr "बुध" 3855 3856 #: kdecore/kcalendarsystemethiopian.cpp:269 3857 #, fuzzy, kde-format 3858 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3859 msgid "Ehu" 3860 msgstr "बिही" 3861 3862 #: kdecore/kcalendarsystemethiopian.cpp:276 3863 #, fuzzy, kde-format 3864 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3865 msgid "Segno" 3866 msgstr "पठाउनुहोस्" 3867 3868 #: kdecore/kcalendarsystemethiopian.cpp:278 3869 #, fuzzy, kde-format 3870 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3871 msgid "Maksegno" 3872 msgstr "पठाउनुहोस्" 3873 3874 #: kdecore/kcalendarsystemethiopian.cpp:280 3875 #, fuzzy, kde-format 3876 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3877 msgid "Rob" 3878 msgstr "Jom" 3879 3880 #: kdecore/kcalendarsystemethiopian.cpp:282 3881 #, fuzzy, kde-format 3882 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3883 msgid "Hamus" 3884 msgstr "पज गर्नुहोस्" 3885 3886 #: kdecore/kcalendarsystemethiopian.cpp:284 3887 #, fuzzy, kde-format 3888 #| msgid "Arb" 3889 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3890 msgid "Arb" 3891 msgstr "Arb" 3892 3893 #: kdecore/kcalendarsystemethiopian.cpp:286 3894 #, fuzzy, kde-format 3895 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3896 msgid "Qedame" 3897 msgstr "नाम" 3898 3899 #: kdecore/kcalendarsystemethiopian.cpp:288 3900 #, fuzzy, kde-format 3901 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3902 msgid "Ehud" 3903 msgstr "बिही" 3904 3905 #: kdecore/kcalendarsystemgregorian.cpp:53 3906 #, kde-format 3907 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3908 msgid "Before Common Era" 3909 msgstr "" 3910 3911 #: kdecore/kcalendarsystemgregorian.cpp:54 3912 #, kde-format 3913 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3914 msgid "BCE" 3915 msgstr "" 3916 3917 #: kdecore/kcalendarsystemgregorian.cpp:56 3918 #, kde-format 3919 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3920 msgid "Before Christ" 3921 msgstr "" 3922 3923 #: kdecore/kcalendarsystemgregorian.cpp:57 3924 #, kde-format 3925 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3926 msgid "BC" 3927 msgstr "" 3928 3929 #: kdecore/kcalendarsystemgregorian.cpp:59 3930 #, kde-format 3931 msgctxt "" 3932 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3933 msgid "%Ey %EC" 3934 msgstr "" 3935 3936 #: kdecore/kcalendarsystemgregorian.cpp:63 3937 #, kde-format 3938 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3939 msgid "Common Era" 3940 msgstr "" 3941 3942 #: kdecore/kcalendarsystemgregorian.cpp:64 3943 #, kde-format 3944 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3945 msgid "CE" 3946 msgstr "" 3947 3948 #: kdecore/kcalendarsystemgregorian.cpp:66 3949 #: kdecore/kcalendarsystemjapanese.cpp:57 3950 #, kde-format 3951 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3952 msgid "Anno Domini" 3953 msgstr "" 3954 3955 #: kdecore/kcalendarsystemgregorian.cpp:67 3956 #: kdecore/kcalendarsystemjapanese.cpp:58 3957 #, kde-format 3958 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3959 msgid "AD" 3960 msgstr "" 3961 3962 #: kdecore/kcalendarsystemgregorian.cpp:69 3963 #: kdecore/kcalendarsystemjapanese.cpp:59 3964 #, kde-format 3965 msgctxt "" 3966 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3967 msgid "%Ey %EC" 3968 msgstr "" 3969 3970 #: kdecore/kcalendarsystemgregorian.cpp:138 3971 #, kde-format 3972 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3973 msgid "J" 3974 msgstr "" 3975 3976 #: kdecore/kcalendarsystemgregorian.cpp:140 3977 #, kde-format 3978 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3979 msgid "F" 3980 msgstr "" 3981 3982 #: kdecore/kcalendarsystemgregorian.cpp:142 3983 #, kde-format 3984 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3985 msgid "M" 3986 msgstr "" 3987 3988 #: kdecore/kcalendarsystemgregorian.cpp:144 3989 #, fuzzy, kde-format 3990 #| msgid "Av" 3991 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3992 msgid "A" 3993 msgstr "एभ" 3994 3995 #: kdecore/kcalendarsystemgregorian.cpp:146 3996 #, kde-format 3997 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3998 msgid "M" 3999 msgstr "" 4000 4001 #: kdecore/kcalendarsystemgregorian.cpp:148 4002 #, kde-format 4003 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4004 msgid "J" 4005 msgstr "" 4006 4007 #: kdecore/kcalendarsystemgregorian.cpp:150 4008 #, kde-format 4009 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4010 msgid "J" 4011 msgstr "" 4012 4013 #: kdecore/kcalendarsystemgregorian.cpp:152 4014 #, fuzzy, kde-format 4015 #| msgid "Av" 4016 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4017 msgid "A" 4018 msgstr "एभ" 4019 4020 #: kdecore/kcalendarsystemgregorian.cpp:154 4021 #, kde-format 4022 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4023 msgid "S" 4024 msgstr "" 4025 4026 #: kdecore/kcalendarsystemgregorian.cpp:156 4027 #, kde-format 4028 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4029 msgid "O" 4030 msgstr "" 4031 4032 #: kdecore/kcalendarsystemgregorian.cpp:158 4033 #, kde-format 4034 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4035 msgid "N" 4036 msgstr "" 4037 4038 #: kdecore/kcalendarsystemgregorian.cpp:160 4039 #, kde-format 4040 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4041 msgid "D" 4042 msgstr "" 4043 4044 #: kdecore/kcalendarsystemgregorian.cpp:169 4045 #, fuzzy, kde-format 4046 #| msgctxt "of January" 4047 #| msgid "of Jan" 4048 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4049 msgid "of Jan" 4050 msgstr "जनवरीको" 4051 4052 #: kdecore/kcalendarsystemgregorian.cpp:171 4053 #, fuzzy, kde-format 4054 #| msgctxt "of February" 4055 #| msgid "of Feb" 4056 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4057 msgid "of Feb" 4058 msgstr "फेब्रुअरीको" 4059 4060 #: kdecore/kcalendarsystemgregorian.cpp:173 4061 #, fuzzy, kde-format 4062 #| msgctxt "of March" 4063 #| msgid "of Mar" 4064 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4065 msgid "of Mar" 4066 msgstr "मार्चको" 4067 4068 #: kdecore/kcalendarsystemgregorian.cpp:175 4069 #, fuzzy, kde-format 4070 #| msgctxt "of April" 4071 #| msgid "of Apr" 4072 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4073 msgid "of Apr" 4074 msgstr "अप्रिलको" 4075 4076 #: kdecore/kcalendarsystemgregorian.cpp:177 4077 #, fuzzy, kde-format 4078 #| msgctxt "of May short" 4079 #| msgid "of May" 4080 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4081 msgid "of May" 4082 msgstr "मेको" 4083 4084 #: kdecore/kcalendarsystemgregorian.cpp:179 4085 #, fuzzy, kde-format 4086 #| msgctxt "of June" 4087 #| msgid "of Jun" 4088 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4089 msgid "of Jun" 4090 msgstr "जुनको" 4091 4092 #: kdecore/kcalendarsystemgregorian.cpp:181 4093 #, fuzzy, kde-format 4094 #| msgctxt "of July" 4095 #| msgid "of Jul" 4096 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4097 msgid "of Jul" 4098 msgstr "जुलाइको" 4099 4100 #: kdecore/kcalendarsystemgregorian.cpp:183 4101 #, fuzzy, kde-format 4102 #| msgctxt "of August" 4103 #| msgid "of Aug" 4104 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4105 msgid "of Aug" 4106 msgstr "अगस्टको" 4107 4108 #: kdecore/kcalendarsystemgregorian.cpp:185 4109 #, fuzzy, kde-format 4110 #| msgctxt "of September" 4111 #| msgid "of Sep" 4112 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4113 msgid "of Sep" 4114 msgstr "सेप्टेम्बरको" 4115 4116 #: kdecore/kcalendarsystemgregorian.cpp:187 4117 #, fuzzy, kde-format 4118 #| msgctxt "of October" 4119 #| msgid "of Oct" 4120 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4121 msgid "of Oct" 4122 msgstr "अक्टोबरको" 4123 4124 #: kdecore/kcalendarsystemgregorian.cpp:189 4125 #, fuzzy, kde-format 4126 #| msgctxt "of November" 4127 #| msgid "of Nov" 4128 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4129 msgid "of Nov" 4130 msgstr "नोभेम्बरको" 4131 4132 #: kdecore/kcalendarsystemgregorian.cpp:191 4133 #, fuzzy, kde-format 4134 #| msgctxt "of December" 4135 #| msgid "of Dec" 4136 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4137 msgid "of Dec" 4138 msgstr "डिसेम्बरको" 4139 4140 #: kdecore/kcalendarsystemgregorian.cpp:200 4141 #, fuzzy, kde-format 4142 #| msgctxt "January" 4143 #| msgid "Jan" 4144 msgctxt "Gregorian month 1 - KLocale::ShortName" 4145 msgid "Jan" 4146 msgstr "जनवरी" 4147 4148 #: kdecore/kcalendarsystemgregorian.cpp:202 4149 #, fuzzy, kde-format 4150 #| msgctxt "February" 4151 #| msgid "Feb" 4152 msgctxt "Gregorian month 2 - KLocale::ShortName" 4153 msgid "Feb" 4154 msgstr "फेब्रुअरी" 4155 4156 #: kdecore/kcalendarsystemgregorian.cpp:204 4157 #, fuzzy, kde-format 4158 #| msgctxt "March" 4159 #| msgid "Mar" 4160 msgctxt "Gregorian month 3 - KLocale::ShortName" 4161 msgid "Mar" 4162 msgstr "मार्च" 4163 4164 #: kdecore/kcalendarsystemgregorian.cpp:206 4165 #, fuzzy, kde-format 4166 #| msgctxt "April" 4167 #| msgid "Apr" 4168 msgctxt "Gregorian month 4 - KLocale::ShortName" 4169 msgid "Apr" 4170 msgstr "अप्रिल" 4171 4172 #: kdecore/kcalendarsystemgregorian.cpp:208 4173 #, fuzzy, kde-format 4174 #| msgctxt "May short" 4175 #| msgid "May" 4176 msgctxt "Gregorian month 5 - KLocale::ShortName" 4177 msgid "May" 4178 msgstr "मे" 4179 4180 #: kdecore/kcalendarsystemgregorian.cpp:210 4181 #, fuzzy, kde-format 4182 #| msgctxt "June" 4183 #| msgid "Jun" 4184 msgctxt "Gregorian month 6 - KLocale::ShortName" 4185 msgid "Jun" 4186 msgstr "जुन" 4187 4188 #: kdecore/kcalendarsystemgregorian.cpp:212 4189 #, fuzzy, kde-format 4190 #| msgctxt "July" 4191 #| msgid "Jul" 4192 msgctxt "Gregorian month 7 - KLocale::ShortName" 4193 msgid "Jul" 4194 msgstr "जुलाइ" 4195 4196 #: kdecore/kcalendarsystemgregorian.cpp:214 4197 #, fuzzy, kde-format 4198 #| msgctxt "August" 4199 #| msgid "Aug" 4200 msgctxt "Gregorian month 8 - KLocale::ShortName" 4201 msgid "Aug" 4202 msgstr "अगस्ट" 4203 4204 #: kdecore/kcalendarsystemgregorian.cpp:216 4205 #, fuzzy, kde-format 4206 #| msgctxt "September" 4207 #| msgid "Sep" 4208 msgctxt "Gregorian month 9 - KLocale::ShortName" 4209 msgid "Sep" 4210 msgstr "सेप्टेम्बर" 4211 4212 #: kdecore/kcalendarsystemgregorian.cpp:218 4213 #, fuzzy, kde-format 4214 #| msgctxt "October" 4215 #| msgid "Oct" 4216 msgctxt "Gregorian month 10 - KLocale::ShortName" 4217 msgid "Oct" 4218 msgstr "अक्टोबर" 4219 4220 #: kdecore/kcalendarsystemgregorian.cpp:220 4221 #, fuzzy, kde-format 4222 #| msgctxt "November" 4223 #| msgid "Nov" 4224 msgctxt "Gregorian month 11 - KLocale::ShortName" 4225 msgid "Nov" 4226 msgstr "नोभेम्बर" 4227 4228 #: kdecore/kcalendarsystemgregorian.cpp:222 4229 #, fuzzy, kde-format 4230 #| msgctxt "December" 4231 #| msgid "Dec" 4232 msgctxt "Gregorian month 12 - KLocale::ShortName" 4233 msgid "Dec" 4234 msgstr "डिसेम्बर" 4235 4236 #: kdecore/kcalendarsystemgregorian.cpp:231 4237 #, fuzzy, kde-format 4238 #| msgid "of January" 4239 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4240 msgid "of January" 4241 msgstr "जनवरीको" 4242 4243 #: kdecore/kcalendarsystemgregorian.cpp:233 4244 #, fuzzy, kde-format 4245 #| msgid "of February" 4246 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4247 msgid "of February" 4248 msgstr "फेब्रुअरीको" 4249 4250 #: kdecore/kcalendarsystemgregorian.cpp:235 4251 #, fuzzy, kde-format 4252 #| msgid "of March" 4253 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4254 msgid "of March" 4255 msgstr "मार्चको" 4256 4257 #: kdecore/kcalendarsystemgregorian.cpp:237 4258 #, fuzzy, kde-format 4259 #| msgid "of April" 4260 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4261 msgid "of April" 4262 msgstr "अप्रिलको" 4263 4264 #: kdecore/kcalendarsystemgregorian.cpp:239 4265 #, fuzzy, kde-format 4266 #| msgctxt "of May short" 4267 #| msgid "of May" 4268 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4269 msgid "of May" 4270 msgstr "मेको" 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:241 4273 #, fuzzy, kde-format 4274 #| msgid "of June" 4275 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4276 msgid "of June" 4277 msgstr "जुनको" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:243 4280 #, fuzzy, kde-format 4281 #| msgid "of July" 4282 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4283 msgid "of July" 4284 msgstr "जुलाइको" 4285 4286 #: kdecore/kcalendarsystemgregorian.cpp:245 4287 #, fuzzy, kde-format 4288 #| msgid "of August" 4289 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4290 msgid "of August" 4291 msgstr "अगस्टको" 4292 4293 #: kdecore/kcalendarsystemgregorian.cpp:247 4294 #, fuzzy, kde-format 4295 #| msgid "of September" 4296 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4297 msgid "of September" 4298 msgstr "सेप्टेम्बरको" 4299 4300 #: kdecore/kcalendarsystemgregorian.cpp:249 4301 #, fuzzy, kde-format 4302 #| msgid "of October" 4303 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4304 msgid "of October" 4305 msgstr "अक्टोबरको" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:251 4308 #, fuzzy, kde-format 4309 #| msgid "of November" 4310 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4311 msgid "of November" 4312 msgstr "नोभेम्बरको" 4313 4314 #: kdecore/kcalendarsystemgregorian.cpp:253 4315 #, fuzzy, kde-format 4316 #| msgid "of December" 4317 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4318 msgid "of December" 4319 msgstr "डिसेम्बरको" 4320 4321 #: kdecore/kcalendarsystemgregorian.cpp:262 4322 #, fuzzy, kde-format 4323 #| msgid "January" 4324 msgctxt "Gregorian month 1 - KLocale::LongName" 4325 msgid "January" 4326 msgstr "जनवरी" 4327 4328 #: kdecore/kcalendarsystemgregorian.cpp:264 4329 #, fuzzy, kde-format 4330 #| msgid "February" 4331 msgctxt "Gregorian month 2 - KLocale::LongName" 4332 msgid "February" 4333 msgstr "फेब्रुअरी" 4334 4335 #: kdecore/kcalendarsystemgregorian.cpp:266 4336 #, fuzzy, kde-format 4337 #| msgctxt "March long" 4338 #| msgid "March" 4339 msgctxt "Gregorian month 3 - KLocale::LongName" 4340 msgid "March" 4341 msgstr "मार्च" 4342 4343 #: kdecore/kcalendarsystemgregorian.cpp:268 4344 #, fuzzy, kde-format 4345 #| msgid "April" 4346 msgctxt "Gregorian month 4 - KLocale::LongName" 4347 msgid "April" 4348 msgstr "अप्रिल" 4349 4350 #: kdecore/kcalendarsystemgregorian.cpp:270 4351 #, fuzzy, kde-format 4352 #| msgctxt "May short" 4353 #| msgid "May" 4354 msgctxt "Gregorian month 5 - KLocale::LongName" 4355 msgid "May" 4356 msgstr "मे" 4357 4358 #: kdecore/kcalendarsystemgregorian.cpp:272 4359 #, fuzzy, kde-format 4360 #| msgid "June" 4361 msgctxt "Gregorian month 6 - KLocale::LongName" 4362 msgid "June" 4363 msgstr "जुन" 4364 4365 #: kdecore/kcalendarsystemgregorian.cpp:274 4366 #, fuzzy, kde-format 4367 #| msgid "July" 4368 msgctxt "Gregorian month 7 - KLocale::LongName" 4369 msgid "July" 4370 msgstr "जुलाइ" 4371 4372 #: kdecore/kcalendarsystemgregorian.cpp:276 4373 #, fuzzy, kde-format 4374 #| msgctxt "August long" 4375 #| msgid "August" 4376 msgctxt "Gregorian month 8 - KLocale::LongName" 4377 msgid "August" 4378 msgstr "अगस्ट" 4379 4380 #: kdecore/kcalendarsystemgregorian.cpp:278 4381 #, fuzzy, kde-format 4382 #| msgid "September" 4383 msgctxt "Gregorian month 9 - KLocale::LongName" 4384 msgid "September" 4385 msgstr "सेप्टेम्बर" 4386 4387 #: kdecore/kcalendarsystemgregorian.cpp:280 4388 #, fuzzy, kde-format 4389 #| msgid "October" 4390 msgctxt "Gregorian month 10 - KLocale::LongName" 4391 msgid "October" 4392 msgstr "अक्टोबर" 4393 4394 #: kdecore/kcalendarsystemgregorian.cpp:282 4395 #, fuzzy, kde-format 4396 #| msgid "November" 4397 msgctxt "Gregorian month 11 - KLocale::LongName" 4398 msgid "November" 4399 msgstr "नोभेम्बर" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:284 4402 #, fuzzy, kde-format 4403 #| msgid "December" 4404 msgctxt "Gregorian month 12 - KLocale::LongName" 4405 msgid "December" 4406 msgstr "डिसेम्बर" 4407 4408 #: kdecore/kcalendarsystemgregorian.cpp:297 4409 #: kdecore/kcalendarsystemhebrew.cpp:807 4410 #, kde-format 4411 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4412 msgid "M" 4413 msgstr "" 4414 4415 #: kdecore/kcalendarsystemgregorian.cpp:299 4416 #: kdecore/kcalendarsystemhebrew.cpp:809 4417 #, kde-format 4418 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4419 msgid "T" 4420 msgstr "" 4421 4422 #: kdecore/kcalendarsystemgregorian.cpp:301 4423 #: kdecore/kcalendarsystemhebrew.cpp:811 4424 #, kde-format 4425 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4426 msgid "W" 4427 msgstr "" 4428 4429 #: kdecore/kcalendarsystemgregorian.cpp:303 4430 #: kdecore/kcalendarsystemhebrew.cpp:813 4431 #, kde-format 4432 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4433 msgid "T" 4434 msgstr "" 4435 4436 #: kdecore/kcalendarsystemgregorian.cpp:305 4437 #: kdecore/kcalendarsystemhebrew.cpp:815 4438 #, kde-format 4439 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4440 msgid "F" 4441 msgstr "" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:307 4444 #: kdecore/kcalendarsystemhebrew.cpp:817 4445 #, kde-format 4446 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4447 msgid "S" 4448 msgstr "" 4449 4450 #: kdecore/kcalendarsystemgregorian.cpp:309 4451 #: kdecore/kcalendarsystemhebrew.cpp:819 4452 #, kde-format 4453 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4454 msgid "S" 4455 msgstr "" 4456 4457 #: kdecore/kcalendarsystemgregorian.cpp:318 4458 #: kdecore/kcalendarsystemhebrew.cpp:828 4459 #, fuzzy, kde-format 4460 #| msgctxt "Monday" 4461 #| msgid "Mon" 4462 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4463 msgid "Mon" 4464 msgstr "सोम" 4465 4466 #: kdecore/kcalendarsystemgregorian.cpp:320 4467 #: kdecore/kcalendarsystemhebrew.cpp:830 4468 #, fuzzy, kde-format 4469 #| msgctxt "Tuesday" 4470 #| msgid "Tue" 4471 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4472 msgid "Tue" 4473 msgstr "मङ्गल" 4474 4475 #: kdecore/kcalendarsystemgregorian.cpp:322 4476 #: kdecore/kcalendarsystemhebrew.cpp:832 4477 #, fuzzy, kde-format 4478 #| msgctxt "Wednesday" 4479 #| msgid "Wed" 4480 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4481 msgid "Wed" 4482 msgstr "बुध" 4483 4484 #: kdecore/kcalendarsystemgregorian.cpp:324 4485 #: kdecore/kcalendarsystemhebrew.cpp:834 4486 #, fuzzy, kde-format 4487 #| msgctxt "Thursday" 4488 #| msgid "Thu" 4489 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4490 msgid "Thu" 4491 msgstr "बिही" 4492 4493 #: kdecore/kcalendarsystemgregorian.cpp:326 4494 #: kdecore/kcalendarsystemhebrew.cpp:836 4495 #, fuzzy, kde-format 4496 #| msgctxt "Friday" 4497 #| msgid "Fri" 4498 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4499 msgid "Fri" 4500 msgstr "शुक्र" 4501 4502 #: kdecore/kcalendarsystemgregorian.cpp:328 4503 #: kdecore/kcalendarsystemhebrew.cpp:838 4504 #, fuzzy, kde-format 4505 #| msgctxt "Saturday" 4506 #| msgid "Sat" 4507 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4508 msgid "Sat" 4509 msgstr "शनि" 4510 4511 #: kdecore/kcalendarsystemgregorian.cpp:330 4512 #: kdecore/kcalendarsystemhebrew.cpp:840 4513 #, fuzzy, kde-format 4514 #| msgctxt "Sunday" 4515 #| msgid "Sun" 4516 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4517 msgid "Sun" 4518 msgstr "आइत" 4519 4520 #: kdecore/kcalendarsystemgregorian.cpp:337 4521 #: kdecore/kcalendarsystemhebrew.cpp:847 4522 #, fuzzy, kde-format 4523 #| msgid "Monday" 4524 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4525 msgid "Monday" 4526 msgstr "सोमबार" 4527 4528 #: kdecore/kcalendarsystemgregorian.cpp:339 4529 #: kdecore/kcalendarsystemhebrew.cpp:849 4530 #, fuzzy, kde-format 4531 #| msgid "Tuesday" 4532 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4533 msgid "Tuesday" 4534 msgstr "मङ्गलबार" 4535 4536 #: kdecore/kcalendarsystemgregorian.cpp:341 4537 #: kdecore/kcalendarsystemhebrew.cpp:851 4538 #, fuzzy, kde-format 4539 #| msgid "Wednesday" 4540 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4541 msgid "Wednesday" 4542 msgstr "बुधबार" 4543 4544 #: kdecore/kcalendarsystemgregorian.cpp:343 4545 #: kdecore/kcalendarsystemhebrew.cpp:853 4546 #, fuzzy, kde-format 4547 #| msgid "Thursday" 4548 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4549 msgid "Thursday" 4550 msgstr "बिहिबार" 4551 4552 #: kdecore/kcalendarsystemgregorian.cpp:345 4553 #: kdecore/kcalendarsystemhebrew.cpp:855 4554 #, fuzzy, kde-format 4555 #| msgid "Friday" 4556 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4557 msgid "Friday" 4558 msgstr "शुक्रबार" 4559 4560 #: kdecore/kcalendarsystemgregorian.cpp:347 4561 #: kdecore/kcalendarsystemhebrew.cpp:857 4562 #, fuzzy, kde-format 4563 #| msgid "Saturday" 4564 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4565 msgid "Saturday" 4566 msgstr "शनिबार" 4567 4568 #: kdecore/kcalendarsystemgregorian.cpp:349 4569 #: kdecore/kcalendarsystemhebrew.cpp:859 4570 #, fuzzy, kde-format 4571 #| msgid "Sunday" 4572 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4573 msgid "Sunday" 4574 msgstr "आइतबार" 4575 4576 #: kdecore/kcalendarsystemhebrew.cpp:281 4577 #, kde-format 4578 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4579 msgid "Anno Mundi" 4580 msgstr "" 4581 4582 #: kdecore/kcalendarsystemhebrew.cpp:282 4583 #, kde-format 4584 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4585 msgid "AM" 4586 msgstr "" 4587 4588 #: kdecore/kcalendarsystemhebrew.cpp:283 4589 #, kde-format 4590 msgctxt "" 4591 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4592 msgid "%Ey %EC" 4593 msgstr "" 4594 4595 #: kdecore/kcalendarsystemhebrew.cpp:625 4596 #, kde-format 4597 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4598 msgid "T" 4599 msgstr "" 4600 4601 #: kdecore/kcalendarsystemhebrew.cpp:627 4602 #, kde-format 4603 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4604 msgid "H" 4605 msgstr "" 4606 4607 #: kdecore/kcalendarsystemhebrew.cpp:629 4608 #, kde-format 4609 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4610 msgid "K" 4611 msgstr "" 4612 4613 #: kdecore/kcalendarsystemhebrew.cpp:631 4614 #, kde-format 4615 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4616 msgid "T" 4617 msgstr "" 4618 4619 #: kdecore/kcalendarsystemhebrew.cpp:633 4620 #, kde-format 4621 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4622 msgid "S" 4623 msgstr "" 4624 4625 #: kdecore/kcalendarsystemhebrew.cpp:635 4626 #, fuzzy, kde-format 4627 #| msgid "Av" 4628 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4629 msgid "A" 4630 msgstr "एभ" 4631 4632 #: kdecore/kcalendarsystemhebrew.cpp:637 4633 #, kde-format 4634 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4635 msgid "N" 4636 msgstr "" 4637 4638 #: kdecore/kcalendarsystemhebrew.cpp:639 4639 #, kde-format 4640 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4641 msgid "I" 4642 msgstr "" 4643 4644 #: kdecore/kcalendarsystemhebrew.cpp:641 4645 #, kde-format 4646 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4647 msgid "S" 4648 msgstr "" 4649 4650 #: kdecore/kcalendarsystemhebrew.cpp:643 4651 #, kde-format 4652 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4653 msgid "T" 4654 msgstr "" 4655 4656 #: kdecore/kcalendarsystemhebrew.cpp:645 4657 #, fuzzy, kde-format 4658 #| msgid "Av" 4659 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4660 msgid "A" 4661 msgstr "एभ" 4662 4663 #: kdecore/kcalendarsystemhebrew.cpp:647 4664 #, kde-format 4665 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4666 msgid "E" 4667 msgstr "" 4668 4669 #: kdecore/kcalendarsystemhebrew.cpp:649 4670 #, fuzzy, kde-format 4671 #| msgid "Av" 4672 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4673 msgid "A" 4674 msgstr "एभ" 4675 4676 #: kdecore/kcalendarsystemhebrew.cpp:651 4677 #, fuzzy, kde-format 4678 #| msgid "Av" 4679 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4680 msgid "A" 4681 msgstr "एभ" 4682 4683 #: kdecore/kcalendarsystemhebrew.cpp:660 4684 #, fuzzy, kde-format 4685 #| msgctxt "of Tir short" 4686 #| msgid "of Tir" 4687 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4688 msgid "of Tis" 4689 msgstr "of Tir" 4690 4691 #: kdecore/kcalendarsystemhebrew.cpp:662 4692 #, fuzzy, kde-format 4693 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4694 msgid "of Hes" 4695 msgstr "of Meh" 4696 4697 #: kdecore/kcalendarsystemhebrew.cpp:664 4698 #, fuzzy, kde-format 4699 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4700 msgid "of Kis" 4701 msgstr "of Nisan" 4702 4703 #: kdecore/kcalendarsystemhebrew.cpp:666 4704 #, fuzzy, kde-format 4705 #| msgid "of Tevet" 4706 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4707 msgid "of Tev" 4708 msgstr "of Tevet" 4709 4710 #: kdecore/kcalendarsystemhebrew.cpp:668 4711 #, fuzzy, kde-format 4712 #| msgid "of Shvat" 4713 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4714 msgid "of Shv" 4715 msgstr "of Shvat" 4716 4717 #: kdecore/kcalendarsystemhebrew.cpp:670 4718 #, fuzzy, kde-format 4719 #| msgid "of Adar" 4720 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4721 msgid "of Ada" 4722 msgstr "of Adar" 4723 4724 #: kdecore/kcalendarsystemhebrew.cpp:672 4725 #, fuzzy, kde-format 4726 #| msgid "of Nisan" 4727 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4728 msgid "of Nis" 4729 msgstr "of Nisan" 4730 4731 #: kdecore/kcalendarsystemhebrew.cpp:674 4732 #, fuzzy, kde-format 4733 #| msgid "of Iyar" 4734 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4735 msgid "of Iya" 4736 msgstr "of Iyar" 4737 4738 #: kdecore/kcalendarsystemhebrew.cpp:676 4739 #, fuzzy, kde-format 4740 #| msgid "of Sivan" 4741 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4742 msgid "of Siv" 4743 msgstr "of Sivan" 4744 4745 #: kdecore/kcalendarsystemhebrew.cpp:678 4746 #, fuzzy, kde-format 4747 #| msgid "of Tamuz" 4748 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4749 msgid "of Tam" 4750 msgstr "of Tamuz" 4751 4752 #: kdecore/kcalendarsystemhebrew.cpp:680 4753 #, fuzzy, kde-format 4754 #| msgid "of Av" 4755 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4756 msgid "of Av" 4757 msgstr "of Av" 4758 4759 #: kdecore/kcalendarsystemhebrew.cpp:682 4760 #, fuzzy, kde-format 4761 #| msgid "of Elul" 4762 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4763 msgid "of Elu" 4764 msgstr "of Elul" 4765 4766 #: kdecore/kcalendarsystemhebrew.cpp:684 4767 #, fuzzy, kde-format 4768 #| msgid "of Adar" 4769 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4770 msgid "of Ad1" 4771 msgstr "of Adar" 4772 4773 #: kdecore/kcalendarsystemhebrew.cpp:686 4774 #, fuzzy, kde-format 4775 #| msgid "of Adar" 4776 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4777 msgid "of Ad2" 4778 msgstr "of Adar" 4779 4780 #: kdecore/kcalendarsystemhebrew.cpp:695 4781 #, fuzzy, kde-format 4782 #| msgctxt "Tir short" 4783 #| msgid "Tir" 4784 msgctxt "Hebrew month 1 - KLocale::ShortName" 4785 msgid "Tis" 4786 msgstr "Tir" 4787 4788 #: kdecore/kcalendarsystemhebrew.cpp:697 4789 #, fuzzy, kde-format 4790 msgctxt "Hebrew month 2 - KLocale::ShortName" 4791 msgid "Hes" 4792 msgstr "हो" 4793 4794 #: kdecore/kcalendarsystemhebrew.cpp:699 4795 #, fuzzy, kde-format 4796 #| msgid "Kislev" 4797 msgctxt "Hebrew month 3 - KLocale::ShortName" 4798 msgid "Kis" 4799 msgstr "किस्लेभ" 4800 4801 #: kdecore/kcalendarsystemhebrew.cpp:701 4802 #, fuzzy, kde-format 4803 #| msgid "Tevet" 4804 msgctxt "Hebrew month 4 - KLocale::ShortName" 4805 msgid "Tev" 4806 msgstr "टेभेट" 4807 4808 #: kdecore/kcalendarsystemhebrew.cpp:703 4809 #, fuzzy, kde-format 4810 #| msgid "Shvat" 4811 msgctxt "Hebrew month 5 - KLocale::ShortName" 4812 msgid "Shv" 4813 msgstr "साभेट" 4814 4815 #: kdecore/kcalendarsystemhebrew.cpp:705 4816 #, fuzzy, kde-format 4817 #| msgid "Adar" 4818 msgctxt "Hebrew month 6 - KLocale::ShortName" 4819 msgid "Ada" 4820 msgstr "अडार" 4821 4822 #: kdecore/kcalendarsystemhebrew.cpp:707 4823 #, fuzzy, kde-format 4824 #| msgid "Nisan" 4825 msgctxt "Hebrew month 7 - KLocale::ShortName" 4826 msgid "Nis" 4827 msgstr "निशान" 4828 4829 #: kdecore/kcalendarsystemhebrew.cpp:709 4830 #, fuzzy, kde-format 4831 #| msgid "Iyar" 4832 msgctxt "Hebrew month 8 - KLocale::ShortName" 4833 msgid "Iya" 4834 msgstr "इयार" 4835 4836 #: kdecore/kcalendarsystemhebrew.cpp:711 4837 #, fuzzy, kde-format 4838 #| msgid "Sivan" 4839 msgctxt "Hebrew month 9 - KLocale::ShortName" 4840 msgid "Siv" 4841 msgstr "सिभान" 4842 4843 #: kdecore/kcalendarsystemhebrew.cpp:713 4844 #, fuzzy, kde-format 4845 #| msgid "Tamuz" 4846 msgctxt "Hebrew month 10 - KLocale::ShortName" 4847 msgid "Tam" 4848 msgstr "टामुज" 4849 4850 #: kdecore/kcalendarsystemhebrew.cpp:715 4851 #, fuzzy, kde-format 4852 #| msgid "Av" 4853 msgctxt "Hebrew month 11 - KLocale::ShortName" 4854 msgid "Av" 4855 msgstr "एभ" 4856 4857 #: kdecore/kcalendarsystemhebrew.cpp:717 4858 #, fuzzy, kde-format 4859 #| msgid "Elul" 4860 msgctxt "Hebrew month 12 - KLocale::ShortName" 4861 msgid "Elu" 4862 msgstr "एलउल" 4863 4864 #: kdecore/kcalendarsystemhebrew.cpp:719 4865 #, fuzzy, kde-format 4866 #| msgid "Ahd" 4867 msgctxt "Hebrew month 13 - KLocale::ShortName" 4868 msgid "Ad1" 4869 msgstr "Ahd" 4870 4871 #: kdecore/kcalendarsystemhebrew.cpp:721 4872 #, fuzzy, kde-format 4873 #| msgid "Ahd" 4874 msgctxt "Hebrew month 14 - KLocale::ShortName" 4875 msgid "Ad2" 4876 msgstr "Ahd" 4877 4878 #: kdecore/kcalendarsystemhebrew.cpp:730 4879 #, fuzzy, kde-format 4880 #| msgid "of Tishrey" 4881 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4882 msgid "of Tishrey" 4883 msgstr "of Tishrey" 4884 4885 #: kdecore/kcalendarsystemhebrew.cpp:732 4886 #, fuzzy, kde-format 4887 #| msgid "of Heshvan" 4888 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4889 msgid "of Heshvan" 4890 msgstr "of Heshvan" 4891 4892 #: kdecore/kcalendarsystemhebrew.cpp:734 4893 #, fuzzy, kde-format 4894 #| msgid "of Kislev" 4895 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4896 msgid "of Kislev" 4897 msgstr "of Kislev" 4898 4899 #: kdecore/kcalendarsystemhebrew.cpp:736 4900 #, fuzzy, kde-format 4901 #| msgid "of Tevet" 4902 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4903 msgid "of Tevet" 4904 msgstr "of Tevet" 4905 4906 #: kdecore/kcalendarsystemhebrew.cpp:738 4907 #, fuzzy, kde-format 4908 #| msgid "of Shvat" 4909 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4910 msgid "of Shvat" 4911 msgstr "of Shvat" 4912 4913 #: kdecore/kcalendarsystemhebrew.cpp:740 4914 #, fuzzy, kde-format 4915 #| msgid "of Adar" 4916 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4917 msgid "of Adar" 4918 msgstr "of Adar" 4919 4920 #: kdecore/kcalendarsystemhebrew.cpp:742 4921 #, fuzzy, kde-format 4922 #| msgid "of Nisan" 4923 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4924 msgid "of Nisan" 4925 msgstr "of Nisan" 4926 4927 #: kdecore/kcalendarsystemhebrew.cpp:744 4928 #, fuzzy, kde-format 4929 #| msgid "of Iyar" 4930 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4931 msgid "of Iyar" 4932 msgstr "of Iyar" 4933 4934 #: kdecore/kcalendarsystemhebrew.cpp:746 4935 #, fuzzy, kde-format 4936 #| msgid "of Sivan" 4937 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4938 msgid "of Sivan" 4939 msgstr "of Sivan" 4940 4941 #: kdecore/kcalendarsystemhebrew.cpp:748 4942 #, fuzzy, kde-format 4943 #| msgid "of Tamuz" 4944 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4945 msgid "of Tamuz" 4946 msgstr "of Tamuz" 4947 4948 #: kdecore/kcalendarsystemhebrew.cpp:750 4949 #, fuzzy, kde-format 4950 #| msgid "of Av" 4951 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4952 msgid "of Av" 4953 msgstr "of Av" 4954 4955 #: kdecore/kcalendarsystemhebrew.cpp:752 4956 #, fuzzy, kde-format 4957 #| msgid "of Elul" 4958 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4959 msgid "of Elul" 4960 msgstr "of Elul" 4961 4962 #: kdecore/kcalendarsystemhebrew.cpp:754 4963 #, fuzzy, kde-format 4964 #| msgid "of Adar I" 4965 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4966 msgid "of Adar I" 4967 msgstr "of Adar I" 4968 4969 #: kdecore/kcalendarsystemhebrew.cpp:756 4970 #, fuzzy, kde-format 4971 #| msgid "of Adar II" 4972 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4973 msgid "of Adar II" 4974 msgstr "of Adar II" 4975 4976 #: kdecore/kcalendarsystemhebrew.cpp:765 4977 #, fuzzy, kde-format 4978 #| msgid "Tishrey" 4979 msgctxt "Hebrew month 1 - KLocale::LongName" 4980 msgid "Tishrey" 4981 msgstr "तिस्रे" 4982 4983 #: kdecore/kcalendarsystemhebrew.cpp:767 4984 #, fuzzy, kde-format 4985 #| msgid "Heshvan" 4986 msgctxt "Hebrew month 2 - KLocale::LongName" 4987 msgid "Heshvan" 4988 msgstr "हेस्भान" 4989 4990 #: kdecore/kcalendarsystemhebrew.cpp:769 4991 #, fuzzy, kde-format 4992 #| msgid "Kislev" 4993 msgctxt "Hebrew month 3 - KLocale::LongName" 4994 msgid "Kislev" 4995 msgstr "किस्लेभ" 4996 4997 #: kdecore/kcalendarsystemhebrew.cpp:771 4998 #, fuzzy, kde-format 4999 #| msgid "Tevet" 5000 msgctxt "Hebrew month 4 - KLocale::LongName" 5001 msgid "Tevet" 5002 msgstr "टेभेट" 5003 5004 #: kdecore/kcalendarsystemhebrew.cpp:773 5005 #, fuzzy, kde-format 5006 #| msgid "Shvat" 5007 msgctxt "Hebrew month 5 - KLocale::LongName" 5008 msgid "Shvat" 5009 msgstr "साभेट" 5010 5011 #: kdecore/kcalendarsystemhebrew.cpp:775 5012 #, fuzzy, kde-format 5013 #| msgid "Adar" 5014 msgctxt "Hebrew month 6 - KLocale::LongName" 5015 msgid "Adar" 5016 msgstr "अडार" 5017 5018 #: kdecore/kcalendarsystemhebrew.cpp:777 5019 #, fuzzy, kde-format 5020 #| msgid "Nisan" 5021 msgctxt "Hebrew month 7 - KLocale::LongName" 5022 msgid "Nisan" 5023 msgstr "निशान" 5024 5025 #: kdecore/kcalendarsystemhebrew.cpp:779 5026 #, fuzzy, kde-format 5027 #| msgid "Iyar" 5028 msgctxt "Hebrew month 8 - KLocale::LongName" 5029 msgid "Iyar" 5030 msgstr "इयार" 5031 5032 #: kdecore/kcalendarsystemhebrew.cpp:781 5033 #, fuzzy, kde-format 5034 #| msgid "Sivan" 5035 msgctxt "Hebrew month 9 - KLocale::LongName" 5036 msgid "Sivan" 5037 msgstr "सिभान" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:783 5040 #, fuzzy, kde-format 5041 #| msgid "Tamuz" 5042 msgctxt "Hebrew month 10 - KLocale::LongName" 5043 msgid "Tamuz" 5044 msgstr "टामुज" 5045 5046 #: kdecore/kcalendarsystemhebrew.cpp:785 5047 #, fuzzy, kde-format 5048 #| msgid "Av" 5049 msgctxt "Hebrew month 11 - KLocale::LongName" 5050 msgid "Av" 5051 msgstr "एभ" 5052 5053 #: kdecore/kcalendarsystemhebrew.cpp:787 5054 #, fuzzy, kde-format 5055 #| msgid "Elul" 5056 msgctxt "Hebrew month 12 - KLocale::LongName" 5057 msgid "Elul" 5058 msgstr "एलउल" 5059 5060 #: kdecore/kcalendarsystemhebrew.cpp:789 5061 #, fuzzy, kde-format 5062 #| msgid "Adar I" 5063 msgctxt "Hebrew month 13 - KLocale::LongName" 5064 msgid "Adar I" 5065 msgstr "Adar I" 5066 5067 #: kdecore/kcalendarsystemhebrew.cpp:791 5068 #, fuzzy, kde-format 5069 #| msgid "Adar II" 5070 msgctxt "Hebrew month 14 - KLocale::LongName" 5071 msgid "Adar II" 5072 msgstr "Adar II" 5073 5074 #: kdecore/kcalendarsystemindiannational.cpp:66 5075 #, fuzzy, kde-format 5076 #| msgid "Safar" 5077 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5078 msgid "Saka Era" 5079 msgstr "सफार" 5080 5081 #: kdecore/kcalendarsystemindiannational.cpp:67 5082 #, kde-format 5083 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5084 msgid "SE" 5085 msgstr "" 5086 5087 #: kdecore/kcalendarsystemindiannational.cpp:68 5088 #, kde-format 5089 msgctxt "" 5090 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5091 "2000 SE" 5092 msgid "%Ey %EC" 5093 msgstr "" 5094 5095 #: kdecore/kcalendarsystemindiannational.cpp:158 5096 #, kde-format 5097 msgctxt "Indian National month 1 - KLocale::NarrowName" 5098 msgid "C" 5099 msgstr "" 5100 5101 #: kdecore/kcalendarsystemindiannational.cpp:160 5102 #, kde-format 5103 msgctxt "Indian National month 2 - KLocale::NarrowName" 5104 msgid "V" 5105 msgstr "" 5106 5107 #: kdecore/kcalendarsystemindiannational.cpp:162 5108 #, kde-format 5109 msgctxt "Indian National month 3 - KLocale::NarrowName" 5110 msgid "J" 5111 msgstr "" 5112 5113 #: kdecore/kcalendarsystemindiannational.cpp:164 5114 #, fuzzy, kde-format 5115 msgctxt "Indian National month 4 - KLocale::NarrowName" 5116 msgid "Ā" 5117 msgstr "of Kho" 5118 5119 #: kdecore/kcalendarsystemindiannational.cpp:166 5120 #, kde-format 5121 msgctxt "Indian National month 5 - KLocale::NarrowName" 5122 msgid "S" 5123 msgstr "" 5124 5125 #: kdecore/kcalendarsystemindiannational.cpp:168 5126 #, kde-format 5127 msgctxt "Indian National month 6 - KLocale::NarrowName" 5128 msgid "B" 5129 msgstr "" 5130 5131 #: kdecore/kcalendarsystemindiannational.cpp:170 5132 #, fuzzy, kde-format 5133 msgctxt "Indian National month 7 - KLocale::NarrowName" 5134 msgid "Ā" 5135 msgstr "of Kho" 5136 5137 #: kdecore/kcalendarsystemindiannational.cpp:172 5138 #, kde-format 5139 msgctxt "Indian National month 8 - KLocale::NarrowName" 5140 msgid "K" 5141 msgstr "" 5142 5143 #: kdecore/kcalendarsystemindiannational.cpp:174 5144 #, fuzzy, kde-format 5145 #| msgid "Av" 5146 msgctxt "Indian National month 9 - KLocale::NarrowName" 5147 msgid "A" 5148 msgstr "एभ" 5149 5150 #: kdecore/kcalendarsystemindiannational.cpp:176 5151 #, kde-format 5152 msgctxt "Indian National month 10 - KLocale::NarrowName" 5153 msgid "P" 5154 msgstr "" 5155 5156 #: kdecore/kcalendarsystemindiannational.cpp:178 5157 #, kde-format 5158 msgctxt "Indian National month 11 - KLocale::NarrowName" 5159 msgid "M" 5160 msgstr "" 5161 5162 #: kdecore/kcalendarsystemindiannational.cpp:180 5163 #, kde-format 5164 msgctxt "Indian National month 12 - KLocale::NarrowName" 5165 msgid "P" 5166 msgstr "" 5167 5168 #: kdecore/kcalendarsystemindiannational.cpp:189 5169 #, fuzzy, kde-format 5170 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5171 msgid "of Cha" 5172 msgstr "of Sha" 5173 5174 #: kdecore/kcalendarsystemindiannational.cpp:191 5175 #, fuzzy, kde-format 5176 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5177 msgid "of Vai" 5178 msgstr "of Far" 5179 5180 #: kdecore/kcalendarsystemindiannational.cpp:193 5181 #, fuzzy, kde-format 5182 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5183 msgid "of Jya" 5184 msgstr "जनवरीको" 5185 5186 #: kdecore/kcalendarsystemindiannational.cpp:195 5187 #, fuzzy, kde-format 5188 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5189 msgid "of Āsh" 5190 msgstr "of Kho" 5191 5192 #: kdecore/kcalendarsystemindiannational.cpp:197 5193 #, fuzzy, kde-format 5194 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5195 msgid "of Shr" 5196 msgstr "of Sha" 5197 5198 #: kdecore/kcalendarsystemindiannational.cpp:199 5199 #, fuzzy, kde-format 5200 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5201 msgid "of Bhā" 5202 msgstr "of Bah" 5203 5204 #: kdecore/kcalendarsystemindiannational.cpp:201 5205 #, fuzzy, kde-format 5206 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5207 msgid "of Āsw" 5208 msgstr "of Esf" 5209 5210 #: kdecore/kcalendarsystemindiannational.cpp:203 5211 #, fuzzy, kde-format 5212 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5213 msgid "of Kār" 5214 msgstr "of Far" 5215 5216 #: kdecore/kcalendarsystemindiannational.cpp:205 5217 #, fuzzy, kde-format 5218 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5219 msgid "of Agr" 5220 msgstr "अप्रिलको" 5221 5222 #: kdecore/kcalendarsystemindiannational.cpp:207 5223 #, fuzzy, kde-format 5224 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5225 msgid "of Pau" 5226 msgstr "of Tamuz" 5227 5228 #: kdecore/kcalendarsystemindiannational.cpp:209 5229 #, fuzzy, kde-format 5230 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5231 msgid "of Māg" 5232 msgstr "of Mor" 5233 5234 #: kdecore/kcalendarsystemindiannational.cpp:211 5235 #, fuzzy, kde-format 5236 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5237 msgid "of Phā" 5238 msgstr "of Kho" 5239 5240 #: kdecore/kcalendarsystemindiannational.cpp:220 5241 #, fuzzy, kde-format 5242 msgctxt "Indian National month 1 - KLocale::ShortName" 5243 msgid "Cha" 5244 msgstr "खा" 5245 5246 #: kdecore/kcalendarsystemindiannational.cpp:222 5247 #, fuzzy, kde-format 5248 msgctxt "Indian National month 2 - KLocale::ShortName" 5249 msgid "Vai" 5250 msgstr "of Far" 5251 5252 #: kdecore/kcalendarsystemindiannational.cpp:224 5253 #, fuzzy, kde-format 5254 msgctxt "Indian National month 3 - KLocale::ShortName" 5255 msgid "Jya" 5256 msgstr "जनवरी" 5257 5258 #: kdecore/kcalendarsystemindiannational.cpp:226 5259 #, fuzzy, kde-format 5260 msgctxt "Indian National month 4 - KLocale::ShortName" 5261 msgid "Āsh" 5262 msgstr "of Kho" 5263 5264 #: kdecore/kcalendarsystemindiannational.cpp:228 5265 #, fuzzy, kde-format 5266 msgctxt "Indian National month 5 - KLocale::ShortName" 5267 msgid "Shr" 5268 msgstr "Sha" 5269 5270 #: kdecore/kcalendarsystemindiannational.cpp:230 5271 #, fuzzy, kde-format 5272 msgctxt "Indian National month 6 - KLocale::ShortName" 5273 msgid "Bhā" 5274 msgstr "of Bah" 5275 5276 #: kdecore/kcalendarsystemindiannational.cpp:232 5277 #, fuzzy, kde-format 5278 msgctxt "Indian National month 7 - KLocale::ShortName" 5279 msgid "Āsw" 5280 msgstr "of Esf" 5281 5282 #: kdecore/kcalendarsystemindiannational.cpp:234 5283 #, fuzzy, kde-format 5284 msgctxt "Indian National month 8 - KLocale::ShortName" 5285 msgid "Kār" 5286 msgstr "of Far" 5287 5288 #: kdecore/kcalendarsystemindiannational.cpp:236 5289 #, fuzzy, kde-format 5290 msgctxt "Indian National month 9 - KLocale::ShortName" 5291 msgid "Agr" 5292 msgstr "Arb" 5293 5294 #: kdecore/kcalendarsystemindiannational.cpp:238 5295 #, fuzzy, kde-format 5296 msgctxt "Indian National month 10 - KLocale::ShortName" 5297 msgid "Pau" 5298 msgstr "पज गर्नुहोस्" 5299 5300 #: kdecore/kcalendarsystemindiannational.cpp:240 5301 #, fuzzy, kde-format 5302 msgctxt "Indian National month 11 - KLocale::ShortName" 5303 msgid "Māg" 5304 msgstr "of Mor" 5305 5306 #: kdecore/kcalendarsystemindiannational.cpp:242 5307 #, fuzzy, kde-format 5308 msgctxt "Indian National month 12 - KLocale::ShortName" 5309 msgid "Phā" 5310 msgstr "of Kho" 5311 5312 #: kdecore/kcalendarsystemindiannational.cpp:251 5313 #, fuzzy, kde-format 5314 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5315 msgid "of Chaitra" 5316 msgstr "of Muharram" 5317 5318 #: kdecore/kcalendarsystemindiannational.cpp:253 5319 #, fuzzy, kde-format 5320 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5321 msgid "of Vaishākh" 5322 msgstr "of Far" 5323 5324 #: kdecore/kcalendarsystemindiannational.cpp:255 5325 #, fuzzy, kde-format 5326 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5327 msgid "of Jyaishtha" 5328 msgstr "of Nisan" 5329 5330 #: kdecore/kcalendarsystemindiannational.cpp:257 5331 #, fuzzy, kde-format 5332 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5333 msgid "of Āshādha" 5334 msgstr "of Kho" 5335 5336 #: kdecore/kcalendarsystemindiannational.cpp:259 5337 #, fuzzy, kde-format 5338 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5339 msgid "of Shrāvana" 5340 msgstr "of Shvat" 5341 5342 #: kdecore/kcalendarsystemindiannational.cpp:261 5343 #, fuzzy, kde-format 5344 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5345 msgid "of Bhādrapad" 5346 msgstr "of Khordad" 5347 5348 #: kdecore/kcalendarsystemindiannational.cpp:263 5349 #, fuzzy, kde-format 5350 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5351 msgid "of Āshwin" 5352 msgstr "of Heshvan" 5353 5354 #: kdecore/kcalendarsystemindiannational.cpp:265 5355 #, fuzzy, kde-format 5356 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5357 msgid "of Kārtik" 5358 msgstr "of Far" 5359 5360 #: kdecore/kcalendarsystemindiannational.cpp:267 5361 #, fuzzy, kde-format 5362 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5363 msgid "of Agrahayana" 5364 msgstr "of Bahman" 5365 5366 #: kdecore/kcalendarsystemindiannational.cpp:269 5367 #, fuzzy, kde-format 5368 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5369 msgid "of Paush" 5370 msgstr "of Bah" 5371 5372 #: kdecore/kcalendarsystemindiannational.cpp:271 5373 #, fuzzy, kde-format 5374 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5375 msgid "of Māgh" 5376 msgstr "of Meh" 5377 5378 #: kdecore/kcalendarsystemindiannational.cpp:273 5379 #, fuzzy, kde-format 5380 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5381 msgid "of Phālgun" 5382 msgstr "of Kho" 5383 5384 #: kdecore/kcalendarsystemindiannational.cpp:282 5385 #, fuzzy, kde-format 5386 msgctxt "Indian National month 1 - KLocale::LongName" 5387 msgid "Chaitra" 5388 msgstr "of Muharram" 5389 5390 #: kdecore/kcalendarsystemindiannational.cpp:284 5391 #, fuzzy, kde-format 5392 msgctxt "Indian National month 2 - KLocale::LongName" 5393 msgid "Vaishākh" 5394 msgstr "of Far" 5395 5396 #: kdecore/kcalendarsystemindiannational.cpp:286 5397 #, fuzzy, kde-format 5398 msgctxt "Indian National month 3 - KLocale::LongName" 5399 msgid "Jyaishtha" 5400 msgstr "of Nisan" 5401 5402 #: kdecore/kcalendarsystemindiannational.cpp:288 5403 #, fuzzy, kde-format 5404 msgctxt "Indian National month 4 - KLocale::LongName" 5405 msgid "Āshādha" 5406 msgstr "of Kho" 5407 5408 #: kdecore/kcalendarsystemindiannational.cpp:290 5409 #, fuzzy, kde-format 5410 msgctxt "Indian National month 5 - KLocale::LongName" 5411 msgid "Shrāvana" 5412 msgstr "of Shvat" 5413 5414 #: kdecore/kcalendarsystemindiannational.cpp:292 5415 #, fuzzy, kde-format 5416 msgctxt "Indian National month 6 - KLocale::LongName" 5417 msgid "Bhādrapad" 5418 msgstr "of Khordad" 5419 5420 #: kdecore/kcalendarsystemindiannational.cpp:294 5421 #, fuzzy, kde-format 5422 msgctxt "Indian National month 7 - KLocale::LongName" 5423 msgid "Āshwin" 5424 msgstr "of Heshvan" 5425 5426 #: kdecore/kcalendarsystemindiannational.cpp:296 5427 #, fuzzy, kde-format 5428 msgctxt "Indian National month 8 - KLocale::LongName" 5429 msgid "Kārtik" 5430 msgstr "of Far" 5431 5432 #: kdecore/kcalendarsystemindiannational.cpp:298 5433 #, fuzzy, kde-format 5434 msgctxt "Indian National month 9 - KLocale::LongName" 5435 msgid "Agrahayana" 5436 msgstr "थानी" 5437 5438 #: kdecore/kcalendarsystemindiannational.cpp:300 5439 #, fuzzy, kde-format 5440 msgctxt "Indian National month 10 - KLocale::LongName" 5441 msgid "Paush" 5442 msgstr "पज गर्नुहोस्" 5443 5444 #: kdecore/kcalendarsystemindiannational.cpp:302 5445 #, fuzzy, kde-format 5446 msgctxt "Indian National month 11 - KLocale::LongName" 5447 msgid "Māgh" 5448 msgstr "of Meh" 5449 5450 #: kdecore/kcalendarsystemindiannational.cpp:304 5451 #, fuzzy, kde-format 5452 msgctxt "Indian National month 12 - KLocale::LongName" 5453 msgid "Phālgun" 5454 msgstr "of Kho" 5455 5456 #: kdecore/kcalendarsystemindiannational.cpp:317 5457 #, kde-format 5458 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5459 msgid "S" 5460 msgstr "" 5461 5462 #: kdecore/kcalendarsystemindiannational.cpp:319 5463 #, kde-format 5464 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5465 msgid "M" 5466 msgstr "" 5467 5468 #: kdecore/kcalendarsystemindiannational.cpp:321 5469 #, kde-format 5470 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5471 msgid "B" 5472 msgstr "" 5473 5474 #: kdecore/kcalendarsystemindiannational.cpp:323 5475 #, kde-format 5476 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5477 msgid "G" 5478 msgstr "" 5479 5480 #: kdecore/kcalendarsystemindiannational.cpp:325 5481 #, kde-format 5482 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5483 msgid "S" 5484 msgstr "" 5485 5486 #: kdecore/kcalendarsystemindiannational.cpp:327 5487 #, kde-format 5488 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5489 msgid "S" 5490 msgstr "" 5491 5492 #: kdecore/kcalendarsystemindiannational.cpp:329 5493 #, kde-format 5494 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5495 msgid "R" 5496 msgstr "" 5497 5498 #: kdecore/kcalendarsystemindiannational.cpp:338 5499 #, fuzzy, kde-format 5500 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5501 msgid "Som" 5502 msgstr "Jom" 5503 5504 #: kdecore/kcalendarsystemindiannational.cpp:340 5505 #, kde-format 5506 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5507 msgid "Mañ" 5508 msgstr "" 5509 5510 #: kdecore/kcalendarsystemindiannational.cpp:342 5511 #, fuzzy, kde-format 5512 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5513 msgid "Bud" 5514 msgstr "बुहिड" 5515 5516 #: kdecore/kcalendarsystemindiannational.cpp:344 5517 #, kde-format 5518 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5519 msgid "Gur" 5520 msgstr "" 5521 5522 #: kdecore/kcalendarsystemindiannational.cpp:346 5523 #, fuzzy, kde-format 5524 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5525 msgid "Suk" 5526 msgstr "आइत" 5527 5528 #: kdecore/kcalendarsystemindiannational.cpp:348 5529 #, fuzzy, kde-format 5530 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5531 msgid "San" 5532 msgstr "सिभान" 5533 5534 #: kdecore/kcalendarsystemindiannational.cpp:350 5535 #, kde-format 5536 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5537 msgid "Rav" 5538 msgstr "" 5539 5540 #: kdecore/kcalendarsystemindiannational.cpp:357 5541 #, kde-format 5542 msgctxt "Indian National weekday 1 - KLocale::LongName" 5543 msgid "Somavãra" 5544 msgstr "" 5545 5546 #: kdecore/kcalendarsystemindiannational.cpp:359 5547 #, kde-format 5548 msgctxt "Indian National weekday 2 - KLocale::LongName" 5549 msgid "Mañgalvã" 5550 msgstr "" 5551 5552 #: kdecore/kcalendarsystemindiannational.cpp:361 5553 #, kde-format 5554 msgctxt "Indian National weekday 3 - KLocale::LongName" 5555 msgid "Budhavãra" 5556 msgstr "" 5557 5558 #: kdecore/kcalendarsystemindiannational.cpp:363 5559 #, kde-format 5560 msgctxt "Indian National weekday 4 - KLocale::LongName" 5561 msgid "Guruvãra" 5562 msgstr "" 5563 5564 #: kdecore/kcalendarsystemindiannational.cpp:365 5565 #, kde-format 5566 msgctxt "Indian National weekday 5 - KLocale::LongName" 5567 msgid "Sukravãra" 5568 msgstr "" 5569 5570 #: kdecore/kcalendarsystemindiannational.cpp:367 5571 #, kde-format 5572 msgctxt "Indian National weekday 6 - KLocale::LongName" 5573 msgid "Sanivãra" 5574 msgstr "" 5575 5576 #: kdecore/kcalendarsystemindiannational.cpp:369 5577 #, kde-format 5578 msgctxt "Indian National weekday 7 - KLocale::LongName" 5579 msgid "Raviãra" 5580 msgstr "" 5581 5582 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5583 #, kde-format 5584 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5585 msgid "Anno Hegirae" 5586 msgstr "" 5587 5588 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5589 #, kde-format 5590 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5591 msgid "AH" 5592 msgstr "" 5593 5594 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5595 #, kde-format 5596 msgctxt "" 5597 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5598 msgid "%Ey %EC" 5599 msgstr "" 5600 5601 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5602 #, kde-format 5603 msgctxt "Hijri month 1 - KLocale::NarrowName" 5604 msgid "M" 5605 msgstr "" 5606 5607 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5608 #, kde-format 5609 msgctxt "Hijri month 2 - KLocale::NarrowName" 5610 msgid "S" 5611 msgstr "" 5612 5613 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5614 #, fuzzy, kde-format 5615 #| msgid "Av" 5616 msgctxt "Hijri month 3 - KLocale::NarrowName" 5617 msgid "A" 5618 msgstr "एभ" 5619 5620 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5621 #, kde-format 5622 msgctxt "Hijri month 4 - KLocale::NarrowName" 5623 msgid "T" 5624 msgstr "" 5625 5626 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5627 #, fuzzy, kde-format 5628 #| msgid "Av" 5629 msgctxt "Hijri month 5 - KLocale::NarrowName" 5630 msgid "A" 5631 msgstr "एभ" 5632 5633 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5634 #, kde-format 5635 msgctxt "Hijri month 6 - KLocale::NarrowName" 5636 msgid "T" 5637 msgstr "" 5638 5639 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5640 #, kde-format 5641 msgctxt "Hijri month 7 - KLocale::NarrowName" 5642 msgid "R" 5643 msgstr "" 5644 5645 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5646 #, kde-format 5647 msgctxt "Hijri month 8 - KLocale::NarrowName" 5648 msgid "S" 5649 msgstr "" 5650 5651 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5652 #, kde-format 5653 msgctxt "Hijri month 9 - KLocale::NarrowName" 5654 msgid "R" 5655 msgstr "" 5656 5657 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5658 #, kde-format 5659 msgctxt "Hijri month 10 - KLocale::NarrowName" 5660 msgid "S" 5661 msgstr "" 5662 5663 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5664 #, kde-format 5665 msgctxt "Hijri month 11 - KLocale::NarrowName" 5666 msgid "Q" 5667 msgstr "" 5668 5669 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5670 #, kde-format 5671 msgctxt "Hijri month 12 - KLocale::NarrowName" 5672 msgid "H" 5673 msgstr "" 5674 5675 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5676 #, fuzzy, kde-format 5677 #| msgctxt "of Mehr short" 5678 #| msgid "of Meh" 5679 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5680 msgid "of Muh" 5681 msgstr "of Meh" 5682 5683 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5684 #, fuzzy, kde-format 5685 #| msgid "of Safar" 5686 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5687 msgid "of Saf" 5688 msgstr "of Safar" 5689 5690 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5691 #, fuzzy, kde-format 5692 #| msgid "of R. Awal" 5693 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5694 msgid "of R.A" 5695 msgstr "of R. Awal" 5696 5697 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5698 #, fuzzy, kde-format 5699 #| msgid "of R. Thaani" 5700 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5701 msgid "of R.T" 5702 msgstr "of R. Thaani" 5703 5704 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5705 #, fuzzy, kde-format 5706 #| msgid "of J. Awal" 5707 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5708 msgid "of J.A" 5709 msgstr "of J. Awal" 5710 5711 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5712 #, fuzzy, kde-format 5713 #| msgid "of J. Thaani" 5714 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5715 msgid "of J.T" 5716 msgstr "of J. Thaani" 5717 5718 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5719 #, fuzzy, kde-format 5720 #| msgid "of Rajab" 5721 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5722 msgid "of Raj" 5723 msgstr "of Rajab" 5724 5725 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5726 #, fuzzy, kde-format 5727 #| msgctxt "of Shahrivar short" 5728 #| msgid "of Sha" 5729 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5730 msgid "of Sha" 5731 msgstr "of Sha" 5732 5733 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5734 #, fuzzy, kde-format 5735 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5736 msgid "of Ram" 5737 msgstr "of Tamuz" 5738 5739 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5740 #, fuzzy, kde-format 5741 #| msgctxt "of Shahrivar short" 5742 #| msgid "of Sha" 5743 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5744 msgid "of Shw" 5745 msgstr "of Sha" 5746 5747 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5748 #, fuzzy, kde-format 5749 #| msgid "of Qi`dah" 5750 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5751 msgid "of Qid" 5752 msgstr "of Qi`dah" 5753 5754 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5755 #, fuzzy, kde-format 5756 #| msgid "of Hijjah" 5757 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5758 msgid "of Hij" 5759 msgstr "of Hijjah" 5760 5761 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5762 #, fuzzy, kde-format 5763 #| msgctxt "Mehr short" 5764 #| msgid "Meh" 5765 msgctxt "Hijri month 1 - KLocale::ShortName" 5766 msgid "Muh" 5767 msgstr "Meh" 5768 5769 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5770 #, fuzzy, kde-format 5771 #| msgid "Safar" 5772 msgctxt "Hijri month 2 - KLocale::ShortName" 5773 msgid "Saf" 5774 msgstr "सफार" 5775 5776 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5777 #, fuzzy, kde-format 5778 #| msgid "R. Awal" 5779 msgctxt "Hijri month 3 - KLocale::ShortName" 5780 msgid "R.A" 5781 msgstr "आर. अवाल" 5782 5783 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5784 #, kde-format 5785 msgctxt "Hijri month 4 - KLocale::ShortName" 5786 msgid "R.T" 5787 msgstr "" 5788 5789 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5790 #, fuzzy, kde-format 5791 #| msgid "J. Awal" 5792 msgctxt "Hijri month 5 - KLocale::ShortName" 5793 msgid "J.A" 5794 msgstr "जे. अवाल" 5795 5796 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5797 #, kde-format 5798 msgctxt "Hijri month 6 - KLocale::ShortName" 5799 msgid "J.T" 5800 msgstr "" 5801 5802 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5803 #, fuzzy, kde-format 5804 #| msgid "Rajab" 5805 msgctxt "Hijri month 7 - KLocale::ShortName" 5806 msgid "Raj" 5807 msgstr "राजब" 5808 5809 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5810 #, fuzzy, kde-format 5811 #| msgctxt "Shahrivar short" 5812 #| msgid "Sha" 5813 msgctxt "Hijri month 8 - KLocale::ShortName" 5814 msgid "Sha" 5815 msgstr "Sha" 5816 5817 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5818 #, fuzzy, kde-format 5819 msgctxt "Hijri month 9 - KLocale::ShortName" 5820 msgid "Ram" 5821 msgstr "पूर्वान्ह" 5822 5823 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5824 #, fuzzy, kde-format 5825 #| msgctxt "Shahrivar short" 5826 #| msgid "Sha" 5827 msgctxt "Hijri month 10 - KLocale::ShortName" 5828 msgid "Shw" 5829 msgstr "Sha" 5830 5831 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5832 #, fuzzy, kde-format 5833 #| msgid "Qi`dah" 5834 msgctxt "Hijri month 11 - KLocale::ShortName" 5835 msgid "Qid" 5836 msgstr "Qi`dah" 5837 5838 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5839 #, fuzzy, kde-format 5840 #| msgctxt "@item Calendar system" 5841 #| msgid "Hijri" 5842 msgctxt "Hijri month 12 - KLocale::ShortName" 5843 msgid "Hij" 5844 msgstr "हिज्रि" 5845 5846 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5847 #, fuzzy, kde-format 5848 #| msgid "of Muharram" 5849 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5850 msgid "of Muharram" 5851 msgstr "of Muharram" 5852 5853 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5854 #, fuzzy, kde-format 5855 #| msgid "of Safar" 5856 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5857 msgid "of Safar" 5858 msgstr "of Safar" 5859 5860 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5861 #, fuzzy, kde-format 5862 #| msgid "of Rabi` al-Awal" 5863 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5864 msgid "of Rabi` al-Awal" 5865 msgstr "of Rabi` al-Awal" 5866 5867 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5868 #, fuzzy, kde-format 5869 #| msgid "of Rabi` al-Thaani" 5870 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5871 msgid "of Rabi` al-Thaani" 5872 msgstr "of Rabi` al-Thaani" 5873 5874 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5875 #, fuzzy, kde-format 5876 #| msgid "of Jumaada al-Awal" 5877 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5878 msgid "of Jumaada al-Awal" 5879 msgstr "of Jumaada al-Awal" 5880 5881 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5882 #, fuzzy, kde-format 5883 #| msgid "of Jumaada al-Thaani" 5884 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5885 msgid "of Jumaada al-Thaani" 5886 msgstr "of Jumaada al-Thaani" 5887 5888 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5889 #, fuzzy, kde-format 5890 #| msgid "of Rajab" 5891 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5892 msgid "of Rajab" 5893 msgstr "of Rajab" 5894 5895 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5896 #, fuzzy, kde-format 5897 #| msgid "of Sha`ban" 5898 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5899 msgid "of Sha`ban" 5900 msgstr "of Sha`ban" 5901 5902 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5903 #, fuzzy, kde-format 5904 #| msgid "of Ramadan" 5905 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5906 msgid "of Ramadan" 5907 msgstr "of Ramadan" 5908 5909 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5910 #, fuzzy, kde-format 5911 #| msgid "of Shawwal" 5912 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5913 msgid "of Shawwal" 5914 msgstr "of Shawwal" 5915 5916 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5917 #, fuzzy, kde-format 5918 #| msgid "of Thu al-Qi`dah" 5919 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5920 msgid "of Thu al-Qi`dah" 5921 msgstr "of Thu al-Qi`dah" 5922 5923 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5924 #, fuzzy, kde-format 5925 #| msgid "of Thu al-Hijjah" 5926 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5927 msgid "of Thu al-Hijjah" 5928 msgstr "of Thu al-Hijjah" 5929 5930 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5931 #, fuzzy, kde-format 5932 #| msgid "Muharram" 5933 msgctxt "Hijri month 1 - KLocale::LongName" 5934 msgid "Muharram" 5935 msgstr "मुहाराम" 5936 5937 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5938 #, fuzzy, kde-format 5939 #| msgid "Safar" 5940 msgctxt "Hijri month 2 - KLocale::LongName" 5941 msgid "Safar" 5942 msgstr "सफार" 5943 5944 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5945 #, fuzzy, kde-format 5946 #| msgid "Rabi` al-Awal" 5947 msgctxt "Hijri month 3 - KLocale::LongName" 5948 msgid "Rabi` al-Awal" 5949 msgstr "Rabi` al-Awal" 5950 5951 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5952 #, fuzzy, kde-format 5953 #| msgid "Rabi` al-Thaani" 5954 msgctxt "Hijri month 4 - KLocale::LongName" 5955 msgid "Rabi` al-Thaani" 5956 msgstr "Rabi` al-Thaani" 5957 5958 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5959 #, fuzzy, kde-format 5960 #| msgid "Jumaada al-Awal" 5961 msgctxt "Hijri month 5 - KLocale::LongName" 5962 msgid "Jumaada al-Awal" 5963 msgstr "जुम्डा एल-अवाल" 5964 5965 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5966 #, fuzzy, kde-format 5967 #| msgid "Jumaada al-Thaani" 5968 msgctxt "Hijri month 6 - KLocale::LongName" 5969 msgid "Jumaada al-Thaani" 5970 msgstr "जुम्डा एल-थानी" 5971 5972 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5973 #, fuzzy, kde-format 5974 #| msgid "Rajab" 5975 msgctxt "Hijri month 7 - KLocale::LongName" 5976 msgid "Rajab" 5977 msgstr "राजब" 5978 5979 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5980 #, fuzzy, kde-format 5981 #| msgid "Sha`ban" 5982 msgctxt "Hijri month 8 - KLocale::LongName" 5983 msgid "Sha`ban" 5984 msgstr "Sha`ban" 5985 5986 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5987 #, fuzzy, kde-format 5988 #| msgid "Ramadan" 5989 msgctxt "Hijri month 9 - KLocale::LongName" 5990 msgid "Ramadan" 5991 msgstr "रमादान" 5992 5993 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5994 #, fuzzy, kde-format 5995 #| msgid "Shawwal" 5996 msgctxt "Hijri month 10 - KLocale::LongName" 5997 msgid "Shawwal" 5998 msgstr "साववाल" 5999 6000 #: kdecore/kcalendarsystemislamiccivil.cpp:310 6001 #, fuzzy, kde-format 6002 #| msgid "Thu al-Qi`dah" 6003 msgctxt "Hijri month 11 - KLocale::LongName" 6004 msgid "Thu al-Qi`dah" 6005 msgstr "Thu al-Qi`dah" 6006 6007 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6008 #, fuzzy, kde-format 6009 #| msgid "Thu al-Hijjah" 6010 msgctxt "Hijri month 12 - KLocale::LongName" 6011 msgid "Thu al-Hijjah" 6012 msgstr "थु एल-हिज्जा" 6013 6014 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6015 #, kde-format 6016 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6017 msgid "I" 6018 msgstr "" 6019 6020 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6021 #, kde-format 6022 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6023 msgid "T" 6024 msgstr "" 6025 6026 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6027 #, fuzzy, kde-format 6028 #| msgid "Av" 6029 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6030 msgid "A" 6031 msgstr "एभ" 6032 6033 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6034 #, kde-format 6035 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6036 msgid "K" 6037 msgstr "" 6038 6039 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6040 #, kde-format 6041 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6042 msgid "J" 6043 msgstr "" 6044 6045 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6046 #, kde-format 6047 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6048 msgid "S" 6049 msgstr "" 6050 6051 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6052 #, fuzzy, kde-format 6053 #| msgid "Av" 6054 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6055 msgid "A" 6056 msgstr "एभ" 6057 6058 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6059 #, fuzzy, kde-format 6060 #| msgid "Ith" 6061 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6062 msgid "Ith" 6063 msgstr "Ith" 6064 6065 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6066 #, fuzzy, kde-format 6067 #| msgid "Thl" 6068 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6069 msgid "Thl" 6070 msgstr "Thl" 6071 6072 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6073 #, fuzzy, kde-format 6074 #| msgid "Arb" 6075 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6076 msgid "Arb" 6077 msgstr "Arb" 6078 6079 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6080 #, fuzzy, kde-format 6081 #| msgid "Kha" 6082 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6083 msgid "Kha" 6084 msgstr "खा" 6085 6086 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6087 #, fuzzy, kde-format 6088 #| msgid "Jum" 6089 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6090 msgid "Jum" 6091 msgstr "Jum" 6092 6093 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6094 #, fuzzy, kde-format 6095 #| msgid "Sab" 6096 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6097 msgid "Sab" 6098 msgstr "Sab" 6099 6100 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6101 #, fuzzy, kde-format 6102 #| msgid "Ahd" 6103 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6104 msgid "Ahd" 6105 msgstr "Ahd" 6106 6107 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6108 #, fuzzy, kde-format 6109 #| msgid "Yaum al-Ithnain" 6110 msgctxt "Hijri weekday 1 - KLocale::LongName" 6111 msgid "Yaum al-Ithnain" 6112 msgstr "याम अल-इथानी" 6113 6114 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6115 #, fuzzy, kde-format 6116 #| msgid "Yau al-Thulatha" 6117 msgctxt "Hijri weekday 2 - KLocale::LongName" 6118 msgid "Yau al-Thulatha" 6119 msgstr "यउ अल-थुलाथा" 6120 6121 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6122 #, fuzzy, kde-format 6123 #| msgid "Yaum al-Arbi'a" 6124 msgctxt "Hijri weekday 3 - KLocale::LongName" 6125 msgid "Yaum al-Arbi'a" 6126 msgstr "याम al-Arbi'a" 6127 6128 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6129 #, fuzzy, kde-format 6130 #| msgid "Yaum al-Khamees" 6131 msgctxt "Hijri weekday 4 - KLocale::LongName" 6132 msgid "Yaum al-Khamees" 6133 msgstr "याम अल-खमिज" 6134 6135 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6136 #, fuzzy, kde-format 6137 #| msgid "Yaum al-Jumma" 6138 msgctxt "Hijri weekday 5 - KLocale::LongName" 6139 msgid "Yaum al-Jumma" 6140 msgstr "याम अल-जमम्मा" 6141 6142 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6143 #, fuzzy, kde-format 6144 #| msgid "Yaum al-Sabt" 6145 msgctxt "Hijri weekday 6 - KLocale::LongName" 6146 msgid "Yaum al-Sabt" 6147 msgstr "याम अल-सब्ट" 6148 6149 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6150 #, fuzzy, kde-format 6151 #| msgid "Yaum al-Ahad" 6152 msgctxt "Hijri weekday 7 - KLocale::LongName" 6153 msgid "Yaum al-Ahad" 6154 msgstr "याम अल-अहाद" 6155 6156 #: kdecore/kcalendarsystemjalali.cpp:74 6157 #, kde-format 6158 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6159 msgid "Anno Persico" 6160 msgstr "" 6161 6162 #: kdecore/kcalendarsystemjalali.cpp:75 6163 #, kde-format 6164 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6165 msgid "AP" 6166 msgstr "" 6167 6168 #: kdecore/kcalendarsystemjalali.cpp:76 6169 #, kde-format 6170 msgctxt "" 6171 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6172 msgid "%Ey %EC" 6173 msgstr "" 6174 6175 #: kdecore/kcalendarsystemjalali.cpp:172 6176 #, kde-format 6177 msgctxt "Jalali month 1 - KLocale::NarrowName" 6178 msgid "F" 6179 msgstr "" 6180 6181 #: kdecore/kcalendarsystemjalali.cpp:174 6182 #, kde-format 6183 msgctxt "Jalali month 2 - KLocale::NarrowName" 6184 msgid "O" 6185 msgstr "" 6186 6187 #: kdecore/kcalendarsystemjalali.cpp:176 6188 #, kde-format 6189 msgctxt "Jalali month 3 - KLocale::NarrowName" 6190 msgid "K" 6191 msgstr "" 6192 6193 #: kdecore/kcalendarsystemjalali.cpp:178 6194 #, kde-format 6195 msgctxt "Jalali month 4 - KLocale::NarrowName" 6196 msgid "T" 6197 msgstr "" 6198 6199 #: kdecore/kcalendarsystemjalali.cpp:180 6200 #, kde-format 6201 msgctxt "Jalali month 5 - KLocale::NarrowName" 6202 msgid "M" 6203 msgstr "" 6204 6205 #: kdecore/kcalendarsystemjalali.cpp:182 6206 #, kde-format 6207 msgctxt "Jalali month 6 - KLocale::NarrowName" 6208 msgid "S" 6209 msgstr "" 6210 6211 #: kdecore/kcalendarsystemjalali.cpp:184 6212 #, kde-format 6213 msgctxt "Jalali month 7 - KLocale::NarrowName" 6214 msgid "M" 6215 msgstr "" 6216 6217 #: kdecore/kcalendarsystemjalali.cpp:186 6218 #, fuzzy, kde-format 6219 #| msgid "Av" 6220 msgctxt "Jalali month 8 - KLocale::NarrowName" 6221 msgid "A" 6222 msgstr "एभ" 6223 6224 #: kdecore/kcalendarsystemjalali.cpp:188 6225 #, fuzzy, kde-format 6226 #| msgid "Av" 6227 msgctxt "Jalali month 9 - KLocale::NarrowName" 6228 msgid "A" 6229 msgstr "एभ" 6230 6231 #: kdecore/kcalendarsystemjalali.cpp:190 6232 #, kde-format 6233 msgctxt "Jalali month 10 - KLocale::NarrowName" 6234 msgid "D" 6235 msgstr "" 6236 6237 #: kdecore/kcalendarsystemjalali.cpp:192 6238 #, kde-format 6239 msgctxt "Jalali month 11 - KLocale::NarrowName" 6240 msgid "B" 6241 msgstr "" 6242 6243 #: kdecore/kcalendarsystemjalali.cpp:194 6244 #, kde-format 6245 msgctxt "Jalali month 12 - KLocale::NarrowName" 6246 msgid "E" 6247 msgstr "" 6248 6249 #: kdecore/kcalendarsystemjalali.cpp:203 6250 #, fuzzy, kde-format 6251 #| msgctxt "of Farvardin short" 6252 #| msgid "of Far" 6253 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6254 msgid "of Far" 6255 msgstr "of Far" 6256 6257 #: kdecore/kcalendarsystemjalali.cpp:205 6258 #, fuzzy, kde-format 6259 #| msgctxt "of Ordibehesht short" 6260 #| msgid "of Ord" 6261 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6262 msgid "of Ord" 6263 msgstr "of Ord" 6264 6265 #: kdecore/kcalendarsystemjalali.cpp:207 6266 #, fuzzy, kde-format 6267 #| msgctxt "of Khordad short" 6268 #| msgid "of Kho" 6269 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6270 msgid "of Kho" 6271 msgstr "of Kho" 6272 6273 #: kdecore/kcalendarsystemjalali.cpp:209 6274 #, fuzzy, kde-format 6275 #| msgctxt "of Tir short" 6276 #| msgid "of Tir" 6277 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6278 msgid "of Tir" 6279 msgstr "of Tir" 6280 6281 #: kdecore/kcalendarsystemjalali.cpp:211 6282 #, fuzzy, kde-format 6283 #| msgctxt "of Mordad short" 6284 #| msgid "of Mor" 6285 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6286 msgid "of Mor" 6287 msgstr "of Mor" 6288 6289 #: kdecore/kcalendarsystemjalali.cpp:213 6290 #, fuzzy, kde-format 6291 #| msgctxt "of Shahrivar short" 6292 #| msgid "of Sha" 6293 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6294 msgid "of Sha" 6295 msgstr "of Sha" 6296 6297 #: kdecore/kcalendarsystemjalali.cpp:215 6298 #, fuzzy, kde-format 6299 #| msgctxt "of Mehr short" 6300 #| msgid "of Meh" 6301 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6302 msgid "of Meh" 6303 msgstr "of Meh" 6304 6305 #: kdecore/kcalendarsystemjalali.cpp:217 6306 #, fuzzy, kde-format 6307 #| msgctxt "of Aban short" 6308 #| msgid "of Aba" 6309 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6310 msgid "of Aba" 6311 msgstr "of Aba" 6312 6313 #: kdecore/kcalendarsystemjalali.cpp:219 6314 #, fuzzy, kde-format 6315 #| msgctxt "of Azar short" 6316 #| msgid "of Aza" 6317 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6318 msgid "of Aza" 6319 msgstr "of Aza" 6320 6321 #: kdecore/kcalendarsystemjalali.cpp:221 6322 #, fuzzy, kde-format 6323 #| msgctxt "of Dei short" 6324 #| msgid "of Dei" 6325 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6326 msgid "of Dei" 6327 msgstr "of Dei" 6328 6329 #: kdecore/kcalendarsystemjalali.cpp:223 6330 #, fuzzy, kde-format 6331 #| msgctxt "of Bahman short" 6332 #| msgid "of Bah" 6333 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6334 msgid "of Bah" 6335 msgstr "of Bah" 6336 6337 #: kdecore/kcalendarsystemjalali.cpp:225 6338 #, fuzzy, kde-format 6339 #| msgctxt "of Esfand short" 6340 #| msgid "of Esf" 6341 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6342 msgid "of Esf" 6343 msgstr "of Esf" 6344 6345 #: kdecore/kcalendarsystemjalali.cpp:234 6346 #, fuzzy, kde-format 6347 #| msgctxt "Farvardin short" 6348 #| msgid "Far" 6349 msgctxt "Jalali month 1 - KLocale::ShortName" 6350 msgid "Far" 6351 msgstr "Far" 6352 6353 #: kdecore/kcalendarsystemjalali.cpp:236 6354 #, fuzzy, kde-format 6355 #| msgctxt "Ordibehesht short" 6356 #| msgid "Ord" 6357 msgctxt "Jalali month 2 - KLocale::ShortName" 6358 msgid "Ord" 6359 msgstr "Ord" 6360 6361 #: kdecore/kcalendarsystemjalali.cpp:238 6362 #, fuzzy, kde-format 6363 #| msgctxt "Khordad short" 6364 #| msgid "Kho" 6365 msgctxt "Jalali month 3 - KLocale::ShortName" 6366 msgid "Kho" 6367 msgstr "Kho" 6368 6369 #: kdecore/kcalendarsystemjalali.cpp:240 6370 #, fuzzy, kde-format 6371 #| msgctxt "Tir short" 6372 #| msgid "Tir" 6373 msgctxt "Jalali month 4 - KLocale::ShortName" 6374 msgid "Tir" 6375 msgstr "Tir" 6376 6377 #: kdecore/kcalendarsystemjalali.cpp:242 6378 #, fuzzy, kde-format 6379 #| msgctxt "Mordad short" 6380 #| msgid "Mor" 6381 msgctxt "Jalali month 5 - KLocale::ShortName" 6382 msgid "Mor" 6383 msgstr "Mor" 6384 6385 #: kdecore/kcalendarsystemjalali.cpp:244 6386 #, fuzzy, kde-format 6387 #| msgctxt "Shahrivar short" 6388 #| msgid "Sha" 6389 msgctxt "Jalali month 6 - KLocale::ShortName" 6390 msgid "Sha" 6391 msgstr "Sha" 6392 6393 #: kdecore/kcalendarsystemjalali.cpp:246 6394 #, fuzzy, kde-format 6395 #| msgctxt "Mehr short" 6396 #| msgid "Meh" 6397 msgctxt "Jalali month 7 - KLocale::ShortName" 6398 msgid "Meh" 6399 msgstr "Meh" 6400 6401 #: kdecore/kcalendarsystemjalali.cpp:248 6402 #, fuzzy, kde-format 6403 #| msgctxt "Aban short" 6404 #| msgid "Aba" 6405 msgctxt "Jalali month 8 - KLocale::ShortName" 6406 msgid "Aba" 6407 msgstr "Aba" 6408 6409 #: kdecore/kcalendarsystemjalali.cpp:250 6410 #, fuzzy, kde-format 6411 #| msgctxt "Azar short" 6412 #| msgid "Aza" 6413 msgctxt "Jalali month 9 - KLocale::ShortName" 6414 msgid "Aza" 6415 msgstr "Aza" 6416 6417 #: kdecore/kcalendarsystemjalali.cpp:252 6418 #, fuzzy, kde-format 6419 #| msgctxt "Dei short" 6420 #| msgid "Dei" 6421 msgctxt "Jalali month 10 - KLocale::ShortName" 6422 msgid "Dei" 6423 msgstr "Dei" 6424 6425 #: kdecore/kcalendarsystemjalali.cpp:254 6426 #, fuzzy, kde-format 6427 #| msgctxt "Bahman short" 6428 #| msgid "Bah" 6429 msgctxt "Jalali month 11 - KLocale::ShortName" 6430 msgid "Bah" 6431 msgstr "Bah" 6432 6433 #: kdecore/kcalendarsystemjalali.cpp:256 6434 #, fuzzy, kde-format 6435 #| msgctxt "Esfand" 6436 #| msgid "Esf" 6437 msgctxt "Jalali month 12 - KLocale::ShortName" 6438 msgid "Esf" 6439 msgstr "Esf" 6440 6441 #: kdecore/kcalendarsystemjalali.cpp:265 6442 #, fuzzy, kde-format 6443 #| msgid "of Farvardin" 6444 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6445 msgid "of Farvardin" 6446 msgstr "of Farvardin" 6447 6448 #: kdecore/kcalendarsystemjalali.cpp:267 6449 #, fuzzy, kde-format 6450 #| msgid "of Ordibehesht" 6451 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6452 msgid "of Ordibehesht" 6453 msgstr "of Ordibehesht" 6454 6455 #: kdecore/kcalendarsystemjalali.cpp:269 6456 #, fuzzy, kde-format 6457 #| msgid "of Khordad" 6458 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6459 msgid "of Khordad" 6460 msgstr "of Khordad" 6461 6462 #: kdecore/kcalendarsystemjalali.cpp:271 6463 #, fuzzy, kde-format 6464 #| msgctxt "of Tir short" 6465 #| msgid "of Tir" 6466 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6467 msgid "of Tir" 6468 msgstr "of Tir" 6469 6470 #: kdecore/kcalendarsystemjalali.cpp:273 6471 #, fuzzy, kde-format 6472 #| msgid "of Mordad" 6473 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6474 msgid "of Mordad" 6475 msgstr "of Mordad" 6476 6477 #: kdecore/kcalendarsystemjalali.cpp:275 6478 #, fuzzy, kde-format 6479 #| msgid "of Shahrivar" 6480 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6481 msgid "of Shahrivar" 6482 msgstr "of Shahrivar" 6483 6484 #: kdecore/kcalendarsystemjalali.cpp:277 6485 #, fuzzy, kde-format 6486 #| msgid "of Mehr" 6487 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6488 msgid "of Mehr" 6489 msgstr "of Mehr" 6490 6491 #: kdecore/kcalendarsystemjalali.cpp:279 6492 #, fuzzy, kde-format 6493 #| msgid "of Aban" 6494 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6495 msgid "of Aban" 6496 msgstr "of Aban" 6497 6498 #: kdecore/kcalendarsystemjalali.cpp:281 6499 #, fuzzy, kde-format 6500 #| msgid "of Azar" 6501 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6502 msgid "of Azar" 6503 msgstr "of Azar" 6504 6505 #: kdecore/kcalendarsystemjalali.cpp:283 6506 #, fuzzy, kde-format 6507 #| msgctxt "of Dei short" 6508 #| msgid "of Dei" 6509 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6510 msgid "of Dei" 6511 msgstr "of Dei" 6512 6513 #: kdecore/kcalendarsystemjalali.cpp:285 6514 #, fuzzy, kde-format 6515 #| msgid "of Bahman" 6516 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6517 msgid "of Bahman" 6518 msgstr "of Bahman" 6519 6520 #: kdecore/kcalendarsystemjalali.cpp:287 6521 #, fuzzy, kde-format 6522 #| msgid "of Esfand" 6523 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6524 msgid "of Esfand" 6525 msgstr "of Esfand" 6526 6527 #: kdecore/kcalendarsystemjalali.cpp:296 6528 #, fuzzy, kde-format 6529 #| msgid "Farvardin" 6530 msgctxt "Jalali month 1 - KLocale::LongName" 6531 msgid "Farvardin" 6532 msgstr "फार्भार्डिन" 6533 6534 #: kdecore/kcalendarsystemjalali.cpp:298 6535 #, fuzzy, kde-format 6536 #| msgid "Ordibehesht" 6537 msgctxt "Jalali month 2 - KLocale::LongName" 6538 msgid "Ordibehesht" 6539 msgstr "ओर्डिबेहेश" 6540 6541 #: kdecore/kcalendarsystemjalali.cpp:300 6542 #, fuzzy, kde-format 6543 #| msgid "Khordad" 6544 msgctxt "Jalali month 3 - KLocale::LongName" 6545 msgid "Khordad" 6546 msgstr "खोर्डाद" 6547 6548 #: kdecore/kcalendarsystemjalali.cpp:302 6549 #, fuzzy, kde-format 6550 #| msgctxt "Tir short" 6551 #| msgid "Tir" 6552 msgctxt "Jalali month 4 - KLocale::LongName" 6553 msgid "Tir" 6554 msgstr "Tir" 6555 6556 #: kdecore/kcalendarsystemjalali.cpp:304 6557 #, fuzzy, kde-format 6558 #| msgid "Mordad" 6559 msgctxt "Jalali month 5 - KLocale::LongName" 6560 msgid "Mordad" 6561 msgstr "मोर्डाद" 6562 6563 #: kdecore/kcalendarsystemjalali.cpp:306 6564 #, fuzzy, kde-format 6565 #| msgid "Shahrivar" 6566 msgctxt "Jalali month 6 - KLocale::LongName" 6567 msgid "Shahrivar" 6568 msgstr "शाह्रिभर" 6569 6570 #: kdecore/kcalendarsystemjalali.cpp:308 6571 #, fuzzy, kde-format 6572 #| msgid "Mehr" 6573 msgctxt "Jalali month 7 - KLocale::LongName" 6574 msgid "Mehr" 6575 msgstr "मेहर" 6576 6577 #: kdecore/kcalendarsystemjalali.cpp:310 6578 #, fuzzy, kde-format 6579 #| msgid "Aban" 6580 msgctxt "Jalali month 8 - KLocale::LongName" 6581 msgid "Aban" 6582 msgstr "अबान" 6583 6584 #: kdecore/kcalendarsystemjalali.cpp:312 6585 #, fuzzy, kde-format 6586 #| msgid "Azar" 6587 msgctxt "Jalali month 9 - KLocale::LongName" 6588 msgid "Azar" 6589 msgstr "अजार" 6590 6591 #: kdecore/kcalendarsystemjalali.cpp:314 6592 #, fuzzy, kde-format 6593 #| msgctxt "Dei short" 6594 #| msgid "Dei" 6595 msgctxt "Jalali month 10 - KLocale::LongName" 6596 msgid "Dei" 6597 msgstr "Dei" 6598 6599 #: kdecore/kcalendarsystemjalali.cpp:316 6600 #, fuzzy, kde-format 6601 #| msgid "Bahman" 6602 msgctxt "Jalali month 11 - KLocale::LongName" 6603 msgid "Bahman" 6604 msgstr "बाहमन" 6605 6606 #: kdecore/kcalendarsystemjalali.cpp:318 6607 #, fuzzy, kde-format 6608 #| msgid "Esfand" 6609 msgctxt "Jalali month 12 - KLocale::LongName" 6610 msgid "Esfand" 6611 msgstr "इस्फान्ड" 6612 6613 #: kdecore/kcalendarsystemjalali.cpp:331 6614 #, kde-format 6615 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6616 msgid "2" 6617 msgstr "" 6618 6619 #: kdecore/kcalendarsystemjalali.cpp:333 6620 #, kde-format 6621 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6622 msgid "3" 6623 msgstr "" 6624 6625 #: kdecore/kcalendarsystemjalali.cpp:335 6626 #, kde-format 6627 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6628 msgid "4" 6629 msgstr "" 6630 6631 #: kdecore/kcalendarsystemjalali.cpp:337 6632 #, kde-format 6633 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6634 msgid "5" 6635 msgstr "" 6636 6637 #: kdecore/kcalendarsystemjalali.cpp:339 6638 #, kde-format 6639 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6640 msgid "J" 6641 msgstr "" 6642 6643 #: kdecore/kcalendarsystemjalali.cpp:341 6644 #, kde-format 6645 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6646 msgid "S" 6647 msgstr "" 6648 6649 #: kdecore/kcalendarsystemjalali.cpp:343 6650 #, kde-format 6651 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6652 msgid "1" 6653 msgstr "" 6654 6655 #: kdecore/kcalendarsystemjalali.cpp:352 6656 #, fuzzy, kde-format 6657 #| msgctxt "Do shanbe short" 6658 #| msgid "2sh" 6659 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6660 msgid "2sh" 6661 msgstr "2sh" 6662 6663 #: kdecore/kcalendarsystemjalali.cpp:354 6664 #, fuzzy, kde-format 6665 #| msgctxt "Se shanbe short" 6666 #| msgid "3sh" 6667 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6668 msgid "3sh" 6669 msgstr "3sh" 6670 6671 #: kdecore/kcalendarsystemjalali.cpp:356 6672 #, fuzzy, kde-format 6673 #| msgctxt "Chahar shanbe short" 6674 #| msgid "4sh" 6675 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6676 msgid "4sh" 6677 msgstr "4sh" 6678 6679 #: kdecore/kcalendarsystemjalali.cpp:358 6680 #, fuzzy, kde-format 6681 #| msgctxt "Panj shanbe short" 6682 #| msgid "5sh" 6683 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6684 msgid "5sh" 6685 msgstr "5sh" 6686 6687 #: kdecore/kcalendarsystemjalali.cpp:360 6688 #, fuzzy, kde-format 6689 #| msgctxt "Jumee short" 6690 #| msgid "Jom" 6691 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6692 msgid "Jom" 6693 msgstr "Jom" 6694 6695 #: kdecore/kcalendarsystemjalali.cpp:362 6696 #, fuzzy, kde-format 6697 #| msgid "Shanbe" 6698 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6699 msgid "Shn" 6700 msgstr "शान्बे" 6701 6702 #: kdecore/kcalendarsystemjalali.cpp:364 6703 #, fuzzy, kde-format 6704 #| msgctxt "Yek-shanbe short" 6705 #| msgid "1sh" 6706 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6707 msgid "1sh" 6708 msgstr "1sh" 6709 6710 #: kdecore/kcalendarsystemjalali.cpp:371 6711 #, fuzzy, kde-format 6712 #| msgid "Do shanbe" 6713 msgctxt "Jalali weekday 1 - KLocale::LongName" 6714 msgid "Do shanbe" 6715 msgstr "डो शान्बे" 6716 6717 #: kdecore/kcalendarsystemjalali.cpp:373 6718 #, fuzzy, kde-format 6719 #| msgid "Se shanbe" 6720 msgctxt "Jalali weekday 2 - KLocale::LongName" 6721 msgid "Se shanbe" 6722 msgstr "से शान्बे" 6723 6724 #: kdecore/kcalendarsystemjalali.cpp:375 6725 #, fuzzy, kde-format 6726 #| msgid "Chahar shanbe" 6727 msgctxt "Jalali weekday 3 - KLocale::LongName" 6728 msgid "Chahar shanbe" 6729 msgstr "चाहर शान्बे" 6730 6731 #: kdecore/kcalendarsystemjalali.cpp:377 6732 #, fuzzy, kde-format 6733 #| msgid "Panj shanbe" 6734 msgctxt "Jalali weekday 4 - KLocale::LongName" 6735 msgid "Panj shanbe" 6736 msgstr "पन्ज शान्बे" 6737 6738 #: kdecore/kcalendarsystemjalali.cpp:379 6739 #, fuzzy, kde-format 6740 #| msgid "Jumee" 6741 msgctxt "Jalali weekday 5 - KLocale::LongName" 6742 msgid "Jumee" 6743 msgstr "जुमी" 6744 6745 #: kdecore/kcalendarsystemjalali.cpp:381 6746 #, fuzzy, kde-format 6747 #| msgid "Shanbe" 6748 msgctxt "Jalali weekday 6 - KLocale::LongName" 6749 msgid "Shanbe" 6750 msgstr "शान्बे" 6751 6752 #: kdecore/kcalendarsystemjalali.cpp:383 6753 #, fuzzy, kde-format 6754 #| msgid "Yek-shanbe" 6755 msgctxt "Jalali weekday 7 - KLocale::LongName" 6756 msgid "Yek-shanbe" 6757 msgstr "येक-शान्बे" 6758 6759 #: kdecore/kcalendarsystemjapanese.cpp:62 6760 #, kde-format 6761 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6762 msgid "Meiji" 6763 msgstr "" 6764 6765 #: kdecore/kcalendarsystemjapanese.cpp:64 6766 #, kde-format 6767 msgctxt "" 6768 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6769 "e.g. Meiji 1" 6770 msgid "%EC Gannen" 6771 msgstr "" 6772 6773 #: kdecore/kcalendarsystemjapanese.cpp:66 6774 #, kde-format 6775 msgctxt "" 6776 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6777 "e.g. Meiji 22" 6778 msgid "%EC %Ey" 6779 msgstr "" 6780 6781 #: kdecore/kcalendarsystemjapanese.cpp:69 6782 #, kde-format 6783 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6784 msgid "Taishō" 6785 msgstr "" 6786 6787 #: kdecore/kcalendarsystemjapanese.cpp:71 6788 #, kde-format 6789 msgctxt "" 6790 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6791 "1, e.g. Taishō 1" 6792 msgid "%EC Gannen" 6793 msgstr "" 6794 6795 #: kdecore/kcalendarsystemjapanese.cpp:73 6796 #, kde-format 6797 msgctxt "" 6798 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6799 "1, e.g. Taishō 22" 6800 msgid "%EC %Ey" 6801 msgstr "" 6802 6803 #: kdecore/kcalendarsystemjapanese.cpp:76 6804 #, fuzzy, kde-format 6805 #| msgctxt "Shahrivar short" 6806 #| msgid "Sha" 6807 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6808 msgid "Shōwa" 6809 msgstr "Sha" 6810 6811 #: kdecore/kcalendarsystemjapanese.cpp:78 6812 #, kde-format 6813 msgctxt "" 6814 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6815 "e.g. Shōwa 1" 6816 msgid "%EC Gannen" 6817 msgstr "" 6818 6819 #: kdecore/kcalendarsystemjapanese.cpp:80 6820 #, kde-format 6821 msgctxt "" 6822 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6823 "e.g. Shōwa 22" 6824 msgid "%EC %Ey" 6825 msgstr "" 6826 6827 #: kdecore/kcalendarsystemjapanese.cpp:83 6828 #, kde-format 6829 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6830 msgid "Heisei" 6831 msgstr "" 6832 6833 #: kdecore/kcalendarsystemjapanese.cpp:85 6834 #, kde-format 6835 msgctxt "" 6836 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6837 "1, e.g. Heisei 1" 6838 msgid "%EC Gannen" 6839 msgstr "" 6840 6841 #: kdecore/kcalendarsystemjapanese.cpp:87 6842 #, kde-format 6843 msgctxt "" 6844 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6845 "1, e.g. Heisei 22" 6846 msgid "%EC %Ey" 6847 msgstr "" 6848 6849 #: kdecore/kcalendarsystemjapanese.cpp:164 6850 #, fuzzy, kde-format 6851 msgctxt "Japanese year 1 of era" 6852 msgid "Gannen" 6853 msgstr "हरियो:" 6854 6855 #: kdecore/kcalendarsystemjulian.cpp:73 6856 #, kde-format 6857 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6858 msgid "Before Common Era" 6859 msgstr "" 6860 6861 #: kdecore/kcalendarsystemjulian.cpp:74 6862 #, kde-format 6863 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6864 msgid "BCE" 6865 msgstr "" 6866 6867 #: kdecore/kcalendarsystemjulian.cpp:76 6868 #, kde-format 6869 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6870 msgid "Before Christ" 6871 msgstr "" 6872 6873 #: kdecore/kcalendarsystemjulian.cpp:77 6874 #, kde-format 6875 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6876 msgid "BC" 6877 msgstr "" 6878 6879 #: kdecore/kcalendarsystemjulian.cpp:79 6880 #, kde-format 6881 msgctxt "" 6882 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6883 msgid "%Ey %EC" 6884 msgstr "" 6885 6886 #: kdecore/kcalendarsystemjulian.cpp:83 6887 #, kde-format 6888 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6889 msgid "Common Era" 6890 msgstr "" 6891 6892 #: kdecore/kcalendarsystemjulian.cpp:84 6893 #, kde-format 6894 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6895 msgid "CE" 6896 msgstr "" 6897 6898 #: kdecore/kcalendarsystemjulian.cpp:86 6899 #, kde-format 6900 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6901 msgid "Anno Domini" 6902 msgstr "" 6903 6904 #: kdecore/kcalendarsystemjulian.cpp:87 6905 #, kde-format 6906 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6907 msgid "AD" 6908 msgstr "" 6909 6910 #: kdecore/kcalendarsystemjulian.cpp:89 6911 #, kde-format 6912 msgctxt "" 6913 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6914 msgid "%Ey %EC" 6915 msgstr "" 6916 6917 #: kdecore/kcalendarsystemjulian.cpp:172 6918 #, kde-format 6919 msgctxt "Julian month 1 - KLocale::NarrowName" 6920 msgid "J" 6921 msgstr "" 6922 6923 #: kdecore/kcalendarsystemjulian.cpp:174 6924 #, kde-format 6925 msgctxt "Julian month 2 - KLocale::NarrowName" 6926 msgid "F" 6927 msgstr "" 6928 6929 #: kdecore/kcalendarsystemjulian.cpp:176 6930 #, kde-format 6931 msgctxt "Julian month 3 - KLocale::NarrowName" 6932 msgid "M" 6933 msgstr "" 6934 6935 #: kdecore/kcalendarsystemjulian.cpp:178 6936 #, fuzzy, kde-format 6937 #| msgid "Av" 6938 msgctxt "Julian month 4 - KLocale::NarrowName" 6939 msgid "A" 6940 msgstr "एभ" 6941 6942 #: kdecore/kcalendarsystemjulian.cpp:180 6943 #, kde-format 6944 msgctxt "Julian month 5 - KLocale::NarrowName" 6945 msgid "M" 6946 msgstr "" 6947 6948 #: kdecore/kcalendarsystemjulian.cpp:182 6949 #, kde-format 6950 msgctxt "Julian month 6 - KLocale::NarrowName" 6951 msgid "J" 6952 msgstr "" 6953 6954 #: kdecore/kcalendarsystemjulian.cpp:184 6955 #, kde-format 6956 msgctxt "Julian month 7 - KLocale::NarrowName" 6957 msgid "J" 6958 msgstr "" 6959 6960 #: kdecore/kcalendarsystemjulian.cpp:186 6961 #, fuzzy, kde-format 6962 #| msgid "Av" 6963 msgctxt "Julian month 8 - KLocale::NarrowName" 6964 msgid "A" 6965 msgstr "एभ" 6966 6967 #: kdecore/kcalendarsystemjulian.cpp:188 6968 #, kde-format 6969 msgctxt "Julian month 9 - KLocale::NarrowName" 6970 msgid "S" 6971 msgstr "" 6972 6973 #: kdecore/kcalendarsystemjulian.cpp:190 6974 #, kde-format 6975 msgctxt "Julian month 10 - KLocale::NarrowName" 6976 msgid "O" 6977 msgstr "" 6978 6979 #: kdecore/kcalendarsystemjulian.cpp:192 6980 #, kde-format 6981 msgctxt "Julian month 11 - KLocale::NarrowName" 6982 msgid "N" 6983 msgstr "" 6984 6985 #: kdecore/kcalendarsystemjulian.cpp:194 6986 #, kde-format 6987 msgctxt "Julian month 12 - KLocale::NarrowName" 6988 msgid "D" 6989 msgstr "" 6990 6991 #: kdecore/kcalendarsystemjulian.cpp:203 6992 #, fuzzy, kde-format 6993 #| msgctxt "of January" 6994 #| msgid "of Jan" 6995 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6996 msgid "of Jan" 6997 msgstr "जनवरीको" 6998 6999 #: kdecore/kcalendarsystemjulian.cpp:205 7000 #, fuzzy, kde-format 7001 #| msgctxt "of February" 7002 #| msgid "of Feb" 7003 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 7004 msgid "of Feb" 7005 msgstr "फेब्रुअरीको" 7006 7007 #: kdecore/kcalendarsystemjulian.cpp:207 7008 #, fuzzy, kde-format 7009 #| msgctxt "of March" 7010 #| msgid "of Mar" 7011 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 7012 msgid "of Mar" 7013 msgstr "मार्चको" 7014 7015 #: kdecore/kcalendarsystemjulian.cpp:209 7016 #, fuzzy, kde-format 7017 #| msgctxt "of April" 7018 #| msgid "of Apr" 7019 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7020 msgid "of Apr" 7021 msgstr "अप्रिलको" 7022 7023 #: kdecore/kcalendarsystemjulian.cpp:211 7024 #, fuzzy, kde-format 7025 #| msgctxt "of May short" 7026 #| msgid "of May" 7027 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7028 msgid "of May" 7029 msgstr "मेको" 7030 7031 #: kdecore/kcalendarsystemjulian.cpp:213 7032 #, fuzzy, kde-format 7033 #| msgctxt "of June" 7034 #| msgid "of Jun" 7035 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7036 msgid "of Jun" 7037 msgstr "जुनको" 7038 7039 #: kdecore/kcalendarsystemjulian.cpp:215 7040 #, fuzzy, kde-format 7041 #| msgctxt "of July" 7042 #| msgid "of Jul" 7043 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7044 msgid "of Jul" 7045 msgstr "जुलाइको" 7046 7047 #: kdecore/kcalendarsystemjulian.cpp:217 7048 #, fuzzy, kde-format 7049 #| msgctxt "of August" 7050 #| msgid "of Aug" 7051 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7052 msgid "of Aug" 7053 msgstr "अगस्टको" 7054 7055 #: kdecore/kcalendarsystemjulian.cpp:219 7056 #, fuzzy, kde-format 7057 #| msgctxt "of September" 7058 #| msgid "of Sep" 7059 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7060 msgid "of Sep" 7061 msgstr "सेप्टेम्बरको" 7062 7063 #: kdecore/kcalendarsystemjulian.cpp:221 7064 #, fuzzy, kde-format 7065 #| msgctxt "of October" 7066 #| msgid "of Oct" 7067 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7068 msgid "of Oct" 7069 msgstr "अक्टोबरको" 7070 7071 #: kdecore/kcalendarsystemjulian.cpp:223 7072 #, fuzzy, kde-format 7073 #| msgctxt "of November" 7074 #| msgid "of Nov" 7075 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7076 msgid "of Nov" 7077 msgstr "नोभेम्बरको" 7078 7079 #: kdecore/kcalendarsystemjulian.cpp:225 7080 #, fuzzy, kde-format 7081 #| msgctxt "of December" 7082 #| msgid "of Dec" 7083 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7084 msgid "of Dec" 7085 msgstr "डिसेम्बरको" 7086 7087 #: kdecore/kcalendarsystemjulian.cpp:234 7088 #, fuzzy, kde-format 7089 #| msgctxt "January" 7090 #| msgid "Jan" 7091 msgctxt "Julian month 1 - KLocale::ShortName" 7092 msgid "Jan" 7093 msgstr "जनवरी" 7094 7095 #: kdecore/kcalendarsystemjulian.cpp:236 7096 #, fuzzy, kde-format 7097 #| msgctxt "February" 7098 #| msgid "Feb" 7099 msgctxt "Julian month 2 - KLocale::ShortName" 7100 msgid "Feb" 7101 msgstr "फेब्रुअरी" 7102 7103 #: kdecore/kcalendarsystemjulian.cpp:238 7104 #, fuzzy, kde-format 7105 #| msgctxt "March" 7106 #| msgid "Mar" 7107 msgctxt "Julian month 3 - KLocale::ShortName" 7108 msgid "Mar" 7109 msgstr "मार्च" 7110 7111 #: kdecore/kcalendarsystemjulian.cpp:240 7112 #, fuzzy, kde-format 7113 #| msgctxt "April" 7114 #| msgid "Apr" 7115 msgctxt "Julian month 4 - KLocale::ShortName" 7116 msgid "Apr" 7117 msgstr "अप्रिल" 7118 7119 #: kdecore/kcalendarsystemjulian.cpp:242 7120 #, fuzzy, kde-format 7121 #| msgctxt "May short" 7122 #| msgid "May" 7123 msgctxt "Julian month 5 - KLocale::ShortName" 7124 msgid "May" 7125 msgstr "मे" 7126 7127 #: kdecore/kcalendarsystemjulian.cpp:244 7128 #, fuzzy, kde-format 7129 #| msgctxt "June" 7130 #| msgid "Jun" 7131 msgctxt "Julian month 6 - KLocale::ShortName" 7132 msgid "Jun" 7133 msgstr "जुन" 7134 7135 #: kdecore/kcalendarsystemjulian.cpp:246 7136 #, fuzzy, kde-format 7137 #| msgctxt "July" 7138 #| msgid "Jul" 7139 msgctxt "Julian month 7 - KLocale::ShortName" 7140 msgid "Jul" 7141 msgstr "जुलाइ" 7142 7143 #: kdecore/kcalendarsystemjulian.cpp:248 7144 #, fuzzy, kde-format 7145 #| msgctxt "August" 7146 #| msgid "Aug" 7147 msgctxt "Julian month 8 - KLocale::ShortName" 7148 msgid "Aug" 7149 msgstr "अगस्ट" 7150 7151 #: kdecore/kcalendarsystemjulian.cpp:250 7152 #, fuzzy, kde-format 7153 #| msgctxt "September" 7154 #| msgid "Sep" 7155 msgctxt "Julian month 9 - KLocale::ShortName" 7156 msgid "Sep" 7157 msgstr "सेप्टेम्बर" 7158 7159 #: kdecore/kcalendarsystemjulian.cpp:252 7160 #, fuzzy, kde-format 7161 #| msgctxt "October" 7162 #| msgid "Oct" 7163 msgctxt "Julian month 10 - KLocale::ShortName" 7164 msgid "Oct" 7165 msgstr "अक्टोबर" 7166 7167 #: kdecore/kcalendarsystemjulian.cpp:254 7168 #, fuzzy, kde-format 7169 #| msgctxt "November" 7170 #| msgid "Nov" 7171 msgctxt "Julian month 11 - KLocale::ShortName" 7172 msgid "Nov" 7173 msgstr "नोभेम्बर" 7174 7175 #: kdecore/kcalendarsystemjulian.cpp:256 7176 #, fuzzy, kde-format 7177 #| msgctxt "December" 7178 #| msgid "Dec" 7179 msgctxt "Julian month 12 - KLocale::ShortName" 7180 msgid "Dec" 7181 msgstr "डिसेम्बर" 7182 7183 #: kdecore/kcalendarsystemjulian.cpp:265 7184 #, fuzzy, kde-format 7185 #| msgid "of January" 7186 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7187 msgid "of January" 7188 msgstr "जनवरीको" 7189 7190 #: kdecore/kcalendarsystemjulian.cpp:267 7191 #, fuzzy, kde-format 7192 #| msgid "of February" 7193 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7194 msgid "of February" 7195 msgstr "फेब्रुअरीको" 7196 7197 #: kdecore/kcalendarsystemjulian.cpp:269 7198 #, fuzzy, kde-format 7199 #| msgid "of March" 7200 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7201 msgid "of March" 7202 msgstr "मार्चको" 7203 7204 #: kdecore/kcalendarsystemjulian.cpp:271 7205 #, fuzzy, kde-format 7206 #| msgid "of April" 7207 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7208 msgid "of April" 7209 msgstr "अप्रिलको" 7210 7211 #: kdecore/kcalendarsystemjulian.cpp:273 7212 #, fuzzy, kde-format 7213 #| msgctxt "of May short" 7214 #| msgid "of May" 7215 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7216 msgid "of May" 7217 msgstr "मेको" 7218 7219 #: kdecore/kcalendarsystemjulian.cpp:275 7220 #, fuzzy, kde-format 7221 #| msgid "of June" 7222 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7223 msgid "of June" 7224 msgstr "जुनको" 7225 7226 #: kdecore/kcalendarsystemjulian.cpp:277 7227 #, fuzzy, kde-format 7228 #| msgid "of July" 7229 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7230 msgid "of July" 7231 msgstr "जुलाइको" 7232 7233 #: kdecore/kcalendarsystemjulian.cpp:279 7234 #, fuzzy, kde-format 7235 #| msgid "of August" 7236 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7237 msgid "of August" 7238 msgstr "अगस्टको" 7239 7240 #: kdecore/kcalendarsystemjulian.cpp:281 7241 #, fuzzy, kde-format 7242 #| msgid "of September" 7243 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7244 msgid "of September" 7245 msgstr "सेप्टेम्बरको" 7246 7247 #: kdecore/kcalendarsystemjulian.cpp:283 7248 #, fuzzy, kde-format 7249 #| msgid "of October" 7250 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7251 msgid "of October" 7252 msgstr "अक्टोबरको" 7253 7254 #: kdecore/kcalendarsystemjulian.cpp:285 7255 #, fuzzy, kde-format 7256 #| msgid "of November" 7257 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7258 msgid "of November" 7259 msgstr "नोभेम्बरको" 7260 7261 #: kdecore/kcalendarsystemjulian.cpp:287 7262 #, fuzzy, kde-format 7263 #| msgid "of December" 7264 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7265 msgid "of December" 7266 msgstr "डिसेम्बरको" 7267 7268 #: kdecore/kcalendarsystemjulian.cpp:296 7269 #, fuzzy, kde-format 7270 #| msgid "January" 7271 msgctxt "Julian month 1 - KLocale::LongName" 7272 msgid "January" 7273 msgstr "जनवरी" 7274 7275 #: kdecore/kcalendarsystemjulian.cpp:298 7276 #, fuzzy, kde-format 7277 #| msgid "February" 7278 msgctxt "Julian month 2 - KLocale::LongName" 7279 msgid "February" 7280 msgstr "फेब्रुअरी" 7281 7282 #: kdecore/kcalendarsystemjulian.cpp:300 7283 #, fuzzy, kde-format 7284 #| msgctxt "March long" 7285 #| msgid "March" 7286 msgctxt "Julian month 3 - KLocale::LongName" 7287 msgid "March" 7288 msgstr "मार्च" 7289 7290 #: kdecore/kcalendarsystemjulian.cpp:302 7291 #, fuzzy, kde-format 7292 #| msgid "April" 7293 msgctxt "Julian month 4 - KLocale::LongName" 7294 msgid "April" 7295 msgstr "अप्रिल" 7296 7297 #: kdecore/kcalendarsystemjulian.cpp:304 7298 #, fuzzy, kde-format 7299 #| msgctxt "May short" 7300 #| msgid "May" 7301 msgctxt "Julian month 5 - KLocale::LongName" 7302 msgid "May" 7303 msgstr "मे" 7304 7305 #: kdecore/kcalendarsystemjulian.cpp:306 7306 #, fuzzy, kde-format 7307 #| msgid "June" 7308 msgctxt "Julian month 6 - KLocale::LongName" 7309 msgid "June" 7310 msgstr "जुन" 7311 7312 #: kdecore/kcalendarsystemjulian.cpp:308 7313 #, fuzzy, kde-format 7314 #| msgid "July" 7315 msgctxt "Julian month 7 - KLocale::LongName" 7316 msgid "July" 7317 msgstr "जुलाइ" 7318 7319 #: kdecore/kcalendarsystemjulian.cpp:310 7320 #, fuzzy, kde-format 7321 #| msgctxt "August long" 7322 #| msgid "August" 7323 msgctxt "Julian month 8 - KLocale::LongName" 7324 msgid "August" 7325 msgstr "अगस्ट" 7326 7327 #: kdecore/kcalendarsystemjulian.cpp:312 7328 #, fuzzy, kde-format 7329 #| msgid "September" 7330 msgctxt "Julian month 9 - KLocale::LongName" 7331 msgid "September" 7332 msgstr "सेप्टेम्बर" 7333 7334 #: kdecore/kcalendarsystemjulian.cpp:314 7335 #, fuzzy, kde-format 7336 #| msgid "October" 7337 msgctxt "Julian month 10 - KLocale::LongName" 7338 msgid "October" 7339 msgstr "अक्टोबर" 7340 7341 #: kdecore/kcalendarsystemjulian.cpp:316 7342 #, fuzzy, kde-format 7343 #| msgid "November" 7344 msgctxt "Julian month 11 - KLocale::LongName" 7345 msgid "November" 7346 msgstr "नोभेम्बर" 7347 7348 #: kdecore/kcalendarsystemjulian.cpp:318 7349 #, fuzzy, kde-format 7350 #| msgid "December" 7351 msgctxt "Julian month 12 - KLocale::LongName" 7352 msgid "December" 7353 msgstr "डिसेम्बर" 7354 7355 #: kdecore/kcalendarsystemjulian.cpp:331 7356 #, kde-format 7357 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7358 msgid "M" 7359 msgstr "" 7360 7361 #: kdecore/kcalendarsystemjulian.cpp:333 7362 #, kde-format 7363 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7364 msgid "T" 7365 msgstr "" 7366 7367 #: kdecore/kcalendarsystemjulian.cpp:335 7368 #, kde-format 7369 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7370 msgid "W" 7371 msgstr "" 7372 7373 #: kdecore/kcalendarsystemjulian.cpp:337 7374 #, kde-format 7375 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7376 msgid "T" 7377 msgstr "" 7378 7379 #: kdecore/kcalendarsystemjulian.cpp:339 7380 #, kde-format 7381 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7382 msgid "F" 7383 msgstr "" 7384 7385 #: kdecore/kcalendarsystemjulian.cpp:341 7386 #, kde-format 7387 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7388 msgid "S" 7389 msgstr "" 7390 7391 #: kdecore/kcalendarsystemjulian.cpp:343 7392 #, kde-format 7393 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7394 msgid "S" 7395 msgstr "" 7396 7397 #: kdecore/kcalendarsystemjulian.cpp:352 7398 #, fuzzy, kde-format 7399 #| msgctxt "Monday" 7400 #| msgid "Mon" 7401 msgctxt "Julian weekday 1 - KLocale::ShortName" 7402 msgid "Mon" 7403 msgstr "सोम" 7404 7405 #: kdecore/kcalendarsystemjulian.cpp:354 7406 #, fuzzy, kde-format 7407 #| msgctxt "Tuesday" 7408 #| msgid "Tue" 7409 msgctxt "Julian weekday 2 - KLocale::ShortName" 7410 msgid "Tue" 7411 msgstr "मङ्गल" 7412 7413 #: kdecore/kcalendarsystemjulian.cpp:356 7414 #, fuzzy, kde-format 7415 #| msgctxt "Wednesday" 7416 #| msgid "Wed" 7417 msgctxt "Julian weekday 3 - KLocale::ShortName" 7418 msgid "Wed" 7419 msgstr "बुध" 7420 7421 #: kdecore/kcalendarsystemjulian.cpp:358 7422 #, fuzzy, kde-format 7423 #| msgctxt "Thursday" 7424 #| msgid "Thu" 7425 msgctxt "Julian weekday 4 - KLocale::ShortName" 7426 msgid "Thu" 7427 msgstr "बिही" 7428 7429 #: kdecore/kcalendarsystemjulian.cpp:360 7430 #, fuzzy, kde-format 7431 #| msgctxt "Friday" 7432 #| msgid "Fri" 7433 msgctxt "Julian weekday 5 - KLocale::ShortName" 7434 msgid "Fri" 7435 msgstr "शुक्र" 7436 7437 #: kdecore/kcalendarsystemjulian.cpp:362 7438 #, fuzzy, kde-format 7439 #| msgctxt "Saturday" 7440 #| msgid "Sat" 7441 msgctxt "Julian weekday 6 - KLocale::ShortName" 7442 msgid "Sat" 7443 msgstr "शनि" 7444 7445 #: kdecore/kcalendarsystemjulian.cpp:364 7446 #, fuzzy, kde-format 7447 #| msgctxt "Sunday" 7448 #| msgid "Sun" 7449 msgctxt "Julian weekday 7 - KLocale::ShortName" 7450 msgid "Sun" 7451 msgstr "आइत" 7452 7453 #: kdecore/kcalendarsystemjulian.cpp:371 7454 #, fuzzy, kde-format 7455 #| msgid "Monday" 7456 msgctxt "Julian weekday 1 - KLocale::LongName" 7457 msgid "Monday" 7458 msgstr "सोमबार" 7459 7460 #: kdecore/kcalendarsystemjulian.cpp:373 7461 #, fuzzy, kde-format 7462 #| msgid "Tuesday" 7463 msgctxt "Julian weekday 2 - KLocale::LongName" 7464 msgid "Tuesday" 7465 msgstr "मङ्गलबार" 7466 7467 #: kdecore/kcalendarsystemjulian.cpp:375 7468 #, fuzzy, kde-format 7469 #| msgid "Wednesday" 7470 msgctxt "Julian weekday 3 - KLocale::LongName" 7471 msgid "Wednesday" 7472 msgstr "बुधबार" 7473 7474 #: kdecore/kcalendarsystemjulian.cpp:377 7475 #, fuzzy, kde-format 7476 #| msgid "Thursday" 7477 msgctxt "Julian weekday 4 - KLocale::LongName" 7478 msgid "Thursday" 7479 msgstr "बिहिबार" 7480 7481 #: kdecore/kcalendarsystemjulian.cpp:379 7482 #, fuzzy, kde-format 7483 #| msgid "Friday" 7484 msgctxt "Julian weekday 5 - KLocale::LongName" 7485 msgid "Friday" 7486 msgstr "शुक्रबार" 7487 7488 #: kdecore/kcalendarsystemjulian.cpp:381 7489 #, fuzzy, kde-format 7490 #| msgid "Saturday" 7491 msgctxt "Julian weekday 6 - KLocale::LongName" 7492 msgid "Saturday" 7493 msgstr "शनिबार" 7494 7495 #: kdecore/kcalendarsystemjulian.cpp:383 7496 #, fuzzy, kde-format 7497 #| msgid "Sunday" 7498 msgctxt "Julian weekday 7 - KLocale::LongName" 7499 msgid "Sunday" 7500 msgstr "आइतबार" 7501 7502 #: kdecore/kcalendarsystemminguo.cpp:57 7503 #, kde-format 7504 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7505 msgid "Republic of China Era" 7506 msgstr "" 7507 7508 #: kdecore/kcalendarsystemminguo.cpp:58 7509 #, kde-format 7510 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7511 msgid "ROC" 7512 msgstr "" 7513 7514 #: kdecore/kcalendarsystemminguo.cpp:59 7515 #, kde-format 7516 msgctxt "" 7517 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7518 msgid "%EC %Ey" 7519 msgstr "" 7520 7521 #: kdecore/kcalendarsystemthai.cpp:58 7522 #, kde-format 7523 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7524 msgid "Buddhist Era" 7525 msgstr "" 7526 7527 #: kdecore/kcalendarsystemthai.cpp:59 7528 #, kde-format 7529 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7530 msgid "BE" 7531 msgstr "" 7532 7533 #: kdecore/kcalendarsystemthai.cpp:60 7534 #, kde-format 7535 msgctxt "" 7536 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7537 msgid "%Ey %EC" 7538 msgstr "" 7539 7540 #: kdecore/kcmdlineargs.cpp:278 7541 #, kde-format 7542 msgid "Use the X-server display 'displayname'" 7543 msgstr "एक्स-सर्भर प्रर्दशन 'प्रर्दशन नाम' प्रयोग गर्नुहोस्" 7544 7545 #: kdecore/kcmdlineargs.cpp:281 7546 #, kde-format 7547 msgid "Restore the application for the given 'sessionId'" 7548 msgstr "दिइएको 'sessionId' का लागि अनप्रयोग पूर्वावस्थामा ल्याउनुहोस्" 7549 7550 #: kdecore/kcmdlineargs.cpp:282 7551 #, kde-format 7552 msgid "" 7553 "Causes the application to install a private color\n" 7554 "map on an 8-bit display" 7555 msgstr "" 7556 "अनुप्रयोग स्थापनाको कारणले एउटा\n" 7557 "8-bit मा निजी रङ मानचित्र स्थापना प्रदर्शन गर्दछ" 7558 7559 #: kdecore/kcmdlineargs.cpp:283 7560 #, kde-format 7561 msgid "" 7562 "Limits the number of colors allocated in the color\n" 7563 "cube on an 8-bit display, if the application is\n" 7564 "using the QApplication::ManyColor color\n" 7565 "specification" 7566 msgstr "" 7567 "यदि अनुप्रयोगले\n" 7568 "Q अनुप्रयोग::धेरै रङको रङ\n" 7569 "विशेषता प्रयोग गरेमा 8-bit प्रर्दशनको रङ क्युबमा विभाजन गरिएको रङको सङ्ख्या\n" 7570 "सिमाङ्कन गर्दछ ।" 7571 7572 #: kdecore/kcmdlineargs.cpp:284 7573 #, kde-format 7574 msgid "tells Qt to never grab the mouse or the keyboard" 7575 msgstr "Qt लाई माउस वा कुञ्जीपाटी कहिले पनि ग्य्राब नगर्न भन्दछ" 7576 7577 #: kdecore/kcmdlineargs.cpp:285 7578 #, kde-format 7579 msgid "" 7580 "running under a debugger can cause an implicit\n" 7581 "-nograb, use -dograb to override" 7582 msgstr "" 7583 "डिबग अन्तर्गत चलाउनाको कारणले अधिलेखन गर्न अस्पष्ट\n" 7584 "-ग्राब नहुने, ग्य्राब-प्रयोग हुने कारण हुन सक्दछ" 7585 7586 #: kdecore/kcmdlineargs.cpp:286 7587 #, kde-format 7588 msgid "switches to synchronous mode for debugging" 7589 msgstr "डिबगका लागि समक्रमण मोडमा स्विच गर्दछ" 7590 7591 #: kdecore/kcmdlineargs.cpp:288 7592 #, kde-format 7593 msgid "defines the application font" 7594 msgstr "अनुप्रयोग फन्ट परिभाषित गर्दछ" 7595 7596 #: kdecore/kcmdlineargs.cpp:290 7597 #, kde-format 7598 msgid "" 7599 "sets the default background color and an\n" 7600 "application palette (light and dark shades are\n" 7601 "calculated)" 7602 msgstr "" 7603 "पूर्वनिर्धारित रङ र अनुप्रयोग रङदानी\n" 7604 "सेट गर्दछ (हल्का र गाढा छायाँ\n" 7605 "गणना गरिएको छ)" 7606 7607 #: kdecore/kcmdlineargs.cpp:292 7608 #, kde-format 7609 msgid "sets the default foreground color" 7610 msgstr "पूर्वनिर्धारित अग्रभूमि रङ सेट गर्दछ" 7611 7612 #: kdecore/kcmdlineargs.cpp:294 7613 #, kde-format 7614 msgid "sets the default button color" 7615 msgstr "पूर्वनिर्धारित बटन रङ सेट गर्दछ" 7616 7617 #: kdecore/kcmdlineargs.cpp:295 7618 #, kde-format 7619 msgid "sets the application name" 7620 msgstr "अनुप्रयोग नाम सेट गर्दछ" 7621 7622 #: kdecore/kcmdlineargs.cpp:296 7623 #, kde-format 7624 msgid "sets the application title (caption)" 7625 msgstr "अनुप्रयोग शीर्षक (क्याप्सन) सेट गर्दछ" 7626 7627 #: kdecore/kcmdlineargs.cpp:297 7628 #, kde-format 7629 msgid "load the testability framework" 7630 msgstr "" 7631 7632 #: kdecore/kcmdlineargs.cpp:299 7633 #, kde-format 7634 msgid "" 7635 "forces the application to use a TrueColor visual on\n" 7636 "an 8-bit display" 7637 msgstr "" 7638 "अनुप्रयोगलाई एउटा 8-bit प्रर्दशनमा सही रङ दृश्य प्रयोग गर्न\n" 7639 "बल गर्दछ" 7640 7641 #: kdecore/kcmdlineargs.cpp:300 7642 #, kde-format 7643 msgid "" 7644 "sets XIM (X Input Method) input style. Possible\n" 7645 "values are onthespot, overthespot, offthespot and\n" 7646 "root" 7647 msgstr "" 7648 "XIM (X आगत विधि) आगत शैली सेट गर्दछ । सम्भाव्य मानहरू\n" 7649 "अनदस्पट, ओभरदस्पट,अफदस्पट र\n" 7650 "रूट हुन्" 7651 7652 #: kdecore/kcmdlineargs.cpp:301 7653 #, kde-format 7654 msgid "set XIM server" 7655 msgstr "XIM सर्भर सेट गर्नुहोस्" 7656 7657 #: kdecore/kcmdlineargs.cpp:302 7658 #, kde-format 7659 msgid "disable XIM" 7660 msgstr "XIM अक्षम पार्नुहोस्" 7661 7662 #: kdecore/kcmdlineargs.cpp:304 7663 #, kde-format 7664 msgid "mirrors the whole layout of widgets" 7665 msgstr "विजेटको सम्पूर्ण सजावट दर्पण गर्दछ" 7666 7667 #: kdecore/kcmdlineargs.cpp:305 7668 #, kde-format 7669 msgid "applies the Qt stylesheet to the application widgets" 7670 msgstr "" 7671 7672 #: kdecore/kcmdlineargs.cpp:306 7673 #, kde-format 7674 msgid "" 7675 "use a different graphics system instead of the default one, options are " 7676 "raster and opengl (experimental)" 7677 msgstr "" 7678 7679 #: kdecore/kcmdlineargs.cpp:307 7680 #, kde-format 7681 msgid "" 7682 "QML JS debugger information. Application must be\n" 7683 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7684 "enabled" 7685 msgstr "" 7686 7687 #: kdecore/kcmdlineargs.cpp:308 7688 #, kde-format 7689 msgid "The windowing system platform (e.g. xcb or wayland)" 7690 msgstr "" 7691 7692 #: kdecore/kcmdlineargs.cpp:310 7693 #, kde-format 7694 msgid "Use 'caption' as name in the titlebar" 7695 msgstr "शीर्षकपट्टीमा नामको रूपमा 'क्याप्सन' प्रयोग गर्नुहोस्" 7696 7697 #: kdecore/kcmdlineargs.cpp:311 7698 #, kde-format 7699 msgid "Use 'icon' as the application icon" 7700 msgstr "अनुप्रयोग प्रतिमाको रूपमा 'प्रतिमा' प्रयोग गर्नुहोस्" 7701 7702 #: kdecore/kcmdlineargs.cpp:312 7703 #, kde-format 7704 msgid "Use alternative configuration file" 7705 msgstr "वैकल्पिक कन्फिगरेसन फाइल प्रयोग गर्नुहोस्" 7706 7707 #: kdecore/kcmdlineargs.cpp:313 7708 #, kde-format 7709 msgid "Disable crash handler, to get core dumps" 7710 msgstr "कोर डम्प प्राप्त गर्न, क्र्यास ह्यान्डलर अक्षम पार्नुहोस्" 7711 7712 #: kdecore/kcmdlineargs.cpp:315 7713 #, kde-format 7714 msgid "Waits for a WM_NET compatible windowmanager" 7715 msgstr "WM_NET मिल्दो विन्डोज प्रबन्धकका लागि प्रतिक्षा गर्दछ" 7716 7717 #: kdecore/kcmdlineargs.cpp:317 7718 #, kde-format 7719 msgid "sets the application GUI style" 7720 msgstr "अनुप्रयोग GUI शैली सेट गर्दछ" 7721 7722 #: kdecore/kcmdlineargs.cpp:318 7723 #, fuzzy, kde-format 7724 #| msgid "" 7725 #| "sets the client geometry of the main widget - see man X for the argument " 7726 #| "format" 7727 msgid "" 7728 "sets the client geometry of the main widget - see man X for the argument " 7729 "format (usually WidthxHeight+XPos+YPos)" 7730 msgstr "मुख्य विजेटको क्लाइन्ट ज्यामिति सेट गर्दछ - तर्क ढाँचाका लागि man X हेर्नुहोस्" 7731 7732 #: kdecore/kcmdlineargs.cpp:436 7733 #, kde-format 7734 msgid "KDE Application" 7735 msgstr "केडीई अनुप्रयोग" 7736 7737 #: kdecore/kcmdlineargs.cpp:497 7738 #, kde-format 7739 msgid "Qt" 7740 msgstr "Qt" 7741 7742 #: kdecore/kcmdlineargs.cpp:500 7743 #, kde-format 7744 msgid "KDE" 7745 msgstr "केडीई" 7746 7747 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7748 #, fuzzy, kde-format 7749 #| msgid "ERROR: Unknown protocol '%1'" 7750 msgid "Unknown option '%1'." 7751 msgstr "त्रुटि: अज्ञात प्रोटोकल '%1'" 7752 7753 #: kdecore/kcmdlineargs.cpp:841 7754 #, kde-format 7755 msgctxt "@info:shell %1 is cmdoption name" 7756 msgid "'%1' missing." 7757 msgstr "'%1' हराइरेहको छ ।" 7758 7759 #: kdecore/kcmdlineargs.cpp:895 7760 #, kde-format 7761 msgctxt "" 7762 "@info:shell message on appcmd --version; do not translate 'Development " 7763 "Platform'%3 application name, other %n version strings" 7764 msgid "" 7765 "Qt: %1\n" 7766 "KDE Frameworks: %2\n" 7767 "%3: %4\n" 7768 msgstr "" 7769 7770 #: kdecore/kcmdlineargs.cpp:921 7771 #, kde-format 7772 msgctxt "the 2nd argument is a list of name+address, one on each line" 7773 msgid "" 7774 "%1 was written by\n" 7775 "%2" 7776 msgstr "" 7777 "%1 लाई\n" 7778 "%2 द्वारा लेखियो" 7779 7780 #: kdecore/kcmdlineargs.cpp:924 7781 #, kde-format 7782 msgid "This application was written by somebody who wants to remain anonymous." 7783 msgstr "" 7784 7785 #: kdecore/kcmdlineargs.cpp:929 7786 #, kde-format 7787 msgid "Please use http://bugs.kde.org to report bugs.\n" 7788 msgstr "" 7789 7790 #: kdecore/kcmdlineargs.cpp:931 7791 #, kde-format 7792 msgid "Please report bugs to %1.\n" 7793 msgstr "" 7794 7795 #: kdecore/kcmdlineargs.cpp:961 7796 #, kde-format 7797 msgid "Unexpected argument '%1'." 7798 msgstr "" 7799 7800 #: kdecore/kcmdlineargs.cpp:1074 7801 #, kde-format 7802 msgid "Use --help to get a list of available command line options." 7803 msgstr "" 7804 7805 #: kdecore/kcmdlineargs.cpp:1096 7806 #, kde-format 7807 msgid "[options] " 7808 msgstr "" 7809 7810 #: kdecore/kcmdlineargs.cpp:1101 7811 #, kde-format 7812 msgid "[%1-options]" 7813 msgstr "" 7814 7815 #: kdecore/kcmdlineargs.cpp:1122 7816 #, kde-format 7817 msgid "Usage: %1 %2\n" 7818 msgstr "" 7819 7820 #: kdecore/kcmdlineargs.cpp:1125 7821 #, kde-format 7822 msgid "" 7823 "\n" 7824 "Generic options:\n" 7825 msgstr "" 7826 7827 #: kdecore/kcmdlineargs.cpp:1127 7828 #, kde-format 7829 msgid "Show help about options" 7830 msgstr "" 7831 7832 #: kdecore/kcmdlineargs.cpp:1133 7833 #, kde-format 7834 msgid "Show %1 specific options" 7835 msgstr "" 7836 7837 #: kdecore/kcmdlineargs.cpp:1140 7838 #, kde-format 7839 msgid "Show all options" 7840 msgstr "" 7841 7842 #: kdecore/kcmdlineargs.cpp:1141 7843 #, kde-format 7844 msgid "Show author information" 7845 msgstr "" 7846 7847 #: kdecore/kcmdlineargs.cpp:1142 7848 #, kde-format 7849 msgid "Show version information" 7850 msgstr "" 7851 7852 #: kdecore/kcmdlineargs.cpp:1143 7853 #, kde-format 7854 msgid "Show license information" 7855 msgstr "" 7856 7857 #: kdecore/kcmdlineargs.cpp:1144 7858 #, kde-format 7859 msgid "End of options" 7860 msgstr "" 7861 7862 #: kdecore/kcmdlineargs.cpp:1164 7863 #, kde-format 7864 msgid "" 7865 "\n" 7866 "%1 options:\n" 7867 msgstr "" 7868 7869 #: kdecore/kcmdlineargs.cpp:1166 7870 #, kde-format 7871 msgid "" 7872 "\n" 7873 "Options:\n" 7874 msgstr "" 7875 7876 #: kdecore/kcmdlineargs.cpp:1219 7877 #, kde-format 7878 msgid "" 7879 "\n" 7880 "Arguments:\n" 7881 msgstr "" 7882 7883 #: kdecore/kcmdlineargs.cpp:1580 7884 #, kde-format 7885 msgid "The files/URLs opened by the application will be deleted after use" 7886 msgstr "अनप्रयोगद्वारा खोलिएका फाइल/यूआरएल प्रयोग पछि मेटिन्छन्" 7887 7888 #: kdecore/kcmdlineargs.cpp:1581 7889 #, kde-format 7890 msgid "KDE-tempfile" 7891 msgstr "केडीई अस्थायी फाइल" 7892 7893 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7894 #: kdecore/kdatetime.cpp:2985 7895 #, fuzzy, kde-format 7896 msgid "am" 7897 msgstr "पूर्वान्ह" 7898 7899 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7900 #: kdecore/kdatetime.cpp:2990 7901 #, kde-format 7902 msgid "pm" 7903 msgstr "अपरान्ह" 7904 7905 #: kdecore/klibloader.cpp:100 7906 #, fuzzy, kde-format 7907 #| msgid "Library not found" 7908 msgid "Library \"%1\" not found" 7909 msgstr "लाइब्रेरी फेला परेन" 7910 7911 #: kdecore/klocale_kde.cpp:785 7912 #, fuzzy, kde-format 7913 #| msgctxt "@item Text character set" 7914 #| msgid "Arabic" 7915 msgctxt "digit set" 7916 msgid "Arabic-Indic" 7917 msgstr "अरबी" 7918 7919 #: kdecore/klocale_kde.cpp:788 7920 #, fuzzy, kde-format 7921 #| msgctxt "KCharselect unicode block name" 7922 #| msgid "Bengali" 7923 msgctxt "digit set" 7924 msgid "Bengali" 7925 msgstr "बङ्गाली" 7926 7927 #: kdecore/klocale_kde.cpp:791 7928 #, fuzzy, kde-format 7929 #| msgctxt "KCharselect unicode block name" 7930 #| msgid "Devanagari" 7931 msgctxt "digit set" 7932 msgid "Devanagari" 7933 msgstr "देवनागरी" 7934 7935 #: kdecore/klocale_kde.cpp:794 7936 #, kde-format 7937 msgctxt "digit set" 7938 msgid "Eastern Arabic-Indic" 7939 msgstr "" 7940 7941 #: kdecore/klocale_kde.cpp:797 7942 #, fuzzy, kde-format 7943 #| msgctxt "KCharselect unicode block name" 7944 #| msgid "Gujarati" 7945 msgctxt "digit set" 7946 msgid "Gujarati" 7947 msgstr "गुजराती" 7948 7949 #: kdecore/klocale_kde.cpp:800 7950 #, fuzzy, kde-format 7951 #| msgctxt "KCharselect unicode block name" 7952 #| msgid "Gurmukhi" 7953 msgctxt "digit set" 7954 msgid "Gurmukhi" 7955 msgstr "गुर्मुखी" 7956 7957 #: kdecore/klocale_kde.cpp:803 7958 #, fuzzy, kde-format 7959 #| msgctxt "KCharselect unicode block name" 7960 #| msgid "Kannada" 7961 msgctxt "digit set" 7962 msgid "Kannada" 7963 msgstr "कन्नाडा" 7964 7965 #: kdecore/klocale_kde.cpp:806 7966 #, fuzzy, kde-format 7967 #| msgctxt "KCharselect unicode block name" 7968 #| msgid "Khmer" 7969 msgctxt "digit set" 7970 msgid "Khmer" 7971 msgstr "खमेर" 7972 7973 #: kdecore/klocale_kde.cpp:809 7974 #, fuzzy, kde-format 7975 #| msgctxt "KCharselect unicode block name" 7976 #| msgid "Malayalam" 7977 msgctxt "digit set" 7978 msgid "Malayalam" 7979 msgstr "मलयालम" 7980 7981 #: kdecore/klocale_kde.cpp:812 7982 #, fuzzy, kde-format 7983 #| msgctxt "KCharselect unicode block name" 7984 #| msgid "Oriya" 7985 msgctxt "digit set" 7986 msgid "Oriya" 7987 msgstr "ओरिया" 7988 7989 #: kdecore/klocale_kde.cpp:815 7990 #, fuzzy, kde-format 7991 #| msgctxt "KCharselect unicode block name" 7992 #| msgid "Tamil" 7993 msgctxt "digit set" 7994 msgid "Tamil" 7995 msgstr "तामिल" 7996 7997 #: kdecore/klocale_kde.cpp:818 7998 #, fuzzy, kde-format 7999 #| msgctxt "KCharselect unicode block name" 8000 #| msgid "Telugu" 8001 msgctxt "digit set" 8002 msgid "Telugu" 8003 msgstr "तेलगु" 8004 8005 #: kdecore/klocale_kde.cpp:821 8006 #, fuzzy, kde-format 8007 #| msgid "R. Thaani" 8008 msgctxt "digit set" 8009 msgid "Thai" 8010 msgstr "आर. थानी" 8011 8012 #: kdecore/klocale_kde.cpp:824 8013 #, fuzzy, kde-format 8014 #| msgctxt "@item Text character set" 8015 #| msgid "Arabic" 8016 msgctxt "digit set" 8017 msgid "Arabic" 8018 msgstr "अरबी" 8019 8020 #: kdecore/klocale_kde.cpp:829 8021 #, fuzzy, kde-format 8022 #| msgctxt "dictionary name. %1-language and %2-country name" 8023 #| msgid "%1 (%2)" 8024 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8025 msgid "%1 (%2)" 8026 msgstr "%1 (%2)" 8027 8028 #. i18n: comments below, they are used by the 8029 #. translators. 8030 #. This prefix is shared by all current dialects. 8031 #. i18n: Dumb message, avoid any markup or scripting. 8032 #: kdecore/klocale_kde.cpp:1327 8033 #, fuzzy, kde-format 8034 #| msgid "%1 B" 8035 msgctxt "size in bytes" 8036 msgid "%1 B" 8037 msgstr "%1 B" 8038 8039 #. i18n: Dumb message, avoid any markup or scripting. 8040 #: kdecore/klocale_kde.cpp:1332 8041 #, fuzzy, kde-format 8042 #| msgid "%1 B" 8043 msgctxt "size in 1000 bytes" 8044 msgid "%1 kB" 8045 msgstr "%1 B" 8046 8047 #. i18n: Dumb message, avoid any markup or scripting. 8048 #: kdecore/klocale_kde.cpp:1334 8049 #, fuzzy, kde-format 8050 #| msgid "%1 MiB" 8051 msgctxt "size in 10^6 bytes" 8052 msgid "%1 MB" 8053 msgstr "%1 MiB" 8054 8055 #. i18n: Dumb message, avoid any markup or scripting. 8056 #: kdecore/klocale_kde.cpp:1336 8057 #, fuzzy, kde-format 8058 #| msgid "%1 GiB" 8059 msgctxt "size in 10^9 bytes" 8060 msgid "%1 GB" 8061 msgstr "%1 GiB" 8062 8063 #. i18n: Dumb message, avoid any markup or scripting. 8064 #: kdecore/klocale_kde.cpp:1338 8065 #, fuzzy, kde-format 8066 #| msgid "%1 TiB" 8067 msgctxt "size in 10^12 bytes" 8068 msgid "%1 TB" 8069 msgstr "%1 TiB" 8070 8071 #. i18n: Dumb message, avoid any markup or scripting. 8072 #: kdecore/klocale_kde.cpp:1340 8073 #, fuzzy, kde-format 8074 #| msgid "%1 B" 8075 msgctxt "size in 10^15 bytes" 8076 msgid "%1 PB" 8077 msgstr "%1 B" 8078 8079 #. i18n: Dumb message, avoid any markup or scripting. 8080 #: kdecore/klocale_kde.cpp:1342 8081 #, fuzzy, kde-format 8082 #| msgid "%1 B" 8083 msgctxt "size in 10^18 bytes" 8084 msgid "%1 EB" 8085 msgstr "%1 B" 8086 8087 #. i18n: Dumb message, avoid any markup or scripting. 8088 #: kdecore/klocale_kde.cpp:1344 8089 #, fuzzy, kde-format 8090 #| msgid "%1 B" 8091 msgctxt "size in 10^21 bytes" 8092 msgid "%1 ZB" 8093 msgstr "%1 B" 8094 8095 #. i18n: Dumb message, avoid any markup or scripting. 8096 #: kdecore/klocale_kde.cpp:1346 8097 #, fuzzy, kde-format 8098 #| msgid "%1 B" 8099 msgctxt "size in 10^24 bytes" 8100 msgid "%1 YB" 8101 msgstr "%1 B" 8102 8103 #. i18n: Dumb message, avoid any markup or scripting. 8104 #: kdecore/klocale_kde.cpp:1351 8105 #, fuzzy, kde-format 8106 #| msgid "%1 KiB" 8107 msgctxt "memory size in 1024 bytes" 8108 msgid "%1 KB" 8109 msgstr "%1 KiB" 8110 8111 #. i18n: Dumb message, avoid any markup or scripting. 8112 #: kdecore/klocale_kde.cpp:1353 8113 #, fuzzy, kde-format 8114 #| msgid "%1 MiB" 8115 msgctxt "memory size in 2^20 bytes" 8116 msgid "%1 MB" 8117 msgstr "%1 MiB" 8118 8119 #. i18n: Dumb message, avoid any markup or scripting. 8120 #: kdecore/klocale_kde.cpp:1355 8121 #, fuzzy, kde-format 8122 #| msgid "%1 GiB" 8123 msgctxt "memory size in 2^30 bytes" 8124 msgid "%1 GB" 8125 msgstr "%1 GiB" 8126 8127 #. i18n: Dumb message, avoid any markup or scripting. 8128 #: kdecore/klocale_kde.cpp:1357 8129 #, fuzzy, kde-format 8130 #| msgid "%1 TiB" 8131 msgctxt "memory size in 2^40 bytes" 8132 msgid "%1 TB" 8133 msgstr "%1 TiB" 8134 8135 #. i18n: Dumb message, avoid any markup or scripting. 8136 #: kdecore/klocale_kde.cpp:1359 8137 #, fuzzy, kde-format 8138 #| msgid "%1 B" 8139 msgctxt "memory size in 2^50 bytes" 8140 msgid "%1 PB" 8141 msgstr "%1 B" 8142 8143 #. i18n: Dumb message, avoid any markup or scripting. 8144 #: kdecore/klocale_kde.cpp:1361 8145 #, fuzzy, kde-format 8146 #| msgid "%1 B" 8147 msgctxt "memory size in 2^60 bytes" 8148 msgid "%1 EB" 8149 msgstr "%1 B" 8150 8151 #. i18n: Dumb message, avoid any markup or scripting. 8152 #: kdecore/klocale_kde.cpp:1363 8153 #, fuzzy, kde-format 8154 #| msgid "%1 B" 8155 msgctxt "memory size in 2^70 bytes" 8156 msgid "%1 ZB" 8157 msgstr "%1 B" 8158 8159 #. i18n: Dumb message, avoid any markup or scripting. 8160 #: kdecore/klocale_kde.cpp:1365 8161 #, fuzzy, kde-format 8162 #| msgid "%1 B" 8163 msgctxt "memory size in 2^80 bytes" 8164 msgid "%1 YB" 8165 msgstr "%1 B" 8166 8167 #. i18n: Dumb message, avoid any markup or scripting. 8168 #: kdecore/klocale_kde.cpp:1371 8169 #, fuzzy, kde-format 8170 #| msgid "%1 KiB" 8171 msgctxt "size in 1024 bytes" 8172 msgid "%1 KiB" 8173 msgstr "%1 KiB" 8174 8175 #. i18n: Dumb message, avoid any markup or scripting. 8176 #: kdecore/klocale_kde.cpp:1373 8177 #, fuzzy, kde-format 8178 #| msgid "%1 MiB" 8179 msgctxt "size in 2^20 bytes" 8180 msgid "%1 MiB" 8181 msgstr "%1 MiB" 8182 8183 #. i18n: Dumb message, avoid any markup or scripting. 8184 #: kdecore/klocale_kde.cpp:1375 8185 #, fuzzy, kde-format 8186 #| msgid "%1 GiB" 8187 msgctxt "size in 2^30 bytes" 8188 msgid "%1 GiB" 8189 msgstr "%1 GiB" 8190 8191 #. i18n: Dumb message, avoid any markup or scripting. 8192 #: kdecore/klocale_kde.cpp:1377 8193 #, fuzzy, kde-format 8194 #| msgid "%1 TiB" 8195 msgctxt "size in 2^40 bytes" 8196 msgid "%1 TiB" 8197 msgstr "%1 TiB" 8198 8199 #. i18n: Dumb message, avoid any markup or scripting. 8200 #: kdecore/klocale_kde.cpp:1379 8201 #, fuzzy, kde-format 8202 #| msgid "%1 TiB" 8203 msgctxt "size in 2^50 bytes" 8204 msgid "%1 PiB" 8205 msgstr "%1 TiB" 8206 8207 #. i18n: Dumb message, avoid any markup or scripting. 8208 #: kdecore/klocale_kde.cpp:1381 8209 #, fuzzy, kde-format 8210 #| msgid "%1 TiB" 8211 msgctxt "size in 2^60 bytes" 8212 msgid "%1 EiB" 8213 msgstr "%1 TiB" 8214 8215 #. i18n: Dumb message, avoid any markup or scripting. 8216 #: kdecore/klocale_kde.cpp:1383 8217 #, fuzzy, kde-format 8218 #| msgid "%1 TiB" 8219 msgctxt "size in 2^70 bytes" 8220 msgid "%1 ZiB" 8221 msgstr "%1 TiB" 8222 8223 #. i18n: Dumb message, avoid any markup or scripting. 8224 #: kdecore/klocale_kde.cpp:1385 8225 #, fuzzy, kde-format 8226 #| msgid "%1 TiB" 8227 msgctxt "size in 2^80 bytes" 8228 msgid "%1 YiB" 8229 msgstr "%1 TiB" 8230 8231 #: kdecore/klocale_kde.cpp:1472 8232 #, fuzzy, kde-format 8233 #| msgid "%1 days" 8234 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8235 msgid "%1 days" 8236 msgstr "%1 दिन" 8237 8238 #: kdecore/klocale_kde.cpp:1475 8239 #, fuzzy, kde-format 8240 #| msgid "%1 hours" 8241 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8242 msgid "%1 hours" 8243 msgstr "%1 घण्टा" 8244 8245 #: kdecore/klocale_kde.cpp:1478 8246 #, fuzzy, kde-format 8247 #| msgid "%1 minutes" 8248 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8249 msgid "%1 minutes" 8250 msgstr "%1 मिनेट" 8251 8252 #: kdecore/klocale_kde.cpp:1481 8253 #, fuzzy, kde-format 8254 #| msgid "%1 seconds" 8255 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8256 msgid "%1 seconds" 8257 msgstr "%1 सेकेन्ड" 8258 8259 #: kdecore/klocale_kde.cpp:1484 8260 #, kde-format 8261 msgctxt "@item:intext" 8262 msgid "%1 millisecond" 8263 msgid_plural "%1 milliseconds" 8264 msgstr[0] "" 8265 msgstr[1] "" 8266 8267 #: kdecore/klocale_kde.cpp:1491 8268 #, kde-format 8269 msgctxt "@item:intext" 8270 msgid "1 day" 8271 msgid_plural "%1 days" 8272 msgstr[0] "" 8273 msgstr[1] "" 8274 8275 #: kdecore/klocale_kde.cpp:1493 8276 #, kde-format 8277 msgctxt "@item:intext" 8278 msgid "1 hour" 8279 msgid_plural "%1 hours" 8280 msgstr[0] "" 8281 msgstr[1] "" 8282 8283 #: kdecore/klocale_kde.cpp:1495 8284 #, kde-format 8285 msgctxt "@item:intext" 8286 msgid "1 minute" 8287 msgid_plural "%1 minutes" 8288 msgstr[0] "" 8289 msgstr[1] "" 8290 8291 #: kdecore/klocale_kde.cpp:1497 8292 #, kde-format 8293 msgctxt "@item:intext" 8294 msgid "1 second" 8295 msgid_plural "%1 seconds" 8296 msgstr[0] "" 8297 msgstr[1] "" 8298 8299 #: kdecore/klocale_kde.cpp:1521 8300 #, fuzzy, kde-format 8301 #| msgctxt "concatenation of dates and time" 8302 #| msgid "%1 %2" 8303 msgctxt "" 8304 "@item:intext days and hours. This uses the previous item:intext messages. If " 8305 "this does not fit the grammar of your language please contact the i18n team " 8306 "to solve the problem" 8307 msgid "%1 and %2" 8308 msgstr "%1 %2" 8309 8310 #: kdecore/klocale_kde.cpp:1527 8311 #, fuzzy, kde-format 8312 #| msgctxt "concatenation of dates and time" 8313 #| msgid "%1 %2" 8314 msgctxt "" 8315 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8316 "If this does not fit the grammar of your language please contact the i18n " 8317 "team to solve the problem" 8318 msgid "%1 and %2" 8319 msgstr "%1 %2" 8320 8321 #: kdecore/klocale_kde.cpp:1534 8322 #, fuzzy, kde-format 8323 #| msgctxt "concatenation of dates and time" 8324 #| msgid "%1 %2" 8325 msgctxt "" 8326 "@item:intext minutes and seconds. This uses the previous item:intext " 8327 "messages. If this does not fit the grammar of your language please contact " 8328 "the i18n team to solve the problem" 8329 msgid "%1 and %2" 8330 msgstr "%1 %2" 8331 8332 #: kdecore/klocale_kde.cpp:2153 8333 #, kde-format 8334 msgctxt "Before Noon KLocale::LongName" 8335 msgid "Ante Meridiem" 8336 msgstr "" 8337 8338 #: kdecore/klocale_kde.cpp:2154 8339 #, fuzzy, kde-format 8340 #| msgid "Av" 8341 msgctxt "Before Noon KLocale::ShortName" 8342 msgid "AM" 8343 msgstr "एभ" 8344 8345 #: kdecore/klocale_kde.cpp:2155 8346 #, fuzzy, kde-format 8347 #| msgid "Av" 8348 msgctxt "Before Noon KLocale::NarrowName" 8349 msgid "A" 8350 msgstr "एभ" 8351 8352 #: kdecore/klocale_kde.cpp:2158 8353 #, kde-format 8354 msgctxt "After Noon KLocale::LongName" 8355 msgid "Post Meridiem" 8356 msgstr "" 8357 8358 #: kdecore/klocale_kde.cpp:2159 8359 #, kde-format 8360 msgctxt "After Noon KLocale::ShortName" 8361 msgid "PM" 8362 msgstr "" 8363 8364 #: kdecore/klocale_kde.cpp:2160 8365 #, kde-format 8366 msgctxt "After Noon KLocale::NarrowName" 8367 msgid "P" 8368 msgstr "" 8369 8370 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8371 #, kde-format 8372 msgctxt "concatenation of dates and time" 8373 msgid "%1 %2" 8374 msgstr "%1 %2" 8375 8376 #: kdecore/klocale_kde.cpp:2267 8377 #, kde-format 8378 msgctxt "concatenation of date/time and time zone" 8379 msgid "%1 %2" 8380 msgstr "%1 %2" 8381 8382 #: kdecore/ksavefile.cpp:99 8383 #, kde-format 8384 msgid "No target filename has been given." 8385 msgstr "" 8386 8387 #: kdecore/ksavefile.cpp:106 8388 #, kde-format 8389 msgid "Already opened." 8390 msgstr "" 8391 8392 #: kdecore/ksavefile.cpp:135 8393 #, kde-format 8394 msgid "Insufficient permissions in target directory." 8395 msgstr "" 8396 8397 #: kdecore/ksavefile.cpp:139 8398 #, kde-format 8399 msgid "Unable to open temporary file." 8400 msgstr "" 8401 8402 #: kdecore/ksavefile.cpp:249 8403 #, kde-format 8404 msgid "Synchronization to disk failed" 8405 msgstr "" 8406 8407 #: kdecore/ksavefile.cpp:280 8408 #, kde-format 8409 msgid "Error during rename." 8410 msgstr "" 8411 8412 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8413 #, kde-format 8414 msgid "Timed out trying to connect to remote host" 8415 msgstr "टाढाको होस्टमा जडान गर्ने प्रयास गर्दा समय म्याद समाप्त" 8416 8417 #: kdecore/netsupp.cpp:866 8418 #, kde-format 8419 msgid "address family for nodename not supported" 8420 msgstr "नोडनामका लागि ठेगाना परिवार समर्थन गर्दैन" 8421 8422 #: kdecore/netsupp.cpp:868 8423 #, kde-format 8424 msgid "invalid value for 'ai_flags'" 8425 msgstr "'ai_flags' का लागि अवैध मान" 8426 8427 #: kdecore/netsupp.cpp:870 8428 #, kde-format 8429 msgid "'ai_family' not supported" 8430 msgstr "'ai_family' समर्थन गर्दैन" 8431 8432 #: kdecore/netsupp.cpp:872 8433 #, kde-format 8434 msgid "no address associated with nodename" 8435 msgstr "नोडनामसँग ठेगाना सम्बन्धित छैन" 8436 8437 #: kdecore/netsupp.cpp:874 8438 #, kde-format 8439 msgid "servname not supported for ai_socktype" 8440 msgstr "ai_socktype का लागि सर्भरनाम समर्थन गर्दैन" 8441 8442 #: kdecore/netsupp.cpp:875 8443 #, kde-format 8444 msgid "'ai_socktype' not supported" 8445 msgstr "'ai_socktype' समर्थित छैन" 8446 8447 #: kdecore/netsupp.cpp:876 8448 #, kde-format 8449 msgid "system error" 8450 msgstr "प्रणाली त्रुटि" 8451 8452 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8453 #, kde-format 8454 msgid "KDE Test Program" 8455 msgstr "" 8456 8457 #: kdecore/TIMEZONES:1 8458 #, kde-format 8459 msgid "Africa/Abidjan" 8460 msgstr "अफ्रिका/अबिद्जन" 8461 8462 #: kdecore/TIMEZONES:2 8463 #, kde-format 8464 msgid "Africa/Accra" 8465 msgstr "अफ्रिका/आक्रा" 8466 8467 #: kdecore/TIMEZONES:3 8468 #, kde-format 8469 msgid "Africa/Addis_Ababa" 8470 msgstr "अफ्रिका/एडिडस अब्बा" 8471 8472 #: kdecore/TIMEZONES:4 8473 #, kde-format 8474 msgid "Africa/Algiers" 8475 msgstr "अफ्रिका/अल्जेरियस" 8476 8477 #: kdecore/TIMEZONES:5 8478 #, fuzzy, kde-format 8479 #| msgid "Africa/Asmera" 8480 msgid "Africa/Asmara" 8481 msgstr "अफ्रिका/आसमेरा" 8482 8483 #: kdecore/TIMEZONES:6 8484 #, kde-format 8485 msgid "Africa/Asmera" 8486 msgstr "अफ्रिका/आसमेरा" 8487 8488 #: kdecore/TIMEZONES:7 8489 #, kde-format 8490 msgid "Africa/Bamako" 8491 msgstr "अफ्रिका/बामाको" 8492 8493 #: kdecore/TIMEZONES:8 8494 #, kde-format 8495 msgid "Africa/Bangui" 8496 msgstr "अफ्रिका/बानगुइस" 8497 8498 #: kdecore/TIMEZONES:9 8499 #, kde-format 8500 msgid "Africa/Banjul" 8501 msgstr "अफ्रिका/बानजुल" 8502 8503 #: kdecore/TIMEZONES:10 8504 #, kde-format 8505 msgid "Africa/Bissau" 8506 msgstr "अफ्रिका/बिस्साउ" 8507 8508 #: kdecore/TIMEZONES:11 8509 #, kde-format 8510 msgid "Africa/Blantyre" 8511 msgstr "अफ्रिका/ब्लानटाएर" 8512 8513 #: kdecore/TIMEZONES:12 8514 #, kde-format 8515 msgid "Africa/Brazzaville" 8516 msgstr "अफ्रिका/ब्राज्जाविले" 8517 8518 #: kdecore/TIMEZONES:13 8519 #, kde-format 8520 msgid "Africa/Bujumbura" 8521 msgstr "अफ्रिका/बुजुम्बुरा" 8522 8523 #: kdecore/TIMEZONES:14 8524 #, kde-format 8525 msgid "Africa/Cairo" 8526 msgstr "अफ्रिका/कायरो" 8527 8528 #: kdecore/TIMEZONES:15 8529 #, kde-format 8530 msgid "Africa/Casablanca" 8531 msgstr "अफ्रिका/क्यासाब्लान्का" 8532 8533 #: kdecore/TIMEZONES:16 8534 #, kde-format 8535 msgid "Africa/Ceuta" 8536 msgstr "अफ्रिका/क्योटा" 8537 8538 #. i18n: comment to the previous timezone 8539 #: kdecore/TIMEZONES:18 8540 #, kde-format 8541 msgid "Ceuta & Melilla" 8542 msgstr "" 8543 8544 #. i18n: comment to the previous timezone 8545 #: kdecore/TIMEZONES:20 8546 #, kde-format 8547 msgid "Ceuta, Melilla" 8548 msgstr "" 8549 8550 #: kdecore/TIMEZONES:21 8551 #, kde-format 8552 msgid "Africa/Conakry" 8553 msgstr "अफ्रिका/कोनाक्रि" 8554 8555 #: kdecore/TIMEZONES:22 8556 #, kde-format 8557 msgid "Africa/Dakar" 8558 msgstr "अफ्रिका/डकार" 8559 8560 #: kdecore/TIMEZONES:23 8561 #, kde-format 8562 msgid "Africa/Dar_es_Salaam" 8563 msgstr "फ्रिका/दारेसलाम" 8564 8565 #: kdecore/TIMEZONES:24 8566 #, kde-format 8567 msgid "Africa/Djibouti" 8568 msgstr "अफ्रिका/द्जिबौटी" 8569 8570 #: kdecore/TIMEZONES:25 8571 #, kde-format 8572 msgid "Africa/Douala" 8573 msgstr "अफ्रिका/दोउआला" 8574 8575 #: kdecore/TIMEZONES:26 8576 #, kde-format 8577 msgid "Africa/El_Aaiun" 8578 msgstr "अफ्रिका/एलाइउन" 8579 8580 #: kdecore/TIMEZONES:27 8581 #, kde-format 8582 msgid "Africa/Freetown" 8583 msgstr "अफ्रिका/फ्रिटाउन" 8584 8585 #: kdecore/TIMEZONES:28 8586 #, kde-format 8587 msgid "Africa/Gaborone" 8588 msgstr "अफ्रिका/गाबोरोन" 8589 8590 #: kdecore/TIMEZONES:29 8591 #, kde-format 8592 msgid "Africa/Harare" 8593 msgstr "अफ्रिका/हरारे" 8594 8595 #: kdecore/TIMEZONES:30 8596 #, kde-format 8597 msgid "Africa/Johannesburg" 8598 msgstr "अफ्रिका/जोहान्सबर्ग" 8599 8600 #: kdecore/TIMEZONES:31 8601 #, fuzzy, kde-format 8602 #| msgid "Africa/Ceuta" 8603 msgid "Africa/Juba" 8604 msgstr "अफ्रिका/क्योटा" 8605 8606 #: kdecore/TIMEZONES:32 8607 #, kde-format 8608 msgid "Africa/Kampala" 8609 msgstr "अफ्रिका/काम्पाला" 8610 8611 #: kdecore/TIMEZONES:33 8612 #, kde-format 8613 msgid "Africa/Khartoum" 8614 msgstr "अफ्रिका/खारतुम" 8615 8616 #: kdecore/TIMEZONES:34 8617 #, kde-format 8618 msgid "Africa/Kigali" 8619 msgstr "अफ्रिका/किगालि" 8620 8621 #: kdecore/TIMEZONES:35 8622 #, kde-format 8623 msgid "Africa/Kinshasa" 8624 msgstr "अफ्रिका/किनशसा" 8625 8626 #. i18n: comment to the previous timezone 8627 #: kdecore/TIMEZONES:37 8628 #, kde-format 8629 msgid "west Dem. Rep. of Congo" 8630 msgstr "" 8631 8632 #. i18n: comment to the previous timezone 8633 #: kdecore/TIMEZONES:39 8634 #, kde-format 8635 msgid "Dem. Rep. of Congo (west)" 8636 msgstr "" 8637 8638 #: kdecore/TIMEZONES:40 8639 #, kde-format 8640 msgid "Africa/Lagos" 8641 msgstr "अफ्रिका/लागोस" 8642 8643 #: kdecore/TIMEZONES:41 8644 #, kde-format 8645 msgid "Africa/Libreville" 8646 msgstr "अफ्रिका/लिब्रेविल्ले" 8647 8648 #: kdecore/TIMEZONES:42 8649 #, kde-format 8650 msgid "Africa/Lome" 8651 msgstr "अफ्रिका/लोमे" 8652 8653 #: kdecore/TIMEZONES:43 8654 #, kde-format 8655 msgid "Africa/Luanda" 8656 msgstr "अफ्रिका/लुवान्डा" 8657 8658 #: kdecore/TIMEZONES:44 8659 #, kde-format 8660 msgid "Africa/Lubumbashi" 8661 msgstr "अफ्रिका/लुबुम्बाशि" 8662 8663 #. i18n: comment to the previous timezone 8664 #: kdecore/TIMEZONES:46 8665 #, kde-format 8666 msgid "east Dem. Rep. of Congo" 8667 msgstr "" 8668 8669 #. i18n: comment to the previous timezone 8670 #: kdecore/TIMEZONES:48 8671 #, kde-format 8672 msgid "Dem. Rep. of Congo (east)" 8673 msgstr "" 8674 8675 #: kdecore/TIMEZONES:49 8676 #, kde-format 8677 msgid "Africa/Lusaka" 8678 msgstr "अफ्रिका/लुसाका" 8679 8680 #: kdecore/TIMEZONES:50 8681 #, kde-format 8682 msgid "Africa/Malabo" 8683 msgstr "अफ्रिका/मालाबो" 8684 8685 #: kdecore/TIMEZONES:51 8686 #, kde-format 8687 msgid "Africa/Maputo" 8688 msgstr "अफ्रिका/मापुटो" 8689 8690 #: kdecore/TIMEZONES:52 8691 #, kde-format 8692 msgid "Africa/Maseru" 8693 msgstr "अफ्रिका/मासेरु" 8694 8695 #: kdecore/TIMEZONES:53 8696 #, kde-format 8697 msgid "Africa/Mbabane" 8698 msgstr "अफ्रिका/बाबाने" 8699 8700 #: kdecore/TIMEZONES:54 8701 #, kde-format 8702 msgid "Africa/Mogadishu" 8703 msgstr "अफ्रिका/मोगादिशु" 8704 8705 #: kdecore/TIMEZONES:55 8706 #, kde-format 8707 msgid "Africa/Monrovia" 8708 msgstr "अफ्रिका/मोन्रोभिया" 8709 8710 #: kdecore/TIMEZONES:56 8711 #, kde-format 8712 msgid "Africa/Nairobi" 8713 msgstr "अफ्रिका/नाइरोबी" 8714 8715 #: kdecore/TIMEZONES:57 8716 #, kde-format 8717 msgid "Africa/Ndjamena" 8718 msgstr "अफ्रिका/एनजामेना" 8719 8720 #: kdecore/TIMEZONES:58 8721 #, kde-format 8722 msgid "Africa/Niamey" 8723 msgstr "अफ्रिका/नियामे" 8724 8725 #: kdecore/TIMEZONES:59 8726 #, kde-format 8727 msgid "Africa/Nouakchott" 8728 msgstr "अफ्रिका/नोउक्चोट्" 8729 8730 #: kdecore/TIMEZONES:60 8731 #, kde-format 8732 msgid "Africa/Ouagadougou" 8733 msgstr "अफ्रिका/ओउआगडोऊगोऊ" 8734 8735 #: kdecore/TIMEZONES:61 8736 #, kde-format 8737 msgid "Africa/Porto-Novo" 8738 msgstr "अफ्रिका/पोर्टोनोभो" 8739 8740 #: kdecore/TIMEZONES:62 8741 #, fuzzy, kde-format 8742 #| msgid "Africa/Ceuta" 8743 msgid "Africa/Pretoria" 8744 msgstr "अफ्रिका/क्योटा" 8745 8746 #: kdecore/TIMEZONES:63 8747 #, kde-format 8748 msgid "Africa/Sao_Tome" 8749 msgstr "अफ्रिका/साओ-टोम" 8750 8751 #: kdecore/TIMEZONES:64 8752 #, kde-format 8753 msgid "Africa/Timbuktu" 8754 msgstr "अफ्रिका/टिम्बुक्टु" 8755 8756 #: kdecore/TIMEZONES:65 8757 #, kde-format 8758 msgid "Africa/Tripoli" 8759 msgstr "अफ्रिका/ट्रिपोली" 8760 8761 #: kdecore/TIMEZONES:66 8762 #, kde-format 8763 msgid "Africa/Tunis" 8764 msgstr "अफ्रिका/टुनिस्" 8765 8766 #: kdecore/TIMEZONES:67 8767 #, kde-format 8768 msgid "Africa/Windhoek" 8769 msgstr "अफ्रिका/विन्धोएक" 8770 8771 #: kdecore/TIMEZONES:68 8772 #, kde-format 8773 msgid "America/Adak" 8774 msgstr "अमेरिका/आदक" 8775 8776 #. i18n: comment to the previous timezone 8777 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8778 #, kde-format 8779 msgid "Aleutian Islands" 8780 msgstr "" 8781 8782 #: kdecore/TIMEZONES:71 8783 #, kde-format 8784 msgid "America/Anchorage" 8785 msgstr "अमेरिका/एङ्कोरेज" 8786 8787 #. i18n: comment to the previous timezone 8788 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8789 #, kde-format 8790 msgid "Alaska Time" 8791 msgstr "" 8792 8793 #. i18n: comment to the previous timezone 8794 #: kdecore/TIMEZONES:75 8795 #, kde-format 8796 msgid "Alaska (most areas)" 8797 msgstr "" 8798 8799 #: kdecore/TIMEZONES:76 8800 #, kde-format 8801 msgid "America/Anguilla" 8802 msgstr "अमेरिका/एन्जुइल्ला" 8803 8804 #: kdecore/TIMEZONES:77 8805 #, kde-format 8806 msgid "America/Antigua" 8807 msgstr "अमेरिका/एन्टिगुवा" 8808 8809 #: kdecore/TIMEZONES:78 8810 #, kde-format 8811 msgid "America/Araguaina" 8812 msgstr "अमेरिका/अरागुइना" 8813 8814 #. i18n: comment to the previous timezone 8815 #: kdecore/TIMEZONES:80 8816 #, kde-format 8817 msgid "Tocantins" 8818 msgstr "" 8819 8820 #: kdecore/TIMEZONES:81 8821 #, kde-format 8822 msgid "America/Argentina/Buenos_Aires" 8823 msgstr "अमेरिका/अर्जेन्टिना/बुएनोएरिस" 8824 8825 #. i18n: comment to the previous timezone 8826 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8827 #, kde-format 8828 msgid "Buenos Aires (BA, CF)" 8829 msgstr "" 8830 8831 #: kdecore/TIMEZONES:84 8832 #, kde-format 8833 msgid "America/Argentina/Catamarca" 8834 msgstr "अमेरिका/अर्जेन्टिना/क्याटामार्का" 8835 8836 #. i18n: comment to the previous timezone 8837 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8838 #, kde-format 8839 msgid "Catamarca (CT), Chubut (CH)" 8840 msgstr "" 8841 8842 #. i18n: comment to the previous timezone 8843 #: kdecore/TIMEZONES:88 8844 #, kde-format 8845 msgid "Catamarca (CT); Chubut (CH)" 8846 msgstr "" 8847 8848 #: kdecore/TIMEZONES:89 8849 #, kde-format 8850 msgid "America/Argentina/ComodRivadavia" 8851 msgstr "अमेरिका/अर्जेन्टिना/कोमोडरिभाडइया" 8852 8853 #: kdecore/TIMEZONES:92 8854 #, kde-format 8855 msgid "America/Argentina/Cordoba" 8856 msgstr "अमेरिका/अर्जेन्टिना/कोर्डोबा" 8857 8858 #. i18n: comment to the previous timezone 8859 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8860 #, kde-format 8861 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8862 msgstr "" 8863 8864 #. i18n: comment to the previous timezone 8865 #: kdecore/TIMEZONES:96 8866 #, kde-format 8867 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8868 msgstr "" 8869 8870 #. i18n: comment to the previous timezone 8871 #: kdecore/TIMEZONES:98 8872 #, kde-format 8873 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8874 msgstr "" 8875 8876 #: kdecore/TIMEZONES:99 8877 #, kde-format 8878 msgid "America/Argentina/Jujuy" 8879 msgstr "अमेरिका/अर्जेन्टिना/जुजुइ" 8880 8881 #. i18n: comment to the previous timezone 8882 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8883 #, kde-format 8884 msgid "Jujuy (JY)" 8885 msgstr "" 8886 8887 #: kdecore/TIMEZONES:102 8888 #, kde-format 8889 msgid "America/Argentina/La_Rioja" 8890 msgstr "अमेरिका/अर्जेन्टिना/लरियोजा" 8891 8892 #. i18n: comment to the previous timezone 8893 #: kdecore/TIMEZONES:104 8894 #, kde-format 8895 msgid "La Rioja (LR)" 8896 msgstr "" 8897 8898 #: kdecore/TIMEZONES:105 8899 #, kde-format 8900 msgid "America/Argentina/Mendoza" 8901 msgstr "अमेरिका/अर्जेन्टिना/मेन्डोजा" 8902 8903 #. i18n: comment to the previous timezone 8904 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8905 #, kde-format 8906 msgid "Mendoza (MZ)" 8907 msgstr "" 8908 8909 #: kdecore/TIMEZONES:108 8910 #, kde-format 8911 msgid "America/Argentina/Rio_Gallegos" 8912 msgstr "अमेरिका/अर्जेन्टिना/रियो ग्यालेगोस" 8913 8914 #. i18n: comment to the previous timezone 8915 #: kdecore/TIMEZONES:110 8916 #, kde-format 8917 msgid "Santa Cruz (SC)" 8918 msgstr "" 8919 8920 #: kdecore/TIMEZONES:111 8921 #, fuzzy, kde-format 8922 #| msgid "America/Argentina/San_Juan" 8923 msgid "America/Argentina/Salta" 8924 msgstr "अमेरिका/अर्जेन्टिना/सन्जुन" 8925 8926 #. i18n: comment to the previous timezone 8927 #: kdecore/TIMEZONES:113 8928 #, kde-format 8929 msgid "(SA, LP, NQ, RN)" 8930 msgstr "" 8931 8932 #. i18n: comment to the previous timezone 8933 #: kdecore/TIMEZONES:115 8934 #, kde-format 8935 msgid "Salta (SA, LP, NQ, RN)" 8936 msgstr "" 8937 8938 #: kdecore/TIMEZONES:116 8939 #, kde-format 8940 msgid "America/Argentina/San_Juan" 8941 msgstr "अमेरिका/अर्जेन्टिना/सन्जुन" 8942 8943 #. i18n: comment to the previous timezone 8944 #: kdecore/TIMEZONES:118 8945 #, kde-format 8946 msgid "San Juan (SJ)" 8947 msgstr "" 8948 8949 #: kdecore/TIMEZONES:119 8950 #, fuzzy, kde-format 8951 #| msgid "America/Argentina/San_Juan" 8952 msgid "America/Argentina/San_Luis" 8953 msgstr "अमेरिका/अर्जेन्टिना/सन्जुन" 8954 8955 #. i18n: comment to the previous timezone 8956 #: kdecore/TIMEZONES:121 8957 #, kde-format 8958 msgid "San Luis (SL)" 8959 msgstr "" 8960 8961 #: kdecore/TIMEZONES:122 8962 #, kde-format 8963 msgid "America/Argentina/Tucuman" 8964 msgstr "अमेरिका/अर्जेन्टिना/ट्युक्युम्यान" 8965 8966 #. i18n: comment to the previous timezone 8967 #: kdecore/TIMEZONES:124 8968 #, kde-format 8969 msgid "Tucuman (TM)" 8970 msgstr "" 8971 8972 #: kdecore/TIMEZONES:125 8973 #, kde-format 8974 msgid "America/Argentina/Ushuaia" 8975 msgstr "अमेरिका/अर्जेन्टिना/उसुइया" 8976 8977 #. i18n: comment to the previous timezone 8978 #: kdecore/TIMEZONES:127 8979 #, kde-format 8980 msgid "Tierra del Fuego (TF)" 8981 msgstr "" 8982 8983 #: kdecore/TIMEZONES:128 8984 #, kde-format 8985 msgid "America/Aruba" 8986 msgstr "अमेरिका/अरुबा" 8987 8988 #: kdecore/TIMEZONES:129 8989 #, kde-format 8990 msgid "America/Asuncion" 8991 msgstr "अमेरिका/एसुन्सिओन" 8992 8993 #: kdecore/TIMEZONES:130 8994 #, fuzzy, kde-format 8995 #| msgid "America/Antigua" 8996 msgid "America/Atikokan" 8997 msgstr "अमेरिका/एन्टिगुवा" 8998 8999 #. i18n: comment to the previous timezone 9000 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 9001 #, kde-format 9002 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 9003 msgstr "" 9004 9005 #. i18n: comment to the previous timezone 9006 #: kdecore/TIMEZONES:134 9007 #, kde-format 9008 msgid "EST - ON (Atikokan); NU (Coral H)" 9009 msgstr "" 9010 9011 #: kdecore/TIMEZONES:135 9012 #, fuzzy, kde-format 9013 #| msgid "America/Antigua" 9014 msgid "America/Atka" 9015 msgstr "अमेरिका/एन्टिगुवा" 9016 9017 #: kdecore/TIMEZONES:138 9018 #, kde-format 9019 msgid "America/Bahia" 9020 msgstr "अमेरिका/बहिया" 9021 9022 #. i18n: comment to the previous timezone 9023 #: kdecore/TIMEZONES:140 9024 #, kde-format 9025 msgid "Bahia" 9026 msgstr "" 9027 9028 #: kdecore/TIMEZONES:141 9029 #, fuzzy, kde-format 9030 #| msgid "America/Bahia" 9031 msgid "America/Bahia_Banderas" 9032 msgstr "अमेरिका/बहिया" 9033 9034 #. i18n: comment to the previous timezone 9035 #: kdecore/TIMEZONES:143 9036 #, kde-format 9037 msgid "Mexican Central Time - Bahia de Banderas" 9038 msgstr "" 9039 9040 #. i18n: comment to the previous timezone 9041 #: kdecore/TIMEZONES:145 9042 #, kde-format 9043 msgid "Central Time - Bahia de Banderas" 9044 msgstr "" 9045 9046 #: kdecore/TIMEZONES:146 9047 #, kde-format 9048 msgid "America/Barbados" 9049 msgstr "अमेरिका/बारबाडोस" 9050 9051 #: kdecore/TIMEZONES:147 9052 #, kde-format 9053 msgid "America/Belem" 9054 msgstr "अमेरिका/बेलेम" 9055 9056 #. i18n: comment to the previous timezone 9057 #: kdecore/TIMEZONES:149 9058 #, kde-format 9059 msgid "Amapa, E Para" 9060 msgstr "" 9061 9062 #. i18n: comment to the previous timezone 9063 #: kdecore/TIMEZONES:151 9064 #, kde-format 9065 msgid "Para (east); Amapa" 9066 msgstr "" 9067 9068 #: kdecore/TIMEZONES:152 9069 #, kde-format 9070 msgid "America/Belize" 9071 msgstr "अमेरिका/बेलिज" 9072 9073 #: kdecore/TIMEZONES:153 9074 #, fuzzy, kde-format 9075 #| msgid "America/Cancun" 9076 msgid "America/Blanc-Sablon" 9077 msgstr "अमेरिका/क्यानकुन" 9078 9079 #. i18n: comment to the previous timezone 9080 #: kdecore/TIMEZONES:155 9081 #, kde-format 9082 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9083 msgstr "" 9084 9085 #. i18n: comment to the previous timezone 9086 #: kdecore/TIMEZONES:157 9087 #, kde-format 9088 msgid "AST - QC (Lower North Shore)" 9089 msgstr "" 9090 9091 #: kdecore/TIMEZONES:158 9092 #, kde-format 9093 msgid "America/Boa_Vista" 9094 msgstr "अमेरिका/बोयँभिस्टा" 9095 9096 #. i18n: comment to the previous timezone 9097 #: kdecore/TIMEZONES:160 9098 #, kde-format 9099 msgid "Roraima" 9100 msgstr "" 9101 9102 #: kdecore/TIMEZONES:161 9103 #, kde-format 9104 msgid "America/Bogota" 9105 msgstr "अमेरिका/बोगोटा" 9106 9107 #: kdecore/TIMEZONES:162 9108 #, kde-format 9109 msgid "America/Boise" 9110 msgstr "अमेरिका/बोइसे" 9111 9112 #. i18n: comment to the previous timezone 9113 #: kdecore/TIMEZONES:164 9114 #, kde-format 9115 msgid "Mountain Time - south Idaho & east Oregon" 9116 msgstr "" 9117 9118 #. i18n: comment to the previous timezone 9119 #: kdecore/TIMEZONES:166 9120 #, kde-format 9121 msgid "Mountain - ID (south); OR (east)" 9122 msgstr "" 9123 9124 #: kdecore/TIMEZONES:167 9125 #, kde-format 9126 msgid "America/Buenos_Aires" 9127 msgstr "अमेरिका/ब्येनोसएरिज" 9128 9129 #: kdecore/TIMEZONES:170 9130 #, fuzzy, kde-format 9131 #| msgid "America/Cayman" 9132 msgid "America/Calgary" 9133 msgstr "अमेरिका/केम्यान" 9134 9135 #. i18n: comment to the previous timezone 9136 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9137 #, kde-format 9138 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9139 msgstr "" 9140 9141 #: kdecore/TIMEZONES:173 9142 #, kde-format 9143 msgid "America/Cambridge_Bay" 9144 msgstr "अमेरिका/क्याम्ब्रिजबे" 9145 9146 #. i18n: comment to the previous timezone 9147 #: kdecore/TIMEZONES:175 9148 #, kde-format 9149 msgid "Mountain Time - west Nunavut" 9150 msgstr "" 9151 9152 #. i18n: comment to the previous timezone 9153 #: kdecore/TIMEZONES:177 9154 #, kde-format 9155 msgid "Mountain - NU (west)" 9156 msgstr "" 9157 9158 #: kdecore/TIMEZONES:178 9159 #, kde-format 9160 msgid "America/Campo_Grande" 9161 msgstr "अमेरिका/कम्पोग्रेन्ड" 9162 9163 #. i18n: comment to the previous timezone 9164 #: kdecore/TIMEZONES:180 9165 #, kde-format 9166 msgid "Mato Grosso do Sul" 9167 msgstr "" 9168 9169 #: kdecore/TIMEZONES:181 9170 #, kde-format 9171 msgid "America/Cancun" 9172 msgstr "अमेरिका/क्यानकुन" 9173 9174 #. i18n: comment to the previous timezone 9175 #: kdecore/TIMEZONES:183 9176 #, kde-format 9177 msgid "Central Time - Quintana Roo" 9178 msgstr "" 9179 9180 #. i18n: comment to the previous timezone 9181 #: kdecore/TIMEZONES:185 9182 #, kde-format 9183 msgid "Eastern Standard Time - Quintana Roo" 9184 msgstr "" 9185 9186 #: kdecore/TIMEZONES:186 9187 #, kde-format 9188 msgid "America/Caracas" 9189 msgstr "अमेरिका/क्याराकास्" 9190 9191 #: kdecore/TIMEZONES:187 9192 #, kde-format 9193 msgid "America/Catamarca" 9194 msgstr "अमेरिका/काटामारका" 9195 9196 #: kdecore/TIMEZONES:190 9197 #, kde-format 9198 msgid "America/Cayenne" 9199 msgstr "अमेरिका/केइन्ने" 9200 9201 #: kdecore/TIMEZONES:191 9202 #, kde-format 9203 msgid "America/Cayman" 9204 msgstr "अमेरिका/केम्यान" 9205 9206 #: kdecore/TIMEZONES:192 9207 #, kde-format 9208 msgid "America/Chicago" 9209 msgstr "अमेरिका/सिकागो" 9210 9211 #. i18n: comment to the previous timezone 9212 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9213 #, kde-format 9214 msgid "Central Time" 9215 msgstr "" 9216 9217 #. i18n: comment to the previous timezone 9218 #: kdecore/TIMEZONES:196 9219 #, kde-format 9220 msgid "Central (most areas)" 9221 msgstr "" 9222 9223 #: kdecore/TIMEZONES:197 9224 #, kde-format 9225 msgid "America/Chihuahua" 9226 msgstr "अमेरिका/चिहुवाहुवा" 9227 9228 #. i18n: comment to the previous timezone 9229 #: kdecore/TIMEZONES:199 9230 #, kde-format 9231 msgid "Mountain Time - Chihuahua" 9232 msgstr "" 9233 9234 #. i18n: comment to the previous timezone 9235 #: kdecore/TIMEZONES:201 9236 #, kde-format 9237 msgid "Mexican Mountain Time - Chihuahua away from US border" 9238 msgstr "" 9239 9240 #. i18n: comment to the previous timezone 9241 #: kdecore/TIMEZONES:203 9242 #, kde-format 9243 msgid "Mountain Time - Chihuahua (most areas)" 9244 msgstr "" 9245 9246 #: kdecore/TIMEZONES:204 9247 #, fuzzy, kde-format 9248 #| msgid "America/Curacao" 9249 msgid "America/Coral_Harbour" 9250 msgstr "अमेरिका/कुराकोआ" 9251 9252 #: kdecore/TIMEZONES:207 9253 #, kde-format 9254 msgid "America/Cordoba" 9255 msgstr "अमेरिका/कोर्डोबा" 9256 9257 #: kdecore/TIMEZONES:210 9258 #, kde-format 9259 msgid "America/Costa_Rica" 9260 msgstr "अमेरिका/कोस्टारिका" 9261 9262 #: kdecore/TIMEZONES:211 9263 #, fuzzy, kde-format 9264 #| msgid "Africa/Freetown" 9265 msgid "America/Creston" 9266 msgstr "अफ्रिका/फ्रिटाउन" 9267 9268 #. i18n: comment to the previous timezone 9269 #: kdecore/TIMEZONES:213 9270 #, kde-format 9271 msgid "Mountain Standard Time - Creston, British Columbia" 9272 msgstr "" 9273 9274 #. i18n: comment to the previous timezone 9275 #: kdecore/TIMEZONES:215 9276 #, kde-format 9277 msgid "MST - BC (Creston)" 9278 msgstr "" 9279 9280 #: kdecore/TIMEZONES:216 9281 #, kde-format 9282 msgid "America/Cuiaba" 9283 msgstr "अमेरिका/कुइबा" 9284 9285 #. i18n: comment to the previous timezone 9286 #: kdecore/TIMEZONES:218 9287 #, kde-format 9288 msgid "Mato Grosso" 9289 msgstr "" 9290 9291 #: kdecore/TIMEZONES:219 9292 #, kde-format 9293 msgid "America/Curacao" 9294 msgstr "अमेरिका/कुराकोआ" 9295 9296 #: kdecore/TIMEZONES:220 9297 #, kde-format 9298 msgid "America/Danmarkshavn" 9299 msgstr "अमेरिका/दान्मार्कशन" 9300 9301 #. i18n: comment to the previous timezone 9302 #: kdecore/TIMEZONES:222 9303 #, kde-format 9304 msgid "east coast, north of Scoresbysund" 9305 msgstr "" 9306 9307 #. i18n: comment to the previous timezone 9308 #: kdecore/TIMEZONES:224 9309 #, kde-format 9310 msgid "National Park (east coast)" 9311 msgstr "" 9312 9313 #: kdecore/TIMEZONES:225 9314 #, kde-format 9315 msgid "America/Dawson" 9316 msgstr "अमेरिका/डव्सन्" 9317 9318 #. i18n: comment to the previous timezone 9319 #: kdecore/TIMEZONES:227 9320 #, kde-format 9321 msgid "Pacific Time - north Yukon" 9322 msgstr "" 9323 9324 #. i18n: comment to the previous timezone 9325 #: kdecore/TIMEZONES:229 9326 #, kde-format 9327 msgid "MST - Yukon (west)" 9328 msgstr "" 9329 9330 #: kdecore/TIMEZONES:230 9331 #, kde-format 9332 msgid "America/Dawson_Creek" 9333 msgstr "अमेरिका/ड्वसनक्रिक" 9334 9335 #. i18n: comment to the previous timezone 9336 #: kdecore/TIMEZONES:232 9337 #, kde-format 9338 msgid "" 9339 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9340 msgstr "" 9341 9342 #. i18n: comment to the previous timezone 9343 #: kdecore/TIMEZONES:234 9344 #, kde-format 9345 msgid "MST - BC (Dawson Cr, Ft St John)" 9346 msgstr "" 9347 9348 #: kdecore/TIMEZONES:235 9349 #, kde-format 9350 msgid "America/Denver" 9351 msgstr "अमेरिका/डेन्वर" 9352 9353 #. i18n: comment to the previous timezone 9354 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9355 #, kde-format 9356 msgid "Mountain Time" 9357 msgstr "" 9358 9359 #. i18n: comment to the previous timezone 9360 #: kdecore/TIMEZONES:239 9361 #, kde-format 9362 msgid "Mountain (most areas)" 9363 msgstr "" 9364 9365 #: kdecore/TIMEZONES:240 9366 #, kde-format 9367 msgid "America/Detroit" 9368 msgstr "अमेरिका/डेट्रोइट" 9369 9370 #. i18n: comment to the previous timezone 9371 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9372 #, kde-format 9373 msgid "Eastern Time - Michigan - most locations" 9374 msgstr "" 9375 9376 #. i18n: comment to the previous timezone 9377 #: kdecore/TIMEZONES:244 9378 #, kde-format 9379 msgid "Eastern - MI (most areas)" 9380 msgstr "" 9381 9382 #: kdecore/TIMEZONES:245 9383 #, kde-format 9384 msgid "America/Dominica" 9385 msgstr "अमेरिका/डोमिनिका" 9386 9387 #: kdecore/TIMEZONES:246 9388 #, kde-format 9389 msgid "America/Edmonton" 9390 msgstr "अमेरिका/एडमोन्टन" 9391 9392 #. i18n: comment to the previous timezone 9393 #: kdecore/TIMEZONES:250 9394 #, kde-format 9395 msgid "Mountain - AB; BC (E); SK (W)" 9396 msgstr "" 9397 9398 #: kdecore/TIMEZONES:251 9399 #, kde-format 9400 msgid "America/Eirunepe" 9401 msgstr "अमेरिका/एइरुनेप" 9402 9403 #. i18n: comment to the previous timezone 9404 #: kdecore/TIMEZONES:253 9405 #, kde-format 9406 msgid "W Amazonas" 9407 msgstr "" 9408 9409 #. i18n: comment to the previous timezone 9410 #: kdecore/TIMEZONES:255 9411 #, kde-format 9412 msgid "Amazonas (west)" 9413 msgstr "" 9414 9415 #: kdecore/TIMEZONES:256 9416 #, kde-format 9417 msgid "America/El_Salvador" 9418 msgstr "अमेरिका/एलसल्भाडोर" 9419 9420 #: kdecore/TIMEZONES:257 9421 #, fuzzy, kde-format 9422 #| msgid "America/Grenada" 9423 msgid "America/Ensenada" 9424 msgstr "अमेरिका/ग्रेनाडा" 9425 9426 #. i18n: comment to the previous timezone 9427 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9428 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9429 #, fuzzy, kde-format 9430 #| msgid "Pacific/Niue" 9431 msgid "Pacific Time" 9432 msgstr "प्यासिफिक/निउ" 9433 9434 #: kdecore/TIMEZONES:260 9435 #, fuzzy, kde-format 9436 #| msgid "America/Porto_Velho" 9437 msgid "America/Fort_Nelson" 9438 msgstr "अमेरिका/पोर्टोवेल्हो" 9439 9440 #. i18n: comment to the previous timezone 9441 #: kdecore/TIMEZONES:262 9442 #, kde-format 9443 msgid "MST - BC (Ft Nelson)" 9444 msgstr "" 9445 9446 #: kdecore/TIMEZONES:263 9447 #, fuzzy, kde-format 9448 #| msgid "America/Fortaleza" 9449 msgid "America/Fort_Wayne" 9450 msgstr "अमेरिका/फोर्टलेजा" 9451 9452 #. i18n: comment to the previous timezone 9453 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9454 #: kdecore/TIMEZONES:1419 9455 #, kde-format 9456 msgid "Eastern Time - Indiana - most locations" 9457 msgstr "" 9458 9459 #: kdecore/TIMEZONES:266 9460 #, kde-format 9461 msgid "America/Fortaleza" 9462 msgstr "अमेरिका/फोर्टलेजा" 9463 9464 #. i18n: comment to the previous timezone 9465 #: kdecore/TIMEZONES:268 9466 #, kde-format 9467 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9468 msgstr "" 9469 9470 #. i18n: comment to the previous timezone 9471 #: kdecore/TIMEZONES:270 9472 #, kde-format 9473 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9474 msgstr "" 9475 9476 #: kdecore/TIMEZONES:271 9477 #, fuzzy, kde-format 9478 #| msgid "Africa/Freetown" 9479 msgid "America/Fredericton" 9480 msgstr "अफ्रिका/फ्रिटाउन" 9481 9482 #. i18n: comment to the previous timezone 9483 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9484 #, kde-format 9485 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9486 msgstr "" 9487 9488 #: kdecore/TIMEZONES:274 9489 #, kde-format 9490 msgid "America/Glace_Bay" 9491 msgstr "अमेरिका/ग्ल्यासबे" 9492 9493 #. i18n: comment to the previous timezone 9494 #: kdecore/TIMEZONES:276 9495 #, kde-format 9496 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9497 msgstr "" 9498 9499 #. i18n: comment to the previous timezone 9500 #: kdecore/TIMEZONES:278 9501 #, fuzzy, kde-format 9502 #| msgid "Atlantic/Cape_Verde" 9503 msgid "Atlantic - NS (Cape Breton)" 9504 msgstr "एटलान्टिक/केपवर्डे" 9505 9506 #: kdecore/TIMEZONES:279 9507 #, kde-format 9508 msgid "America/Godthab" 9509 msgstr "अमेरिका/गडथब" 9510 9511 #. i18n: comment to the previous timezone 9512 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9513 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9514 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9515 #: kdecore/TIMEZONES:1350 9516 #, kde-format 9517 msgid "most locations" 9518 msgstr "" 9519 9520 #: kdecore/TIMEZONES:282 9521 #, kde-format 9522 msgid "America/Goose_Bay" 9523 msgstr "अमेरिका/गुसबे" 9524 9525 #. i18n: comment to the previous timezone 9526 #: kdecore/TIMEZONES:284 9527 #, kde-format 9528 msgid "Atlantic Time - Labrador - most locations" 9529 msgstr "" 9530 9531 #. i18n: comment to the previous timezone 9532 #: kdecore/TIMEZONES:286 9533 #, kde-format 9534 msgid "Atlantic - Labrador (most areas)" 9535 msgstr "" 9536 9537 #: kdecore/TIMEZONES:287 9538 #, kde-format 9539 msgid "America/Grand_Turk" 9540 msgstr "अमेरिका/ग्रेन्डटर्क" 9541 9542 #: kdecore/TIMEZONES:288 9543 #, kde-format 9544 msgid "America/Grenada" 9545 msgstr "अमेरिका/ग्रेनाडा" 9546 9547 #: kdecore/TIMEZONES:289 9548 #, kde-format 9549 msgid "America/Guadeloupe" 9550 msgstr "अमेरिका/ग्युएडेलोप" 9551 9552 #: kdecore/TIMEZONES:290 9553 #, kde-format 9554 msgid "America/Guatemala" 9555 msgstr "अमेरिका/ग्वाटेमाला" 9556 9557 #: kdecore/TIMEZONES:291 9558 #, kde-format 9559 msgid "America/Guayaquil" 9560 msgstr "अमेरिका/ग्वायेक्विल" 9561 9562 #. i18n: comment to the previous timezone 9563 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9564 #: kdecore/TIMEZONES:1400 9565 #, kde-format 9566 msgid "mainland" 9567 msgstr "" 9568 9569 #. i18n: comment to the previous timezone 9570 #: kdecore/TIMEZONES:295 9571 #, kde-format 9572 msgid "Ecuador (mainland)" 9573 msgstr "" 9574 9575 #: kdecore/TIMEZONES:296 9576 #, kde-format 9577 msgid "America/Guyana" 9578 msgstr "अमेरिका/गुयाना" 9579 9580 #: kdecore/TIMEZONES:297 9581 #, kde-format 9582 msgid "America/Halifax" 9583 msgstr "अमेरिका/हलिफ्याक्स" 9584 9585 #. i18n: comment to the previous timezone 9586 #: kdecore/TIMEZONES:301 9587 #, kde-format 9588 msgid "Atlantic - NS (most areas); PE" 9589 msgstr "" 9590 9591 #: kdecore/TIMEZONES:302 9592 #, kde-format 9593 msgid "America/Havana" 9594 msgstr "अमेरिका/हवाना" 9595 9596 #: kdecore/TIMEZONES:303 9597 #, kde-format 9598 msgid "America/Hermosillo" 9599 msgstr "अमेरिका/हर्मोसिलो" 9600 9601 #. i18n: comment to the previous timezone 9602 #: kdecore/TIMEZONES:305 9603 #, kde-format 9604 msgid "Mountain Standard Time - Sonora" 9605 msgstr "" 9606 9607 #: kdecore/TIMEZONES:306 9608 #, fuzzy, kde-format 9609 #| msgid "America/Indianapolis" 9610 msgid "America/Indiana/Indianapolis" 9611 msgstr "अमेरिका/इन्डियानापोलिस" 9612 9613 #. i18n: comment to the previous timezone 9614 #: kdecore/TIMEZONES:310 9615 #, kde-format 9616 msgid "Eastern - IN (most areas)" 9617 msgstr "" 9618 9619 #: kdecore/TIMEZONES:311 9620 #, kde-format 9621 msgid "America/Indiana/Knox" 9622 msgstr "अमेरिका/इन्डियाना/नोक्स" 9623 9624 #. i18n: comment to the previous timezone 9625 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9626 #, kde-format 9627 msgid "Eastern Time - Indiana - Starke County" 9628 msgstr "" 9629 9630 #. i18n: comment to the previous timezone 9631 #: kdecore/TIMEZONES:315 9632 #, kde-format 9633 msgid "Central Time - Indiana - Starke County" 9634 msgstr "" 9635 9636 #. i18n: comment to the previous timezone 9637 #: kdecore/TIMEZONES:317 9638 #, kde-format 9639 msgid "Central - IN (Starke)" 9640 msgstr "" 9641 9642 #: kdecore/TIMEZONES:318 9643 #, kde-format 9644 msgid "America/Indiana/Marengo" 9645 msgstr "अमेरिका/इन्डियाना/मरेन्गो" 9646 9647 #. i18n: comment to the previous timezone 9648 #: kdecore/TIMEZONES:320 9649 #, kde-format 9650 msgid "Eastern Time - Indiana - Crawford County" 9651 msgstr "" 9652 9653 #. i18n: comment to the previous timezone 9654 #: kdecore/TIMEZONES:322 9655 #, kde-format 9656 msgid "Eastern - IN (Crawford)" 9657 msgstr "" 9658 9659 #: kdecore/TIMEZONES:323 9660 #, fuzzy, kde-format 9661 #| msgid "America/Indiana/Marengo" 9662 msgid "America/Indiana/Petersburg" 9663 msgstr "अमेरिका/इन्डियाना/मरेन्गो" 9664 9665 #. i18n: comment to the previous timezone 9666 #: kdecore/TIMEZONES:325 9667 #, kde-format 9668 msgid "Central Time - Indiana - Pike County" 9669 msgstr "" 9670 9671 #. i18n: comment to the previous timezone 9672 #: kdecore/TIMEZONES:327 9673 #, kde-format 9674 msgid "Eastern Time - Indiana - Pike County" 9675 msgstr "" 9676 9677 #. i18n: comment to the previous timezone 9678 #: kdecore/TIMEZONES:329 9679 #, kde-format 9680 msgid "Eastern - IN (Pike)" 9681 msgstr "" 9682 9683 #: kdecore/TIMEZONES:330 9684 #, fuzzy, kde-format 9685 #| msgid "America/Indiana/Vevay" 9686 msgid "America/Indiana/Tell_City" 9687 msgstr "अमेरिका/इन्डियाना/वेवेय" 9688 9689 #. i18n: comment to the previous timezone 9690 #: kdecore/TIMEZONES:332 9691 #, kde-format 9692 msgid "Central Time - Indiana - Perry County" 9693 msgstr "" 9694 9695 #. i18n: comment to the previous timezone 9696 #: kdecore/TIMEZONES:334 9697 #, kde-format 9698 msgid "Central - IN (Perry)" 9699 msgstr "" 9700 9701 #: kdecore/TIMEZONES:335 9702 #, kde-format 9703 msgid "America/Indiana/Vevay" 9704 msgstr "अमेरिका/इन्डियाना/वेवेय" 9705 9706 #. i18n: comment to the previous timezone 9707 #: kdecore/TIMEZONES:337 9708 #, kde-format 9709 msgid "Eastern Time - Indiana - Switzerland County" 9710 msgstr "" 9711 9712 #. i18n: comment to the previous timezone 9713 #: kdecore/TIMEZONES:339 9714 #, kde-format 9715 msgid "Eastern - IN (Switzerland)" 9716 msgstr "" 9717 9718 #: kdecore/TIMEZONES:340 9719 #, fuzzy, kde-format 9720 #| msgid "America/Indiana/Vevay" 9721 msgid "America/Indiana/Vincennes" 9722 msgstr "अमेरिका/इन्डियाना/वेवेय" 9723 9724 #. i18n: comment to the previous timezone 9725 #: kdecore/TIMEZONES:342 9726 #, kde-format 9727 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9728 msgstr "" 9729 9730 #. i18n: comment to the previous timezone 9731 #: kdecore/TIMEZONES:344 9732 #, kde-format 9733 msgid "Eastern - IN (Da, Du, K, Mn)" 9734 msgstr "" 9735 9736 #: kdecore/TIMEZONES:345 9737 #, fuzzy, kde-format 9738 #| msgid "America/Indiana/Knox" 9739 msgid "America/Indiana/Winamac" 9740 msgstr "अमेरिका/इन्डियाना/नोक्स" 9741 9742 #. i18n: comment to the previous timezone 9743 #: kdecore/TIMEZONES:347 9744 #, kde-format 9745 msgid "Eastern Time - Indiana - Pulaski County" 9746 msgstr "" 9747 9748 #. i18n: comment to the previous timezone 9749 #: kdecore/TIMEZONES:349 9750 #, kde-format 9751 msgid "Eastern - IN (Pulaski)" 9752 msgstr "" 9753 9754 #: kdecore/TIMEZONES:350 9755 #, kde-format 9756 msgid "America/Indianapolis" 9757 msgstr "अमेरिका/इन्डियानापोलिस" 9758 9759 #: kdecore/TIMEZONES:353 9760 #, kde-format 9761 msgid "America/Inuvik" 9762 msgstr "अमेरिका/इनुभिक" 9763 9764 #. i18n: comment to the previous timezone 9765 #: kdecore/TIMEZONES:355 9766 #, kde-format 9767 msgid "Mountain Time - west Northwest Territories" 9768 msgstr "" 9769 9770 #. i18n: comment to the previous timezone 9771 #: kdecore/TIMEZONES:357 9772 #, kde-format 9773 msgid "Mountain - NT (west)" 9774 msgstr "" 9775 9776 #: kdecore/TIMEZONES:358 9777 #, kde-format 9778 msgid "America/Iqaluit" 9779 msgstr "अमेरिका/इक्वालुइट" 9780 9781 #. i18n: comment to the previous timezone 9782 #: kdecore/TIMEZONES:360 9783 #, kde-format 9784 msgid "Eastern Time - east Nunavut - most locations" 9785 msgstr "" 9786 9787 #. i18n: comment to the previous timezone 9788 #: kdecore/TIMEZONES:362 9789 #, kde-format 9790 msgid "Eastern - NU (most east areas)" 9791 msgstr "" 9792 9793 #: kdecore/TIMEZONES:363 9794 #, kde-format 9795 msgid "America/Jamaica" 9796 msgstr "अमेरिका/जमैका" 9797 9798 #: kdecore/TIMEZONES:364 9799 #, kde-format 9800 msgid "America/Jujuy" 9801 msgstr "अमेरिका/जुजुय" 9802 9803 #: kdecore/TIMEZONES:367 9804 #, kde-format 9805 msgid "America/Juneau" 9806 msgstr "अमेरिका/ज्युनेउ" 9807 9808 #. i18n: comment to the previous timezone 9809 #: kdecore/TIMEZONES:369 9810 #, kde-format 9811 msgid "Alaska Time - Alaska panhandle" 9812 msgstr "" 9813 9814 #. i18n: comment to the previous timezone 9815 #: kdecore/TIMEZONES:371 9816 #, kde-format 9817 msgid "Alaska - Juneau area" 9818 msgstr "" 9819 9820 #: kdecore/TIMEZONES:372 9821 #, fuzzy, kde-format 9822 #| msgid "America/Louisville" 9823 msgid "America/Kentucky/Louisville" 9824 msgstr "अमेरिका/लोइसभिले" 9825 9826 #. i18n: comment to the previous timezone 9827 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9828 #, fuzzy, kde-format 9829 #| msgid "America/Louisville" 9830 msgid "Eastern Time - Kentucky - Louisville area" 9831 msgstr "अमेरिका/लोइसभिले" 9832 9833 #. i18n: comment to the previous timezone 9834 #: kdecore/TIMEZONES:376 9835 #, fuzzy, kde-format 9836 #| msgid "America/Louisville" 9837 msgid "Eastern - KY (Louisville area)" 9838 msgstr "अमेरिका/लोइसभिले" 9839 9840 #: kdecore/TIMEZONES:377 9841 #, kde-format 9842 msgid "America/Kentucky/Monticello" 9843 msgstr "अमेरिका/केन्टुकि/मोन्टिसेलो" 9844 9845 #. i18n: comment to the previous timezone 9846 #: kdecore/TIMEZONES:379 9847 #, kde-format 9848 msgid "Eastern Time - Kentucky - Wayne County" 9849 msgstr "" 9850 9851 #. i18n: comment to the previous timezone 9852 #: kdecore/TIMEZONES:381 9853 #, kde-format 9854 msgid "Eastern - KY (Wayne)" 9855 msgstr "" 9856 9857 #: kdecore/TIMEZONES:382 9858 #, fuzzy, kde-format 9859 #| msgid "America/Indiana/Knox" 9860 msgid "America/Knox_IN" 9861 msgstr "अमेरिका/इन्डियाना/नोक्स" 9862 9863 #: kdecore/TIMEZONES:385 9864 #, fuzzy, kde-format 9865 #| msgid "America/Grenada" 9866 msgid "America/Kralendijk" 9867 msgstr "अमेरिका/ग्रेनाडा" 9868 9869 #: kdecore/TIMEZONES:386 9870 #, kde-format 9871 msgid "America/La_Paz" 9872 msgstr "अमेरिका/लपज" 9873 9874 #: kdecore/TIMEZONES:387 9875 #, kde-format 9876 msgid "America/Lima" 9877 msgstr "अमेरिका/लिमा" 9878 9879 #: kdecore/TIMEZONES:388 9880 #, kde-format 9881 msgid "America/Los_Angeles" 9882 msgstr "अमेरिका/लसएन्जल्स" 9883 9884 #. i18n: comment to the previous timezone 9885 #: kdecore/TIMEZONES:392 9886 #, fuzzy, kde-format 9887 #| msgid "Pacific/Yap" 9888 msgid "Pacific" 9889 msgstr "प्यासिफिक/याप" 9890 9891 #: kdecore/TIMEZONES:393 9892 #, kde-format 9893 msgid "America/Louisville" 9894 msgstr "अमेरिका/लोइसभिले" 9895 9896 #: kdecore/TIMEZONES:396 9897 #, fuzzy, kde-format 9898 #| msgid "America/Port-au-Prince" 9899 msgid "America/Lower_Princes" 9900 msgstr "अमेरिका/पोर्ट-आउ-प्रिन्स" 9901 9902 #: kdecore/TIMEZONES:397 9903 #, kde-format 9904 msgid "America/Maceio" 9905 msgstr "अमेरिका/मसेइयो" 9906 9907 #. i18n: comment to the previous timezone 9908 #: kdecore/TIMEZONES:399 9909 #, kde-format 9910 msgid "Alagoas, Sergipe" 9911 msgstr "" 9912 9913 #: kdecore/TIMEZONES:400 9914 #, kde-format 9915 msgid "America/Managua" 9916 msgstr "अमेरिका/मनागुवा" 9917 9918 #: kdecore/TIMEZONES:401 9919 #, kde-format 9920 msgid "America/Manaus" 9921 msgstr "अमेरिका/मानस" 9922 9923 #. i18n: comment to the previous timezone 9924 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9925 #, kde-format 9926 msgid "E Amazonas" 9927 msgstr "" 9928 9929 #. i18n: comment to the previous timezone 9930 #: kdecore/TIMEZONES:405 9931 #, kde-format 9932 msgid "Amazonas (east)" 9933 msgstr "" 9934 9935 #: kdecore/TIMEZONES:406 9936 #, fuzzy, kde-format 9937 #| msgid "America/Maceio" 9938 msgid "America/Marigot" 9939 msgstr "अमेरिका/मसेइयो" 9940 9941 #: kdecore/TIMEZONES:407 9942 #, kde-format 9943 msgid "America/Martinique" 9944 msgstr "अमेरिका/माटिनिक" 9945 9946 #: kdecore/TIMEZONES:408 9947 #, fuzzy, kde-format 9948 #| msgid "America/Manaus" 9949 msgid "America/Matamoros" 9950 msgstr "अमेरिका/मानस" 9951 9952 #. i18n: comment to the previous timezone 9953 #: kdecore/TIMEZONES:410 9954 #, kde-format 9955 msgid "" 9956 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9957 msgstr "" 9958 9959 #. i18n: comment to the previous timezone 9960 #: kdecore/TIMEZONES:412 9961 #, kde-format 9962 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9963 msgstr "" 9964 9965 #: kdecore/TIMEZONES:413 9966 #, kde-format 9967 msgid "America/Mazatlan" 9968 msgstr "अमेरिका/मजाट्लान" 9969 9970 #. i18n: comment to the previous timezone 9971 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9972 #, kde-format 9973 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9974 msgstr "" 9975 9976 #. i18n: comment to the previous timezone 9977 #: kdecore/TIMEZONES:417 9978 #, kde-format 9979 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9980 msgstr "" 9981 9982 #: kdecore/TIMEZONES:418 9983 #, kde-format 9984 msgid "America/Mendoza" 9985 msgstr "अमेरिका/मेन्दोजा" 9986 9987 #: kdecore/TIMEZONES:421 9988 #, kde-format 9989 msgid "America/Menominee" 9990 msgstr "अमेरिका/मेनोमिनी" 9991 9992 #. i18n: comment to the previous timezone 9993 #: kdecore/TIMEZONES:423 9994 #, kde-format 9995 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9996 msgstr "" 9997 9998 #. i18n: comment to the previous timezone 9999 #: kdecore/TIMEZONES:425 10000 #, kde-format 10001 msgid "Central - MI (Wisconsin border)" 10002 msgstr "" 10003 10004 #: kdecore/TIMEZONES:426 10005 #, kde-format 10006 msgid "America/Merida" 10007 msgstr "अमेरिका/मेरिडा" 10008 10009 #. i18n: comment to the previous timezone 10010 #: kdecore/TIMEZONES:428 10011 #, kde-format 10012 msgid "Central Time - Campeche, Yucatan" 10013 msgstr "" 10014 10015 #: kdecore/TIMEZONES:429 10016 #, fuzzy, kde-format 10017 #| msgid "America/Mazatlan" 10018 msgid "America/Metlakatla" 10019 msgstr "अमेरिका/मजाट्लान" 10020 10021 #. i18n: comment to the previous timezone 10022 #: kdecore/TIMEZONES:431 10023 #, kde-format 10024 msgid "Metlakatla Time - Annette Island" 10025 msgstr "" 10026 10027 #. i18n: comment to the previous timezone 10028 #: kdecore/TIMEZONES:433 10029 #, kde-format 10030 msgid "Alaska - Annette Island" 10031 msgstr "" 10032 10033 #: kdecore/TIMEZONES:434 10034 #, kde-format 10035 msgid "America/Mexico_City" 10036 msgstr "अमेरिका/मेक्सिको सिटी" 10037 10038 #. i18n: comment to the previous timezone 10039 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 10040 #, kde-format 10041 msgid "Central Time - most locations" 10042 msgstr "" 10043 10044 #: kdecore/TIMEZONES:439 10045 #, kde-format 10046 msgid "America/Miquelon" 10047 msgstr "अमेरिका/मिक्वेलोन" 10048 10049 #: kdecore/TIMEZONES:440 10050 #, fuzzy, kde-format 10051 #| msgid "America/Edmonton" 10052 msgid "America/Moncton" 10053 msgstr "अमेरिका/एडमोन्टन" 10054 10055 #. i18n: comment to the previous timezone 10056 #: kdecore/TIMEZONES:442 10057 #, kde-format 10058 msgid "Atlantic Time - New Brunswick" 10059 msgstr "" 10060 10061 #. i18n: comment to the previous timezone 10062 #: kdecore/TIMEZONES:444 10063 #, kde-format 10064 msgid "Atlantic - New Brunswick" 10065 msgstr "" 10066 10067 #: kdecore/TIMEZONES:445 10068 #, kde-format 10069 msgid "America/Monterrey" 10070 msgstr "अमेरिका/मोन्टेरी" 10071 10072 #. i18n: comment to the previous timezone 10073 #: kdecore/TIMEZONES:447 10074 #, kde-format 10075 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10076 msgstr "" 10077 10078 #. i18n: comment to the previous timezone 10079 #: kdecore/TIMEZONES:449 10080 #, kde-format 10081 msgid "" 10082 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10083 "US border" 10084 msgstr "" 10085 10086 #. i18n: comment to the previous timezone 10087 #: kdecore/TIMEZONES:451 10088 #, kde-format 10089 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10090 msgstr "" 10091 10092 #: kdecore/TIMEZONES:452 10093 #, kde-format 10094 msgid "America/Montevideo" 10095 msgstr "अमेरिका/मोन्टेभिडियो" 10096 10097 #: kdecore/TIMEZONES:453 10098 #, kde-format 10099 msgid "America/Montreal" 10100 msgstr "अमेरिका/मोन्ट्रियल" 10101 10102 #. i18n: comment to the previous timezone 10103 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10104 #, kde-format 10105 msgid "Eastern Time - Quebec - most locations" 10106 msgstr "" 10107 10108 #: kdecore/TIMEZONES:456 10109 #, kde-format 10110 msgid "America/Montserrat" 10111 msgstr "अमेरिका/मोन्टसेराट" 10112 10113 #: kdecore/TIMEZONES:457 10114 #, kde-format 10115 msgid "America/Nassau" 10116 msgstr "अमेरिका/नासाउ" 10117 10118 #: kdecore/TIMEZONES:458 10119 #, kde-format 10120 msgid "America/New_York" 10121 msgstr "अमेरिका/न्युयोर्क" 10122 10123 #. i18n: comment to the previous timezone 10124 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10125 #, kde-format 10126 msgid "Eastern Time" 10127 msgstr "" 10128 10129 #. i18n: comment to the previous timezone 10130 #: kdecore/TIMEZONES:462 10131 #, kde-format 10132 msgid "Eastern (most areas)" 10133 msgstr "" 10134 10135 #: kdecore/TIMEZONES:463 10136 #, kde-format 10137 msgid "America/Nipigon" 10138 msgstr "अमेरिका/निपिगोन" 10139 10140 #. i18n: comment to the previous timezone 10141 #: kdecore/TIMEZONES:465 10142 #, kde-format 10143 msgid "" 10144 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10145 msgstr "" 10146 10147 #. i18n: comment to the previous timezone 10148 #: kdecore/TIMEZONES:467 10149 #, kde-format 10150 msgid "Eastern - ON, QC (no DST 1967-73)" 10151 msgstr "" 10152 10153 #: kdecore/TIMEZONES:468 10154 #, kde-format 10155 msgid "America/Nome" 10156 msgstr "अमेरिका/नोम" 10157 10158 #. i18n: comment to the previous timezone 10159 #: kdecore/TIMEZONES:470 10160 #, kde-format 10161 msgid "Alaska Time - west Alaska" 10162 msgstr "" 10163 10164 #. i18n: comment to the previous timezone 10165 #: kdecore/TIMEZONES:472 10166 #, kde-format 10167 msgid "Alaska (west)" 10168 msgstr "" 10169 10170 #: kdecore/TIMEZONES:473 10171 #, kde-format 10172 msgid "America/Noronha" 10173 msgstr "अमेरिका/नोरोन्हा" 10174 10175 #. i18n: comment to the previous timezone 10176 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10177 #, fuzzy, kde-format 10178 #| msgid "Atlantic/Canary" 10179 msgid "Atlantic islands" 10180 msgstr "एटलान्टिक/क्यानरी" 10181 10182 #: kdecore/TIMEZONES:476 10183 #, fuzzy, kde-format 10184 #| msgid "America/North_Dakota/Center" 10185 msgid "America/North_Dakota/Beulah" 10186 msgstr "अमेरिका/नर्थडकोटा/सेन्टर" 10187 10188 #. i18n: comment to the previous timezone 10189 #: kdecore/TIMEZONES:478 10190 #, kde-format 10191 msgid "Central Time - North Dakota - Mercer County" 10192 msgstr "" 10193 10194 #. i18n: comment to the previous timezone 10195 #: kdecore/TIMEZONES:480 10196 #, kde-format 10197 msgid "Central - ND (Mercer)" 10198 msgstr "" 10199 10200 #: kdecore/TIMEZONES:481 10201 #, kde-format 10202 msgid "America/North_Dakota/Center" 10203 msgstr "अमेरिका/नर्थडकोटा/सेन्टर" 10204 10205 #. i18n: comment to the previous timezone 10206 #: kdecore/TIMEZONES:483 10207 #, kde-format 10208 msgid "Central Time - North Dakota - Oliver County" 10209 msgstr "" 10210 10211 #. i18n: comment to the previous timezone 10212 #: kdecore/TIMEZONES:485 10213 #, kde-format 10214 msgid "Central - ND (Oliver)" 10215 msgstr "" 10216 10217 #: kdecore/TIMEZONES:486 10218 #, fuzzy, kde-format 10219 #| msgid "America/North_Dakota/Center" 10220 msgid "America/North_Dakota/New_Salem" 10221 msgstr "अमेरिका/नर्थडकोटा/सेन्टर" 10222 10223 #. i18n: comment to the previous timezone 10224 #: kdecore/TIMEZONES:488 10225 #, kde-format 10226 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10227 msgstr "" 10228 10229 #. i18n: comment to the previous timezone 10230 #: kdecore/TIMEZONES:490 10231 #, kde-format 10232 msgid "Central - ND (Morton rural)" 10233 msgstr "" 10234 10235 #: kdecore/TIMEZONES:491 10236 #, fuzzy, kde-format 10237 #| msgid "America/Jujuy" 10238 msgid "America/Nuuk" 10239 msgstr "अमेरिका/जुजुय" 10240 10241 #. i18n: comment to the previous timezone 10242 #: kdecore/TIMEZONES:493 10243 #, kde-format 10244 msgid "Greenland (most areas)" 10245 msgstr "" 10246 10247 #: kdecore/TIMEZONES:494 10248 #, fuzzy, kde-format 10249 #| msgid "America/Managua" 10250 msgid "America/Ojinaga" 10251 msgstr "अमेरिका/मनागुवा" 10252 10253 #. i18n: comment to the previous timezone 10254 #: kdecore/TIMEZONES:496 10255 #, kde-format 10256 msgid "US Mountain Time - Chihuahua near US border" 10257 msgstr "" 10258 10259 #. i18n: comment to the previous timezone 10260 #: kdecore/TIMEZONES:498 10261 #, kde-format 10262 msgid "Mountain Time US - Chihuahua (US border)" 10263 msgstr "" 10264 10265 #: kdecore/TIMEZONES:499 10266 #, fuzzy, kde-format 10267 #| msgid "America/Maceio" 10268 msgid "America/Ontario" 10269 msgstr "अमेरिका/मसेइयो" 10270 10271 #: kdecore/TIMEZONES:502 10272 #, kde-format 10273 msgid "America/Panama" 10274 msgstr "अमेरिका/पानामा" 10275 10276 #: kdecore/TIMEZONES:503 10277 #, kde-format 10278 msgid "America/Pangnirtung" 10279 msgstr "अमेरिका/पाङ्गनिर्टुङ" 10280 10281 #. i18n: comment to the previous timezone 10282 #: kdecore/TIMEZONES:505 10283 #, kde-format 10284 msgid "Eastern Time - Pangnirtung, Nunavut" 10285 msgstr "" 10286 10287 #. i18n: comment to the previous timezone 10288 #: kdecore/TIMEZONES:507 10289 #, kde-format 10290 msgid "Eastern - NU (Pangnirtung)" 10291 msgstr "" 10292 10293 #: kdecore/TIMEZONES:508 10294 #, kde-format 10295 msgid "America/Paramaribo" 10296 msgstr "अमेरिका/पारामारिबो" 10297 10298 #: kdecore/TIMEZONES:509 10299 #, kde-format 10300 msgid "America/Phoenix" 10301 msgstr "अमेरिका/फोनिक्स" 10302 10303 #. i18n: comment to the previous timezone 10304 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10305 #, kde-format 10306 msgid "Mountain Standard Time - Arizona" 10307 msgstr "" 10308 10309 #. i18n: comment to the previous timezone 10310 #: kdecore/TIMEZONES:513 10311 #, kde-format 10312 msgid "MST - Arizona (except Navajo)" 10313 msgstr "" 10314 10315 #: kdecore/TIMEZONES:514 10316 #, kde-format 10317 msgid "America/Port-au-Prince" 10318 msgstr "अमेरिका/पोर्ट-आउ-प्रिन्स" 10319 10320 #: kdecore/TIMEZONES:515 10321 #, kde-format 10322 msgid "America/Port_of_Spain" 10323 msgstr "अमेरिका/स्पेनको पोर्ट" 10324 10325 #: kdecore/TIMEZONES:516 10326 #, fuzzy, kde-format 10327 #| msgid "America/Porto_Velho" 10328 msgid "America/Porto_Acre" 10329 msgstr "अमेरिका/पोर्टोवेल्हो" 10330 10331 #. i18n: comment to the previous timezone 10332 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10333 #, kde-format 10334 msgid "Acre" 10335 msgstr "" 10336 10337 #: kdecore/TIMEZONES:519 10338 #, kde-format 10339 msgid "America/Porto_Velho" 10340 msgstr "अमेरिका/पोर्टोवेल्हो" 10341 10342 #. i18n: comment to the previous timezone 10343 #: kdecore/TIMEZONES:521 10344 #, kde-format 10345 msgid "Rondonia" 10346 msgstr "" 10347 10348 #: kdecore/TIMEZONES:522 10349 #, kde-format 10350 msgid "America/Puerto_Rico" 10351 msgstr "अमेरिका/पेर्टोरिको" 10352 10353 #: kdecore/TIMEZONES:523 10354 #, fuzzy, kde-format 10355 #| msgid "America/Buenos_Aires" 10356 msgid "America/Punta_Arenas" 10357 msgstr "अमेरिका/ब्येनोसएरिज" 10358 10359 #. i18n: comment to the previous timezone 10360 #: kdecore/TIMEZONES:525 10361 #, kde-format 10362 msgid "Region of Magallanes" 10363 msgstr "" 10364 10365 #: kdecore/TIMEZONES:526 10366 #, kde-format 10367 msgid "America/Rainy_River" 10368 msgstr "अमेरिका/रेनी रिभर" 10369 10370 #. i18n: comment to the previous timezone 10371 #: kdecore/TIMEZONES:528 10372 #, kde-format 10373 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10374 msgstr "" 10375 10376 #. i18n: comment to the previous timezone 10377 #: kdecore/TIMEZONES:530 10378 #, kde-format 10379 msgid "Central - ON (Rainy R, Ft Frances)" 10380 msgstr "" 10381 10382 #: kdecore/TIMEZONES:531 10383 #, kde-format 10384 msgid "America/Rankin_Inlet" 10385 msgstr "अमेरिका/रङ्किन इनलेट" 10386 10387 #. i18n: comment to the previous timezone 10388 #: kdecore/TIMEZONES:533 10389 #, kde-format 10390 msgid "Central Time - central Nunavut" 10391 msgstr "" 10392 10393 #. i18n: comment to the previous timezone 10394 #: kdecore/TIMEZONES:535 10395 #, kde-format 10396 msgid "Central - NU (central)" 10397 msgstr "" 10398 10399 #: kdecore/TIMEZONES:536 10400 #, kde-format 10401 msgid "America/Recife" 10402 msgstr "अमेरिका/रेसिफे" 10403 10404 #. i18n: comment to the previous timezone 10405 #: kdecore/TIMEZONES:538 10406 #, kde-format 10407 msgid "Pernambuco" 10408 msgstr "" 10409 10410 #: kdecore/TIMEZONES:539 10411 #, kde-format 10412 msgid "America/Regina" 10413 msgstr "अमेरिका/रेजिना" 10414 10415 #. i18n: comment to the previous timezone 10416 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10417 #: kdecore/TIMEZONES:1123 10418 #, kde-format 10419 msgid "Central Standard Time - Saskatchewan - most locations" 10420 msgstr "" 10421 10422 #. i18n: comment to the previous timezone 10423 #: kdecore/TIMEZONES:543 10424 #, kde-format 10425 msgid "CST - SK (most areas)" 10426 msgstr "" 10427 10428 #: kdecore/TIMEZONES:544 10429 #, fuzzy, kde-format 10430 #| msgid "America/Belem" 10431 msgid "America/Resolute" 10432 msgstr "अमेरिका/बेलेम" 10433 10434 #. i18n: comment to the previous timezone 10435 #: kdecore/TIMEZONES:546 10436 #, kde-format 10437 msgid "Eastern Time - Resolute, Nunavut" 10438 msgstr "" 10439 10440 #. i18n: comment to the previous timezone 10441 #: kdecore/TIMEZONES:548 10442 #, kde-format 10443 msgid "Central Standard Time - Resolute, Nunavut" 10444 msgstr "" 10445 10446 #. i18n: comment to the previous timezone 10447 #: kdecore/TIMEZONES:550 10448 #, kde-format 10449 msgid "Central - NU (Resolute)" 10450 msgstr "" 10451 10452 #: kdecore/TIMEZONES:551 10453 #, kde-format 10454 msgid "America/Rio_Branco" 10455 msgstr "अमेरिका/रियोब्रान्को" 10456 10457 #: kdecore/TIMEZONES:554 10458 #, kde-format 10459 msgid "America/Rosario" 10460 msgstr "अमेरिका/रोसारियो" 10461 10462 #: kdecore/TIMEZONES:557 10463 #, fuzzy, kde-format 10464 #| msgid "America/Santiago" 10465 msgid "America/Santa_Isabel" 10466 msgstr "अमेरिका/सान्टियागो" 10467 10468 #. i18n: comment to the previous timezone 10469 #: kdecore/TIMEZONES:559 10470 #, kde-format 10471 msgid "Mexican Pacific Time - Baja California away from US border" 10472 msgstr "" 10473 10474 #: kdecore/TIMEZONES:560 10475 #, fuzzy, kde-format 10476 #| msgid "America/Santiago" 10477 msgid "America/Santarem" 10478 msgstr "अमेरिका/सान्टियागो" 10479 10480 #. i18n: comment to the previous timezone 10481 #: kdecore/TIMEZONES:562 10482 #, fuzzy, kde-format 10483 msgid "W Para" 10484 msgstr "मार्चको" 10485 10486 #. i18n: comment to the previous timezone 10487 #: kdecore/TIMEZONES:564 10488 #, kde-format 10489 msgid "Para (west)" 10490 msgstr "" 10491 10492 #: kdecore/TIMEZONES:565 10493 #, kde-format 10494 msgid "America/Santiago" 10495 msgstr "अमेरिका/सान्टियागो" 10496 10497 #. i18n: comment to the previous timezone 10498 #: kdecore/TIMEZONES:569 10499 #, kde-format 10500 msgid "Chile (most areas)" 10501 msgstr "" 10502 10503 #: kdecore/TIMEZONES:570 10504 #, kde-format 10505 msgid "America/Santo_Domingo" 10506 msgstr "अमेरिका/सान्टोडोमिन्गो" 10507 10508 #: kdecore/TIMEZONES:571 10509 #, kde-format 10510 msgid "America/Sao_Paulo" 10511 msgstr "अमेरिका/साओपाउलो" 10512 10513 #. i18n: comment to the previous timezone 10514 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10515 #, kde-format 10516 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10517 msgstr "" 10518 10519 #. i18n: comment to the previous timezone 10520 #: kdecore/TIMEZONES:575 10521 #, kde-format 10522 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10523 msgstr "" 10524 10525 #: kdecore/TIMEZONES:576 10526 #, fuzzy, kde-format 10527 #| msgid "America/Dawson" 10528 msgid "America/Saskatoon" 10529 msgstr "अमेरिका/डव्सन्" 10530 10531 #: kdecore/TIMEZONES:579 10532 #, kde-format 10533 msgid "America/Scoresbysund" 10534 msgstr "अमेरिका/स्कोर्सबाइसुन्ड" 10535 10536 #. i18n: comment to the previous timezone 10537 #: kdecore/TIMEZONES:581 10538 #, kde-format 10539 msgid "Scoresbysund / Ittoqqortoormiit" 10540 msgstr "" 10541 10542 #. i18n: comment to the previous timezone 10543 #: kdecore/TIMEZONES:583 10544 #, kde-format 10545 msgid "Scoresbysund/Ittoqqortoormiit" 10546 msgstr "" 10547 10548 #: kdecore/TIMEZONES:584 10549 #, kde-format 10550 msgid "America/Shiprock" 10551 msgstr "अमेरिका/सिपोर्क" 10552 10553 #. i18n: comment to the previous timezone 10554 #: kdecore/TIMEZONES:586 10555 #, kde-format 10556 msgid "Mountain Time - Navajo" 10557 msgstr "" 10558 10559 #: kdecore/TIMEZONES:587 10560 #, fuzzy, kde-format 10561 #| msgid "America/Antigua" 10562 msgid "America/Sitka" 10563 msgstr "अमेरिका/एन्टिगुवा" 10564 10565 #. i18n: comment to the previous timezone 10566 #: kdecore/TIMEZONES:589 10567 #, kde-format 10568 msgid "Alaska Time - southeast Alaska panhandle" 10569 msgstr "" 10570 10571 #. i18n: comment to the previous timezone 10572 #: kdecore/TIMEZONES:591 10573 #, kde-format 10574 msgid "Alaska - Sitka area" 10575 msgstr "" 10576 10577 #: kdecore/TIMEZONES:592 10578 #, fuzzy, kde-format 10579 #| msgid "America/Belem" 10580 msgid "America/St_Barthelemy" 10581 msgstr "अमेरिका/बेलेम" 10582 10583 #: kdecore/TIMEZONES:593 10584 #, kde-format 10585 msgid "America/St_Johns" 10586 msgstr "अमेरिका/सेन्ट जोन्स" 10587 10588 #. i18n: comment to the previous timezone 10589 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10590 #, kde-format 10591 msgid "Newfoundland Time, including SE Labrador" 10592 msgstr "" 10593 10594 #. i18n: comment to the previous timezone 10595 #: kdecore/TIMEZONES:597 10596 #, kde-format 10597 msgid "Newfoundland; Labrador (southeast)" 10598 msgstr "" 10599 10600 #: kdecore/TIMEZONES:598 10601 #, kde-format 10602 msgid "America/St_Kitts" 10603 msgstr "अमेरिका/सेन्ट किट्स" 10604 10605 #: kdecore/TIMEZONES:599 10606 #, kde-format 10607 msgid "America/St_Lucia" 10608 msgstr "अमेरिका/सेन्ट लुसिया" 10609 10610 #: kdecore/TIMEZONES:600 10611 #, kde-format 10612 msgid "America/St_Thomas" 10613 msgstr "अमेरिका/सेन्ट थोमस" 10614 10615 #: kdecore/TIMEZONES:601 10616 #, kde-format 10617 msgid "America/St_Vincent" 10618 msgstr "अमेरिका/सेन्ट भिन्सेन्ट" 10619 10620 #: kdecore/TIMEZONES:602 10621 #, kde-format 10622 msgid "America/Swift_Current" 10623 msgstr "अमेरिका/स्विफ्ट करेन्ट" 10624 10625 #. i18n: comment to the previous timezone 10626 #: kdecore/TIMEZONES:604 10627 #, kde-format 10628 msgid "Central Standard Time - Saskatchewan - midwest" 10629 msgstr "" 10630 10631 #. i18n: comment to the previous timezone 10632 #: kdecore/TIMEZONES:606 10633 #, kde-format 10634 msgid "CST - SK (midwest)" 10635 msgstr "" 10636 10637 #: kdecore/TIMEZONES:607 10638 #, kde-format 10639 msgid "America/Tegucigalpa" 10640 msgstr "अमेरिका/टेगुसिगाल्पा" 10641 10642 #: kdecore/TIMEZONES:608 10643 #, kde-format 10644 msgid "America/Thule" 10645 msgstr "अमेरिका/थुले" 10646 10647 #. i18n: comment to the previous timezone 10648 #: kdecore/TIMEZONES:610 10649 #, kde-format 10650 msgid "Thule / Pituffik" 10651 msgstr "" 10652 10653 #. i18n: comment to the previous timezone 10654 #: kdecore/TIMEZONES:612 10655 #, kde-format 10656 msgid "Thule/Pituffik" 10657 msgstr "" 10658 10659 #: kdecore/TIMEZONES:613 10660 #, kde-format 10661 msgid "America/Thunder_Bay" 10662 msgstr "अमेरिका/थन्डरबे" 10663 10664 #. i18n: comment to the previous timezone 10665 #: kdecore/TIMEZONES:615 10666 #, kde-format 10667 msgid "Eastern Time - Thunder Bay, Ontario" 10668 msgstr "" 10669 10670 #. i18n: comment to the previous timezone 10671 #: kdecore/TIMEZONES:617 10672 #, kde-format 10673 msgid "Eastern - ON (Thunder Bay)" 10674 msgstr "" 10675 10676 #: kdecore/TIMEZONES:618 10677 #, kde-format 10678 msgid "America/Tijuana" 10679 msgstr "अमेरिका/टिजुवाना" 10680 10681 #. i18n: comment to the previous timezone 10682 #: kdecore/TIMEZONES:622 10683 #, kde-format 10684 msgid "US Pacific Time - Baja California near US border" 10685 msgstr "" 10686 10687 #. i18n: comment to the previous timezone 10688 #: kdecore/TIMEZONES:624 10689 #, kde-format 10690 msgid "Pacific Time US - Baja California" 10691 msgstr "" 10692 10693 #: kdecore/TIMEZONES:625 10694 #, kde-format 10695 msgid "America/Toronto" 10696 msgstr "अमेरिका/टोरोन्टो" 10697 10698 #. i18n: comment to the previous timezone 10699 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10700 #, kde-format 10701 msgid "Eastern Time - Ontario - most locations" 10702 msgstr "" 10703 10704 #. i18n: comment to the previous timezone 10705 #: kdecore/TIMEZONES:629 10706 #, kde-format 10707 msgid "Eastern - ON, QC (most areas)" 10708 msgstr "" 10709 10710 #: kdecore/TIMEZONES:630 10711 #, kde-format 10712 msgid "America/Tortola" 10713 msgstr "अमेरिका/टोर्टोला" 10714 10715 #: kdecore/TIMEZONES:631 10716 #, kde-format 10717 msgid "America/Vancouver" 10718 msgstr "अमेरिका/भानकोवर" 10719 10720 #. i18n: comment to the previous timezone 10721 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10722 #, kde-format 10723 msgid "Pacific Time - west British Columbia" 10724 msgstr "" 10725 10726 #. i18n: comment to the previous timezone 10727 #: kdecore/TIMEZONES:635 10728 #, kde-format 10729 msgid "Pacific - BC (most areas)" 10730 msgstr "" 10731 10732 #: kdecore/TIMEZONES:636 10733 #, fuzzy, kde-format 10734 #| msgid "America/Regina" 10735 msgid "America/Virgin" 10736 msgstr "अमेरिका/रेजिना" 10737 10738 #: kdecore/TIMEZONES:637 10739 #, kde-format 10740 msgid "America/Whitehorse" 10741 msgstr "अमेरिका/ह्वाइटहर्स" 10742 10743 #. i18n: comment to the previous timezone 10744 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10745 #, kde-format 10746 msgid "Pacific Time - south Yukon" 10747 msgstr "" 10748 10749 #. i18n: comment to the previous timezone 10750 #: kdecore/TIMEZONES:641 10751 #, kde-format 10752 msgid "MST - Yukon (east)" 10753 msgstr "" 10754 10755 #: kdecore/TIMEZONES:642 10756 #, kde-format 10757 msgid "America/Winnipeg" 10758 msgstr "अमेरिका/विन्निपेग" 10759 10760 #. i18n: comment to the previous timezone 10761 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10762 #, kde-format 10763 msgid "Central Time - Manitoba & west Ontario" 10764 msgstr "" 10765 10766 #. i18n: comment to the previous timezone 10767 #: kdecore/TIMEZONES:646 10768 #, kde-format 10769 msgid "Central - ON (west); Manitoba" 10770 msgstr "" 10771 10772 #: kdecore/TIMEZONES:647 10773 #, kde-format 10774 msgid "America/Yakutat" 10775 msgstr "अमेरिका/याकुटाट" 10776 10777 #. i18n: comment to the previous timezone 10778 #: kdecore/TIMEZONES:649 10779 #, kde-format 10780 msgid "Alaska Time - Alaska panhandle neck" 10781 msgstr "" 10782 10783 #. i18n: comment to the previous timezone 10784 #: kdecore/TIMEZONES:651 10785 #, kde-format 10786 msgid "Alaska - Yakutat" 10787 msgstr "" 10788 10789 #: kdecore/TIMEZONES:652 10790 #, kde-format 10791 msgid "America/Yellowknife" 10792 msgstr "अमेरिका/येलोनाइफ" 10793 10794 #. i18n: comment to the previous timezone 10795 #: kdecore/TIMEZONES:654 10796 #, kde-format 10797 msgid "Mountain Time - central Northwest Territories" 10798 msgstr "" 10799 10800 #. i18n: comment to the previous timezone 10801 #: kdecore/TIMEZONES:656 10802 #, kde-format 10803 msgid "Mountain - NT (central)" 10804 msgstr "" 10805 10806 #: kdecore/TIMEZONES:657 10807 #, kde-format 10808 msgid "Antarctica/Casey" 10809 msgstr "अन्टार्कटिका/क्यासे" 10810 10811 #. i18n: comment to the previous timezone 10812 #: kdecore/TIMEZONES:659 10813 #, kde-format 10814 msgid "Casey Station, Bailey Peninsula" 10815 msgstr "" 10816 10817 #. i18n: comment to the previous timezone 10818 #: kdecore/TIMEZONES:661 10819 #, kde-format 10820 msgid "Casey" 10821 msgstr "" 10822 10823 #: kdecore/TIMEZONES:662 10824 #, kde-format 10825 msgid "Antarctica/Davis" 10826 msgstr "अन्टार्कटिका/डेभिस्" 10827 10828 #. i18n: comment to the previous timezone 10829 #: kdecore/TIMEZONES:664 10830 #, kde-format 10831 msgid "Davis Station, Vestfold Hills" 10832 msgstr "" 10833 10834 #. i18n: comment to the previous timezone 10835 #: kdecore/TIMEZONES:666 10836 #, kde-format 10837 msgid "Davis" 10838 msgstr "" 10839 10840 #: kdecore/TIMEZONES:667 10841 #, kde-format 10842 msgid "Antarctica/DumontDUrville" 10843 msgstr "अन्टार्कटिका/DumontDUrville" 10844 10845 #. i18n: comment to the previous timezone 10846 #: kdecore/TIMEZONES:669 10847 #, kde-format 10848 msgid "Dumont-d'Urville Station, Terre Adelie" 10849 msgstr "" 10850 10851 #. i18n: comment to the previous timezone 10852 #: kdecore/TIMEZONES:671 10853 #, fuzzy, kde-format 10854 #| msgid "Antarctica/DumontDUrville" 10855 msgid "Dumont-d'Urville" 10856 msgstr "अन्टार्कटिका/DumontDUrville" 10857 10858 #: kdecore/TIMEZONES:672 10859 #, fuzzy, kde-format 10860 #| msgid "Antarctica/McMurdo" 10861 msgid "Antarctica/Macquarie" 10862 msgstr "अन्टार्कटिका/म्याकमर्डो" 10863 10864 #. i18n: comment to the previous timezone 10865 #: kdecore/TIMEZONES:674 10866 #, kde-format 10867 msgid "Macquarie Island Station, Macquarie Island" 10868 msgstr "" 10869 10870 #. i18n: comment to the previous timezone 10871 #: kdecore/TIMEZONES:676 10872 #, kde-format 10873 msgid "Macquarie Island" 10874 msgstr "" 10875 10876 #: kdecore/TIMEZONES:677 10877 #, kde-format 10878 msgid "Antarctica/Mawson" 10879 msgstr "अन्टार्कटिका/म्वासन" 10880 10881 #. i18n: comment to the previous timezone 10882 #: kdecore/TIMEZONES:679 10883 #, kde-format 10884 msgid "Mawson Station, Holme Bay" 10885 msgstr "" 10886 10887 #. i18n: comment to the previous timezone 10888 #: kdecore/TIMEZONES:681 10889 #, kde-format 10890 msgid "Mawson" 10891 msgstr "" 10892 10893 #: kdecore/TIMEZONES:682 10894 #, kde-format 10895 msgid "Antarctica/McMurdo" 10896 msgstr "अन्टार्कटिका/म्याकमर्डो" 10897 10898 #. i18n: comment to the previous timezone 10899 #: kdecore/TIMEZONES:684 10900 #, kde-format 10901 msgid "McMurdo Station, Ross Island" 10902 msgstr "" 10903 10904 #. i18n: comment to the previous timezone 10905 #: kdecore/TIMEZONES:686 10906 #, kde-format 10907 msgid "New Zealand time - McMurdo, South Pole" 10908 msgstr "" 10909 10910 #: kdecore/TIMEZONES:687 10911 #, kde-format 10912 msgid "Antarctica/Palmer" 10913 msgstr "अन्टार्कटिका/पाल्मर" 10914 10915 #. i18n: comment to the previous timezone 10916 #: kdecore/TIMEZONES:689 10917 #, kde-format 10918 msgid "Palmer Station, Anvers Island" 10919 msgstr "" 10920 10921 #. i18n: comment to the previous timezone 10922 #: kdecore/TIMEZONES:691 10923 #, kde-format 10924 msgid "Palmer" 10925 msgstr "" 10926 10927 #: kdecore/TIMEZONES:692 10928 #, kde-format 10929 msgid "Antarctica/Rothera" 10930 msgstr "एन्टार्कटिका/रोथेरा" 10931 10932 #. i18n: comment to the previous timezone 10933 #: kdecore/TIMEZONES:694 10934 #, kde-format 10935 msgid "Rothera Station, Adelaide Island" 10936 msgstr "" 10937 10938 #. i18n: comment to the previous timezone 10939 #: kdecore/TIMEZONES:696 10940 #, kde-format 10941 msgid "Rothera" 10942 msgstr "" 10943 10944 #: kdecore/TIMEZONES:697 10945 #, kde-format 10946 msgid "Antarctica/South_Pole" 10947 msgstr "अन्टार्कटिका/साउथ पोल" 10948 10949 #. i18n: comment to the previous timezone 10950 #: kdecore/TIMEZONES:699 10951 #, kde-format 10952 msgid "Amundsen-Scott Station, South Pole" 10953 msgstr "" 10954 10955 #: kdecore/TIMEZONES:700 10956 #, kde-format 10957 msgid "Antarctica/Syowa" 10958 msgstr "अन्टार्कटिका/सायोवा" 10959 10960 #. i18n: comment to the previous timezone 10961 #: kdecore/TIMEZONES:702 10962 #, kde-format 10963 msgid "Syowa Station, E Ongul I" 10964 msgstr "" 10965 10966 #. i18n: comment to the previous timezone 10967 #: kdecore/TIMEZONES:704 10968 #, kde-format 10969 msgid "Syowa" 10970 msgstr "" 10971 10972 #: kdecore/TIMEZONES:705 10973 #, fuzzy, kde-format 10974 #| msgid "Antarctica/McMurdo" 10975 msgid "Antarctica/Troll" 10976 msgstr "अन्टार्कटिका/म्याकमर्डो" 10977 10978 #. i18n: comment to the previous timezone 10979 #: kdecore/TIMEZONES:707 10980 #, kde-format 10981 msgid "Troll" 10982 msgstr "" 10983 10984 #: kdecore/TIMEZONES:708 10985 #, kde-format 10986 msgid "Antarctica/Vostok" 10987 msgstr "अन्टार्कटिका/वोस्टोक" 10988 10989 #. i18n: comment to the previous timezone 10990 #: kdecore/TIMEZONES:710 10991 #, kde-format 10992 msgid "Vostok Station, S Magnetic Pole" 10993 msgstr "" 10994 10995 #. i18n: comment to the previous timezone 10996 #: kdecore/TIMEZONES:712 10997 #, kde-format 10998 msgid "Vostok Station, Lake Vostok" 10999 msgstr "" 11000 11001 #. i18n: comment to the previous timezone 11002 #: kdecore/TIMEZONES:714 11003 #, kde-format 11004 msgid "Vostok" 11005 msgstr "" 11006 11007 #: kdecore/TIMEZONES:715 11008 #, kde-format 11009 msgid "Arctic/Longyearbyen" 11010 msgstr "आर्कटिक/लङ्गएयरबेन" 11011 11012 #: kdecore/TIMEZONES:716 11013 #, kde-format 11014 msgid "Asia/Aden" 11015 msgstr "एशिया/एडेन" 11016 11017 #: kdecore/TIMEZONES:717 11018 #, kde-format 11019 msgid "Asia/Almaty" 11020 msgstr "एशिया/अल्म्याटी" 11021 11022 #. i18n: comment to the previous timezone 11023 #: kdecore/TIMEZONES:721 11024 #, kde-format 11025 msgid "Kazakhstan (most areas)" 11026 msgstr "" 11027 11028 #: kdecore/TIMEZONES:722 11029 #, kde-format 11030 msgid "Asia/Amman" 11031 msgstr "एशिया/अम्मान" 11032 11033 #: kdecore/TIMEZONES:723 11034 #, kde-format 11035 msgid "Asia/Anadyr" 11036 msgstr "एशिया/अन्डेर" 11037 11038 #. i18n: comment to the previous timezone 11039 #: kdecore/TIMEZONES:725 11040 #, kde-format 11041 msgid "Moscow+10 - Bering Sea" 11042 msgstr "" 11043 11044 #. i18n: comment to the previous timezone 11045 #: kdecore/TIMEZONES:727 11046 #, kde-format 11047 msgid "Moscow+08 - Bering Sea" 11048 msgstr "" 11049 11050 #. i18n: comment to the previous timezone 11051 #: kdecore/TIMEZONES:729 11052 #, kde-format 11053 msgid "MSK+09 - Bering Sea" 11054 msgstr "" 11055 11056 #: kdecore/TIMEZONES:730 11057 #, kde-format 11058 msgid "Asia/Aqtau" 11059 msgstr "एशिया/अक्टो" 11060 11061 #. i18n: comment to the previous timezone 11062 #: kdecore/TIMEZONES:732 11063 #, kde-format 11064 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11065 msgstr "" 11066 11067 #. i18n: comment to the previous timezone 11068 #: kdecore/TIMEZONES:734 11069 #, kde-format 11070 msgid "Mangghystau/Mankistau" 11071 msgstr "" 11072 11073 #: kdecore/TIMEZONES:735 11074 #, kde-format 11075 msgid "Asia/Aqtobe" 11076 msgstr "एशिया/अक्टोबे" 11077 11078 #. i18n: comment to the previous timezone 11079 #: kdecore/TIMEZONES:737 11080 #, kde-format 11081 msgid "Aqtobe (Aktobe)" 11082 msgstr "" 11083 11084 #. i18n: comment to the previous timezone 11085 #: kdecore/TIMEZONES:739 11086 #, kde-format 11087 msgid "Aqtobe/Aktobe" 11088 msgstr "" 11089 11090 #: kdecore/TIMEZONES:740 11091 #, kde-format 11092 msgid "Asia/Ashgabat" 11093 msgstr "एशिया/आश्गाबाट" 11094 11095 #: kdecore/TIMEZONES:741 11096 #, fuzzy, kde-format 11097 #| msgid "Asia/Ashgabat" 11098 msgid "Asia/Ashkhabad" 11099 msgstr "एशिया/आश्गाबाट" 11100 11101 #: kdecore/TIMEZONES:742 11102 #, fuzzy, kde-format 11103 #| msgid "Asia/Aqtau" 11104 msgid "Asia/Atyrau" 11105 msgstr "एशिया/अक्टो" 11106 11107 #. i18n: comment to the previous timezone 11108 #: kdecore/TIMEZONES:744 11109 #, kde-format 11110 msgid "Atyrau/Atirau/Gur'yev" 11111 msgstr "" 11112 11113 #: kdecore/TIMEZONES:745 11114 #, kde-format 11115 msgid "Asia/Baghdad" 11116 msgstr "एशिया/बग्दाद" 11117 11118 #: kdecore/TIMEZONES:746 11119 #, kde-format 11120 msgid "Asia/Bahrain" 11121 msgstr "एशिया/बहराइन" 11122 11123 #: kdecore/TIMEZONES:747 11124 #, kde-format 11125 msgid "Asia/Baku" 11126 msgstr "एशिया/बाकु" 11127 11128 #: kdecore/TIMEZONES:748 11129 #, kde-format 11130 msgid "Asia/Bangkok" 11131 msgstr "एशिया/ब्याङ्कक" 11132 11133 #: kdecore/TIMEZONES:749 11134 #, fuzzy, kde-format 11135 #| msgid "Asia/Baku" 11136 msgid "Asia/Barnaul" 11137 msgstr "एशिया/बाकु" 11138 11139 #. i18n: comment to the previous timezone 11140 #: kdecore/TIMEZONES:751 11141 #, kde-format 11142 msgid "MSK+04 - Altai" 11143 msgstr "" 11144 11145 #: kdecore/TIMEZONES:752 11146 #, fuzzy, kde-format 11147 #| msgid "Asia/Beirut" 11148 msgid "Asia/Beijing" 11149 msgstr "एशिया/बेरुत" 11150 11151 #. i18n: comment to the previous timezone 11152 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11153 #, kde-format 11154 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11155 msgstr "" 11156 11157 #. i18n: comment to the previous timezone 11158 #: kdecore/TIMEZONES:756 11159 #, kde-format 11160 msgid "China Standard Time" 11161 msgstr "" 11162 11163 #: kdecore/TIMEZONES:757 11164 #, kde-format 11165 msgid "Asia/Beirut" 11166 msgstr "एशिया/बेरुत" 11167 11168 #: kdecore/TIMEZONES:758 11169 #, kde-format 11170 msgid "Asia/Bishkek" 11171 msgstr "एशिया/बिसकेक" 11172 11173 #: kdecore/TIMEZONES:759 11174 #, kde-format 11175 msgid "Asia/Brunei" 11176 msgstr "एशिया/ब्रुनाई" 11177 11178 #: kdecore/TIMEZONES:760 11179 #, kde-format 11180 msgid "Asia/Calcutta" 11181 msgstr "एशिया/कलकत्ता" 11182 11183 #: kdecore/TIMEZONES:761 11184 #, fuzzy, kde-format 11185 #| msgid "Asia/Choibalsan" 11186 msgid "Asia/Chita" 11187 msgstr "एशिया/चोइबालसान" 11188 11189 #. i18n: comment to the previous timezone 11190 #: kdecore/TIMEZONES:763 11191 #, kde-format 11192 msgid "MSK+06 - Zabaykalsky" 11193 msgstr "" 11194 11195 #: kdecore/TIMEZONES:764 11196 #, kde-format 11197 msgid "Asia/Choibalsan" 11198 msgstr "एशिया/चोइबालसान" 11199 11200 #. i18n: comment to the previous timezone 11201 #: kdecore/TIMEZONES:766 11202 #, kde-format 11203 msgid "Dornod, Sukhbaatar" 11204 msgstr "" 11205 11206 #: kdecore/TIMEZONES:767 11207 #, kde-format 11208 msgid "Asia/Chongqing" 11209 msgstr "एशिया/चोङ्किङ्" 11210 11211 #. i18n: comment to the previous timezone 11212 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11213 #, kde-format 11214 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11215 msgstr "" 11216 11217 #. i18n: comment to the previous timezone 11218 #: kdecore/TIMEZONES:771 11219 #, kde-format 11220 msgid "China mountains" 11221 msgstr "" 11222 11223 #: kdecore/TIMEZONES:772 11224 #, fuzzy, kde-format 11225 #| msgid "Asia/Chongqing" 11226 msgid "Asia/Chungking" 11227 msgstr "एशिया/चोङ्किङ्" 11228 11229 #: kdecore/TIMEZONES:775 11230 #, kde-format 11231 msgid "Asia/Colombo" 11232 msgstr "एशिया/कोलम्बो" 11233 11234 #: kdecore/TIMEZONES:776 11235 #, fuzzy, kde-format 11236 #| msgid "Asia/Dhaka" 11237 msgid "Asia/Dacca" 11238 msgstr "एशिया/ढाका" 11239 11240 #: kdecore/TIMEZONES:777 11241 #, kde-format 11242 msgid "Asia/Damascus" 11243 msgstr "एशिया/दमास्कस" 11244 11245 #: kdecore/TIMEZONES:778 11246 #, kde-format 11247 msgid "Asia/Dhaka" 11248 msgstr "एशिया/ढाका" 11249 11250 #: kdecore/TIMEZONES:779 11251 #, kde-format 11252 msgid "Asia/Dili" 11253 msgstr "एशिया/दिलि" 11254 11255 #: kdecore/TIMEZONES:780 11256 #, kde-format 11257 msgid "Asia/Dubai" 11258 msgstr "एशिया/दुबाई" 11259 11260 #: kdecore/TIMEZONES:781 11261 #, fuzzy, kde-format 11262 #| msgid "Do shanbe" 11263 msgid "Asia/Dushanbe" 11264 msgstr "डो शान्बे" 11265 11266 #: kdecore/TIMEZONES:782 11267 #, fuzzy, kde-format 11268 #| msgid "Asia/Damascus" 11269 msgid "Asia/Famagusta" 11270 msgstr "एशिया/दमास्कस" 11271 11272 #. i18n: comment to the previous timezone 11273 #: kdecore/TIMEZONES:784 11274 #, kde-format 11275 msgid "Northern Cyprus" 11276 msgstr "" 11277 11278 #: kdecore/TIMEZONES:785 11279 #, kde-format 11280 msgid "Asia/Gaza" 11281 msgstr "एशिया/गाजा" 11282 11283 #. i18n: comment to the previous timezone 11284 #: kdecore/TIMEZONES:787 11285 #, kde-format 11286 msgid "Gaza Strip" 11287 msgstr "" 11288 11289 #: kdecore/TIMEZONES:788 11290 #, kde-format 11291 msgid "Asia/Harbin" 11292 msgstr "एशिया/हर्बिन" 11293 11294 #. i18n: comment to the previous timezone 11295 #: kdecore/TIMEZONES:790 11296 #, kde-format 11297 msgid "Heilongjiang (except Mohe), Jilin" 11298 msgstr "" 11299 11300 #. i18n: comment to the previous timezone 11301 #: kdecore/TIMEZONES:792 11302 #, kde-format 11303 msgid "China north" 11304 msgstr "" 11305 11306 #: kdecore/TIMEZONES:793 11307 #, fuzzy, kde-format 11308 #| msgid "Asia/Harbin" 11309 msgid "Asia/Hebron" 11310 msgstr "एशिया/हर्बिन" 11311 11312 #. i18n: comment to the previous timezone 11313 #: kdecore/TIMEZONES:795 11314 #, kde-format 11315 msgid "West Bank" 11316 msgstr "" 11317 11318 #: kdecore/TIMEZONES:796 11319 #, fuzzy, kde-format 11320 #| msgid "Asia/Chongqing" 11321 msgid "Asia/Ho_Chi_Minh" 11322 msgstr "एशिया/चोङ्किङ्" 11323 11324 #: kdecore/TIMEZONES:797 11325 #, kde-format 11326 msgid "Asia/Hong_Kong" 11327 msgstr "एशिया/हङ्गकङ्ग" 11328 11329 #: kdecore/TIMEZONES:798 11330 #, kde-format 11331 msgid "Asia/Hovd" 11332 msgstr "एशिया/होव्द" 11333 11334 #. i18n: comment to the previous timezone 11335 #: kdecore/TIMEZONES:800 11336 #, kde-format 11337 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11338 msgstr "" 11339 11340 #: kdecore/TIMEZONES:801 11341 #, kde-format 11342 msgid "Asia/Irkutsk" 11343 msgstr "एशिया/इर्कुत्स्क" 11344 11345 #. i18n: comment to the previous timezone 11346 #: kdecore/TIMEZONES:803 11347 #, kde-format 11348 msgid "Moscow+05 - Lake Baikal" 11349 msgstr "" 11350 11351 #. i18n: comment to the previous timezone 11352 #: kdecore/TIMEZONES:805 11353 #, kde-format 11354 msgid "MSK+05 - Irkutsk, Buryatia" 11355 msgstr "" 11356 11357 #: kdecore/TIMEZONES:806 11358 #, kde-format 11359 msgid "Asia/Jakarta" 11360 msgstr "एशिया/जाकर्ता" 11361 11362 #. i18n: comment to the previous timezone 11363 #: kdecore/TIMEZONES:808 11364 #, kde-format 11365 msgid "Java & Sumatra" 11366 msgstr "" 11367 11368 #. i18n: comment to the previous timezone 11369 #: kdecore/TIMEZONES:810 11370 #, kde-format 11371 msgid "Java, Sumatra" 11372 msgstr "" 11373 11374 #: kdecore/TIMEZONES:811 11375 #, kde-format 11376 msgid "Asia/Jayapura" 11377 msgstr "एशिया/जयपुरा" 11378 11379 #. i18n: comment to the previous timezone 11380 #: kdecore/TIMEZONES:813 11381 #, kde-format 11382 msgid "Irian Jaya & the Moluccas" 11383 msgstr "" 11384 11385 #. i18n: comment to the previous timezone 11386 #: kdecore/TIMEZONES:815 11387 #, kde-format 11388 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11389 msgstr "" 11390 11391 #. i18n: comment to the previous timezone 11392 #: kdecore/TIMEZONES:817 11393 #, kde-format 11394 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11395 msgstr "" 11396 11397 #: kdecore/TIMEZONES:818 11398 #, kde-format 11399 msgid "Asia/Jerusalem" 11400 msgstr "एशिया/जेरुसलेम" 11401 11402 #: kdecore/TIMEZONES:819 11403 #, kde-format 11404 msgid "Asia/Kabul" 11405 msgstr "एशिया/काबुल" 11406 11407 #: kdecore/TIMEZONES:820 11408 #, kde-format 11409 msgid "Asia/Kamchatka" 11410 msgstr "एशिया/कामचट्का" 11411 11412 #. i18n: comment to the previous timezone 11413 #: kdecore/TIMEZONES:822 11414 #, kde-format 11415 msgid "Moscow+09 - Kamchatka" 11416 msgstr "" 11417 11418 #. i18n: comment to the previous timezone 11419 #: kdecore/TIMEZONES:824 11420 #, kde-format 11421 msgid "Moscow+08 - Kamchatka" 11422 msgstr "" 11423 11424 #. i18n: comment to the previous timezone 11425 #: kdecore/TIMEZONES:826 11426 #, kde-format 11427 msgid "MSK+09 - Kamchatka" 11428 msgstr "" 11429 11430 #: kdecore/TIMEZONES:827 11431 #, kde-format 11432 msgid "Asia/Karachi" 11433 msgstr "एशिया/कराची" 11434 11435 #: kdecore/TIMEZONES:828 11436 #, kde-format 11437 msgid "Asia/Kashgar" 11438 msgstr "एशिया/कस्गार" 11439 11440 #. i18n: comment to the previous timezone 11441 #: kdecore/TIMEZONES:830 11442 #, kde-format 11443 msgid "west Tibet & Xinjiang" 11444 msgstr "" 11445 11446 #. i18n: comment to the previous timezone 11447 #: kdecore/TIMEZONES:832 11448 #, kde-format 11449 msgid "China west Xinjiang" 11450 msgstr "" 11451 11452 #: kdecore/TIMEZONES:833 11453 #, fuzzy, kde-format 11454 #| msgid "Asia/Katmandu" 11455 msgid "Asia/Kathmandu" 11456 msgstr "एशिया/काठमाडौँ" 11457 11458 #: kdecore/TIMEZONES:834 11459 #, kde-format 11460 msgid "Asia/Katmandu" 11461 msgstr "एशिया/काठमाडौँ" 11462 11463 #: kdecore/TIMEZONES:835 11464 #, fuzzy, kde-format 11465 #| msgid "Asia/Shanghai" 11466 msgid "Asia/Khandyga" 11467 msgstr "एशिया/साङ्घाइ" 11468 11469 #. i18n: comment to the previous timezone 11470 #: kdecore/TIMEZONES:837 11471 #, kde-format 11472 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11473 msgstr "" 11474 11475 #: kdecore/TIMEZONES:838 11476 #, fuzzy, kde-format 11477 #| msgid "Asia/Jakarta" 11478 msgid "Asia/Kolkata" 11479 msgstr "एशिया/जाकर्ता" 11480 11481 #: kdecore/TIMEZONES:839 11482 #, kde-format 11483 msgid "Asia/Krasnoyarsk" 11484 msgstr "एशिया/क्रस्नोयार्स्क" 11485 11486 #. i18n: comment to the previous timezone 11487 #: kdecore/TIMEZONES:841 11488 #, kde-format 11489 msgid "Moscow+04 - Yenisei River" 11490 msgstr "" 11491 11492 #. i18n: comment to the previous timezone 11493 #: kdecore/TIMEZONES:843 11494 #, kde-format 11495 msgid "MSK+04 - Krasnoyarsk area" 11496 msgstr "" 11497 11498 #: kdecore/TIMEZONES:844 11499 #, kde-format 11500 msgid "Asia/Kuala_Lumpur" 11501 msgstr "एशिया/क्लवालालम्पुर" 11502 11503 #. i18n: comment to the previous timezone 11504 #: kdecore/TIMEZONES:846 11505 #, kde-format 11506 msgid "peninsular Malaysia" 11507 msgstr "" 11508 11509 #. i18n: comment to the previous timezone 11510 #: kdecore/TIMEZONES:848 11511 #, kde-format 11512 msgid "Malaysia (peninsula)" 11513 msgstr "" 11514 11515 #: kdecore/TIMEZONES:849 11516 #, kde-format 11517 msgid "Asia/Kuching" 11518 msgstr "एशिया/कुचिङ्" 11519 11520 #. i18n: comment to the previous timezone 11521 #: kdecore/TIMEZONES:851 11522 #, kde-format 11523 msgid "Sabah & Sarawak" 11524 msgstr "" 11525 11526 #. i18n: comment to the previous timezone 11527 #: kdecore/TIMEZONES:853 11528 #, kde-format 11529 msgid "Sabah, Sarawak" 11530 msgstr "" 11531 11532 #: kdecore/TIMEZONES:854 11533 #, kde-format 11534 msgid "Asia/Kuwait" 11535 msgstr "एशिया/कुवेत" 11536 11537 #: kdecore/TIMEZONES:855 11538 #, fuzzy, kde-format 11539 #| msgid "Asia/Macau" 11540 msgid "Asia/Macao" 11541 msgstr "एशिया/म्याक्यु" 11542 11543 #: kdecore/TIMEZONES:856 11544 #, kde-format 11545 msgid "Asia/Macau" 11546 msgstr "एशिया/म्याक्यु" 11547 11548 #: kdecore/TIMEZONES:857 11549 #, kde-format 11550 msgid "Asia/Magadan" 11551 msgstr "एशिया/मगदान" 11552 11553 #. i18n: comment to the previous timezone 11554 #: kdecore/TIMEZONES:859 11555 #, kde-format 11556 msgid "Moscow+08 - Magadan" 11557 msgstr "" 11558 11559 #. i18n: comment to the previous timezone 11560 #: kdecore/TIMEZONES:861 11561 #, kde-format 11562 msgid "MSK+08 - Magadan" 11563 msgstr "" 11564 11565 #: kdecore/TIMEZONES:862 11566 #, kde-format 11567 msgid "Asia/Makassar" 11568 msgstr "एशिया/मकासार" 11569 11570 #. i18n: comment to the previous timezone 11571 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11572 #, kde-format 11573 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11574 msgstr "" 11575 11576 #. i18n: comment to the previous timezone 11577 #: kdecore/TIMEZONES:866 11578 #, kde-format 11579 msgid "" 11580 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11581 msgstr "" 11582 11583 #. i18n: comment to the previous timezone 11584 #: kdecore/TIMEZONES:868 11585 #, kde-format 11586 msgid "" 11587 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11588 msgstr "" 11589 11590 #: kdecore/TIMEZONES:869 11591 #, kde-format 11592 msgid "Asia/Manila" 11593 msgstr "एशिया/मनिला" 11594 11595 #: kdecore/TIMEZONES:870 11596 #, kde-format 11597 msgid "Asia/Muscat" 11598 msgstr "एशिया/मस्कट" 11599 11600 #: kdecore/TIMEZONES:871 11601 #, kde-format 11602 msgid "Asia/Nicosia" 11603 msgstr "एशिया/निकोसिया" 11604 11605 #. i18n: comment to the previous timezone 11606 #: kdecore/TIMEZONES:873 11607 #, kde-format 11608 msgid "Cyprus (most areas)" 11609 msgstr "" 11610 11611 #: kdecore/TIMEZONES:874 11612 #, fuzzy, kde-format 11613 #| msgid "Asia/Irkutsk" 11614 msgid "Asia/Novokuznetsk" 11615 msgstr "एशिया/इर्कुत्स्क" 11616 11617 #. i18n: comment to the previous timezone 11618 #: kdecore/TIMEZONES:876 11619 #, fuzzy, kde-format 11620 #| msgid "Asia/Novosibirsk" 11621 msgid "Moscow+03 - Novokuznetsk" 11622 msgstr "एशिया/नोवोसिब्रिस्क" 11623 11624 #. i18n: comment to the previous timezone 11625 #: kdecore/TIMEZONES:878 11626 #, kde-format 11627 msgid "MSK+04 - Kemerovo" 11628 msgstr "" 11629 11630 #: kdecore/TIMEZONES:879 11631 #, kde-format 11632 msgid "Asia/Novosibirsk" 11633 msgstr "एशिया/नोवोसिब्रिस्क" 11634 11635 #. i18n: comment to the previous timezone 11636 #: kdecore/TIMEZONES:881 11637 #, fuzzy, kde-format 11638 #| msgid "Asia/Novosibirsk" 11639 msgid "Moscow+03 - Novosibirsk" 11640 msgstr "एशिया/नोवोसिब्रिस्क" 11641 11642 #. i18n: comment to the previous timezone 11643 #: kdecore/TIMEZONES:883 11644 #, fuzzy, kde-format 11645 #| msgid "Asia/Novosibirsk" 11646 msgid "MSK+04 - Novosibirsk" 11647 msgstr "एशिया/नोवोसिब्रिस्क" 11648 11649 #: kdecore/TIMEZONES:884 11650 #, kde-format 11651 msgid "Asia/Omsk" 11652 msgstr "एशिया/ओम्स्क" 11653 11654 #. i18n: comment to the previous timezone 11655 #: kdecore/TIMEZONES:886 11656 #, kde-format 11657 msgid "Moscow+03 - west Siberia" 11658 msgstr "" 11659 11660 #. i18n: comment to the previous timezone 11661 #: kdecore/TIMEZONES:888 11662 #, kde-format 11663 msgid "MSK+03 - Omsk" 11664 msgstr "" 11665 11666 #: kdecore/TIMEZONES:889 11667 #, kde-format 11668 msgid "Asia/Oral" 11669 msgstr "एशिया/ओरल" 11670 11671 #. i18n: comment to the previous timezone 11672 #: kdecore/TIMEZONES:891 11673 #, kde-format 11674 msgid "West Kazakhstan" 11675 msgstr "" 11676 11677 #: kdecore/TIMEZONES:892 11678 #, kde-format 11679 msgid "Asia/Phnom_Penh" 11680 msgstr "एशिया/नोमपेह" 11681 11682 #: kdecore/TIMEZONES:893 11683 #, kde-format 11684 msgid "Asia/Pontianak" 11685 msgstr "एशिया/पोन्टियानक" 11686 11687 #. i18n: comment to the previous timezone 11688 #: kdecore/TIMEZONES:895 11689 #, kde-format 11690 msgid "west & central Borneo" 11691 msgstr "" 11692 11693 #. i18n: comment to the previous timezone 11694 #: kdecore/TIMEZONES:897 11695 #, kde-format 11696 msgid "Borneo (west, central)" 11697 msgstr "" 11698 11699 #: kdecore/TIMEZONES:898 11700 #, kde-format 11701 msgid "Asia/Pyongyang" 11702 msgstr "एशिया/प्योङ्याङ" 11703 11704 #: kdecore/TIMEZONES:899 11705 #, kde-format 11706 msgid "Asia/Qatar" 11707 msgstr "एशिया/कतार" 11708 11709 #: kdecore/TIMEZONES:900 11710 #, fuzzy, kde-format 11711 #| msgid "Asia/Pontianak" 11712 msgid "Asia/Qostanay" 11713 msgstr "एशिया/पोन्टियानक" 11714 11715 #. i18n: comment to the previous timezone 11716 #: kdecore/TIMEZONES:902 11717 #, kde-format 11718 msgid "Qostanay/Kostanay/Kustanay" 11719 msgstr "" 11720 11721 #: kdecore/TIMEZONES:903 11722 #, kde-format 11723 msgid "Asia/Qyzylorda" 11724 msgstr "एशिया/क्विजिलोर्दा" 11725 11726 #. i18n: comment to the previous timezone 11727 #: kdecore/TIMEZONES:905 11728 #, kde-format 11729 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11730 msgstr "" 11731 11732 #. i18n: comment to the previous timezone 11733 #: kdecore/TIMEZONES:907 11734 #, kde-format 11735 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11736 msgstr "" 11737 11738 #: kdecore/TIMEZONES:908 11739 #, kde-format 11740 msgid "Asia/Rangoon" 11741 msgstr "एशिया/रङ्गुन" 11742 11743 #: kdecore/TIMEZONES:909 11744 #, kde-format 11745 msgid "Asia/Riyadh" 11746 msgstr "एशिया/रियाद" 11747 11748 #: kdecore/TIMEZONES:910 11749 #, kde-format 11750 msgid "Asia/Saigon" 11751 msgstr "एशिया/सइगोन" 11752 11753 #: kdecore/TIMEZONES:911 11754 #, kde-format 11755 msgid "Asia/Sakhalin" 11756 msgstr "एशिया/सखलिन" 11757 11758 #. i18n: comment to the previous timezone 11759 #: kdecore/TIMEZONES:913 11760 #, kde-format 11761 msgid "Moscow+07 - Sakhalin Island" 11762 msgstr "" 11763 11764 #. i18n: comment to the previous timezone 11765 #: kdecore/TIMEZONES:915 11766 #, kde-format 11767 msgid "MSK+08 - Sakhalin Island" 11768 msgstr "" 11769 11770 #: kdecore/TIMEZONES:916 11771 #, kde-format 11772 msgid "Asia/Samarkand" 11773 msgstr "एशिया/समरकान्द" 11774 11775 #. i18n: comment to the previous timezone 11776 #: kdecore/TIMEZONES:918 11777 #, kde-format 11778 msgid "west Uzbekistan" 11779 msgstr "" 11780 11781 #. i18n: comment to the previous timezone 11782 #: kdecore/TIMEZONES:920 11783 #, kde-format 11784 msgid "Uzbekistan (west)" 11785 msgstr "" 11786 11787 #: kdecore/TIMEZONES:921 11788 #, kde-format 11789 msgid "Asia/Seoul" 11790 msgstr "एशिया/सिउल" 11791 11792 #: kdecore/TIMEZONES:922 11793 #, kde-format 11794 msgid "Asia/Shanghai" 11795 msgstr "एशिया/साङ्घाइ" 11796 11797 #. i18n: comment to the previous timezone 11798 #: kdecore/TIMEZONES:926 11799 #, kde-format 11800 msgid "China east" 11801 msgstr "" 11802 11803 #. i18n: comment to the previous timezone 11804 #: kdecore/TIMEZONES:928 11805 #, kde-format 11806 msgid "Beijing Time" 11807 msgstr "" 11808 11809 #: kdecore/TIMEZONES:929 11810 #, kde-format 11811 msgid "Asia/Singapore" 11812 msgstr "एशिया/सिङ्गापुर" 11813 11814 #: kdecore/TIMEZONES:930 11815 #, fuzzy, kde-format 11816 #| msgid "Asia/Krasnoyarsk" 11817 msgid "Asia/Srednekolymsk" 11818 msgstr "एशिया/क्रस्नोयार्स्क" 11819 11820 #. i18n: comment to the previous timezone 11821 #: kdecore/TIMEZONES:932 11822 #, kde-format 11823 msgid "MSK+08 - Sakha (E); North Kuril Is" 11824 msgstr "" 11825 11826 #: kdecore/TIMEZONES:933 11827 #, kde-format 11828 msgid "Asia/Taipei" 11829 msgstr "एशिया/ताइपेइ" 11830 11831 #: kdecore/TIMEZONES:934 11832 #, kde-format 11833 msgid "Asia/Tashkent" 11834 msgstr "एशिया/ताश्केन्ट" 11835 11836 #. i18n: comment to the previous timezone 11837 #: kdecore/TIMEZONES:936 11838 #, kde-format 11839 msgid "east Uzbekistan" 11840 msgstr "" 11841 11842 #. i18n: comment to the previous timezone 11843 #: kdecore/TIMEZONES:938 11844 #, kde-format 11845 msgid "Uzbekistan (east)" 11846 msgstr "" 11847 11848 #: kdecore/TIMEZONES:939 11849 #, kde-format 11850 msgid "Asia/Tbilisi" 11851 msgstr "एशिया/बिलिसी" 11852 11853 #: kdecore/TIMEZONES:940 11854 #, kde-format 11855 msgid "Asia/Tehran" 11856 msgstr "एशिया/तेहरान" 11857 11858 #: kdecore/TIMEZONES:941 11859 #, fuzzy, kde-format 11860 #| msgid "Asia/Taipei" 11861 msgid "Asia/Tel_Aviv" 11862 msgstr "एशिया/ताइपेइ" 11863 11864 #: kdecore/TIMEZONES:942 11865 #, fuzzy, kde-format 11866 #| msgid "Asia/Thimphu" 11867 msgid "Asia/Thimbu" 11868 msgstr "एशिया/थिम्पु" 11869 11870 #: kdecore/TIMEZONES:943 11871 #, kde-format 11872 msgid "Asia/Thimphu" 11873 msgstr "एशिया/थिम्पु" 11874 11875 #: kdecore/TIMEZONES:944 11876 #, kde-format 11877 msgid "Asia/Tokyo" 11878 msgstr "एशिया/टोकियो" 11879 11880 #: kdecore/TIMEZONES:945 11881 #, fuzzy, kde-format 11882 #| msgid "Asia/Omsk" 11883 msgid "Asia/Tomsk" 11884 msgstr "एशिया/ओम्स्क" 11885 11886 #. i18n: comment to the previous timezone 11887 #: kdecore/TIMEZONES:947 11888 #, kde-format 11889 msgid "MSK+04 - Tomsk" 11890 msgstr "" 11891 11892 #: kdecore/TIMEZONES:948 11893 #, kde-format 11894 msgid "Asia/Ujung_Pandang" 11895 msgstr "एशिया/उजुङ्ग पानडाङ" 11896 11897 #: kdecore/TIMEZONES:951 11898 #, kde-format 11899 msgid "Asia/Ulaanbaatar" 11900 msgstr "एशिया/उल्लनबटर" 11901 11902 #. i18n: comment to the previous timezone 11903 #: kdecore/TIMEZONES:955 11904 #, kde-format 11905 msgid "Mongolia (most areas)" 11906 msgstr "" 11907 11908 #: kdecore/TIMEZONES:956 11909 #, fuzzy, kde-format 11910 #| msgid "Asia/Ulaanbaatar" 11911 msgid "Asia/Ulan_Bator" 11912 msgstr "एशिया/उल्लनबटर" 11913 11914 #: kdecore/TIMEZONES:959 11915 #, kde-format 11916 msgid "Asia/Urumqi" 11917 msgstr "एशिया/उरुम्की" 11918 11919 #. i18n: comment to the previous timezone 11920 #: kdecore/TIMEZONES:961 11921 #, kde-format 11922 msgid "most of Tibet & Xinjiang" 11923 msgstr "" 11924 11925 #. i18n: comment to the previous timezone 11926 #: kdecore/TIMEZONES:963 11927 #, kde-format 11928 msgid "China Xinjiang-Tibet" 11929 msgstr "" 11930 11931 #. i18n: comment to the previous timezone 11932 #: kdecore/TIMEZONES:965 11933 #, kde-format 11934 msgid "Xinjiang Time" 11935 msgstr "" 11936 11937 #: kdecore/TIMEZONES:966 11938 #, fuzzy, kde-format 11939 #| msgid "Asia/Tehran" 11940 msgid "Asia/Ust-Nera" 11941 msgstr "एशिया/तेहरान" 11942 11943 #. i18n: comment to the previous timezone 11944 #: kdecore/TIMEZONES:968 11945 #, kde-format 11946 msgid "MSK+07 - Oymyakonsky" 11947 msgstr "" 11948 11949 #: kdecore/TIMEZONES:969 11950 #, kde-format 11951 msgid "Asia/Vientiane" 11952 msgstr "एशिया/भियनटिन" 11953 11954 #: kdecore/TIMEZONES:970 11955 #, kde-format 11956 msgid "Asia/Vladivostok" 11957 msgstr "एशिया/ब्लाडिवोस्टोक" 11958 11959 #. i18n: comment to the previous timezone 11960 #: kdecore/TIMEZONES:972 11961 #, kde-format 11962 msgid "Moscow+07 - Amur River" 11963 msgstr "" 11964 11965 #. i18n: comment to the previous timezone 11966 #: kdecore/TIMEZONES:974 11967 #, kde-format 11968 msgid "MSK+07 - Amur River" 11969 msgstr "" 11970 11971 #: kdecore/TIMEZONES:975 11972 #, kde-format 11973 msgid "Asia/Yakutsk" 11974 msgstr "एशिया/याकुत्सक" 11975 11976 #. i18n: comment to the previous timezone 11977 #: kdecore/TIMEZONES:977 11978 #, kde-format 11979 msgid "Moscow+06 - Lena River" 11980 msgstr "" 11981 11982 #. i18n: comment to the previous timezone 11983 #: kdecore/TIMEZONES:979 11984 #, kde-format 11985 msgid "MSK+06 - Lena River" 11986 msgstr "" 11987 11988 #: kdecore/TIMEZONES:980 11989 #, fuzzy, kde-format 11990 #| msgid "Asia/Rangoon" 11991 msgid "Asia/Yangon" 11992 msgstr "एशिया/रङ्गुन" 11993 11994 #: kdecore/TIMEZONES:981 11995 #, kde-format 11996 msgid "Asia/Yekaterinburg" 11997 msgstr "एशिया/येकाटरिनबर्ग" 11998 11999 #. i18n: comment to the previous timezone 12000 #: kdecore/TIMEZONES:983 12001 #, kde-format 12002 msgid "Moscow+02 - Urals" 12003 msgstr "" 12004 12005 #. i18n: comment to the previous timezone 12006 #: kdecore/TIMEZONES:985 12007 #, kde-format 12008 msgid "MSK+02 - Urals" 12009 msgstr "" 12010 12011 #: kdecore/TIMEZONES:986 12012 #, kde-format 12013 msgid "Asia/Yerevan" 12014 msgstr "एशिया/येरेवान" 12015 12016 #: kdecore/TIMEZONES:987 12017 #, kde-format 12018 msgid "Atlantic/Azores" 12019 msgstr "एटलान्टिक/अजोर्स" 12020 12021 #. i18n: comment to the previous timezone 12022 #: kdecore/TIMEZONES:989 12023 #, kde-format 12024 msgid "Azores" 12025 msgstr "" 12026 12027 #: kdecore/TIMEZONES:990 12028 #, kde-format 12029 msgid "Atlantic/Bermuda" 12030 msgstr "एटलान्टिक/बर्मुडा" 12031 12032 #: kdecore/TIMEZONES:991 12033 #, kde-format 12034 msgid "Atlantic/Canary" 12035 msgstr "एटलान्टिक/क्यानरी" 12036 12037 #. i18n: comment to the previous timezone 12038 #: kdecore/TIMEZONES:993 12039 #, kde-format 12040 msgid "Canary Islands" 12041 msgstr "" 12042 12043 #: kdecore/TIMEZONES:994 12044 #, kde-format 12045 msgid "Atlantic/Cape_Verde" 12046 msgstr "एटलान्टिक/केपवर्डे" 12047 12048 #: kdecore/TIMEZONES:995 12049 #, kde-format 12050 msgid "Atlantic/Faeroe" 12051 msgstr "एटलान्टिक/फाइरो" 12052 12053 #: kdecore/TIMEZONES:996 12054 #, fuzzy, kde-format 12055 #| msgid "Atlantic/Faeroe" 12056 msgid "Atlantic/Faroe" 12057 msgstr "एटलान्टिक/फाइरो" 12058 12059 #: kdecore/TIMEZONES:997 12060 #, kde-format 12061 msgid "Atlantic/Jan_Mayen" 12062 msgstr "एटलान्टिक/जानमयेन" 12063 12064 #: kdecore/TIMEZONES:998 12065 #, kde-format 12066 msgid "Atlantic/Madeira" 12067 msgstr "एटलान्टिक/मदेइरा" 12068 12069 #. i18n: comment to the previous timezone 12070 #: kdecore/TIMEZONES:1000 12071 #, kde-format 12072 msgid "Madeira Islands" 12073 msgstr "" 12074 12075 #: kdecore/TIMEZONES:1001 12076 #, kde-format 12077 msgid "Atlantic/Reykjavik" 12078 msgstr "एटलान्टिक/रेकजाविक" 12079 12080 #: kdecore/TIMEZONES:1002 12081 #, kde-format 12082 msgid "Atlantic/South_Georgia" 12083 msgstr "एटलान्टिक/साउथ जर्जिया" 12084 12085 #: kdecore/TIMEZONES:1003 12086 #, kde-format 12087 msgid "Atlantic/St_Helena" 12088 msgstr "एटलान्टिक/सेन्ट हेलेना" 12089 12090 #: kdecore/TIMEZONES:1004 12091 #, kde-format 12092 msgid "Atlantic/Stanley" 12093 msgstr "एटलान्टिक/स्टान्ली" 12094 12095 #: kdecore/TIMEZONES:1005 12096 #, fuzzy, kde-format 12097 #| msgid "Australia/Brisbane" 12098 msgid "Australia/ACT" 12099 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12100 12101 #. i18n: comment to the previous timezone 12102 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12103 #: kdecore/TIMEZONES:1073 12104 #, kde-format 12105 msgid "New South Wales - most locations" 12106 msgstr "" 12107 12108 #: kdecore/TIMEZONES:1008 12109 #, kde-format 12110 msgid "Australia/Adelaide" 12111 msgstr "अष्ट्रेलिया/अदेलाइदे" 12112 12113 #. i18n: comment to the previous timezone 12114 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12115 #, fuzzy, kde-format 12116 #| msgid "Australia/Adelaide" 12117 msgid "South Australia" 12118 msgstr "अष्ट्रेलिया/अदेलाइदे" 12119 12120 #: kdecore/TIMEZONES:1011 12121 #, kde-format 12122 msgid "Australia/Brisbane" 12123 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12124 12125 #. i18n: comment to the previous timezone 12126 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12127 #, kde-format 12128 msgid "Queensland - most locations" 12129 msgstr "" 12130 12131 #. i18n: comment to the previous timezone 12132 #: kdecore/TIMEZONES:1015 12133 #, kde-format 12134 msgid "Queensland (most areas)" 12135 msgstr "" 12136 12137 #: kdecore/TIMEZONES:1016 12138 #, kde-format 12139 msgid "Australia/Broken_Hill" 12140 msgstr "अष्ट्रेलिया/ब्रोकेनहिल" 12141 12142 #. i18n: comment to the previous timezone 12143 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12144 #, kde-format 12145 msgid "New South Wales - Yancowinna" 12146 msgstr "" 12147 12148 #. i18n: comment to the previous timezone 12149 #: kdecore/TIMEZONES:1020 12150 #, kde-format 12151 msgid "New South Wales (Yancowinna)" 12152 msgstr "" 12153 12154 #: kdecore/TIMEZONES:1021 12155 #, fuzzy, kde-format 12156 #| msgid "Australia/Brisbane" 12157 msgid "Australia/Canberra" 12158 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12159 12160 #: kdecore/TIMEZONES:1024 12161 #, fuzzy, kde-format 12162 #| msgid "Australia/Brisbane" 12163 msgid "Australia/Currie" 12164 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12165 12166 #. i18n: comment to the previous timezone 12167 #: kdecore/TIMEZONES:1026 12168 #, kde-format 12169 msgid "Tasmania - King Island" 12170 msgstr "" 12171 12172 #: kdecore/TIMEZONES:1027 12173 #, kde-format 12174 msgid "Australia/Darwin" 12175 msgstr "अष्ट्रेलिया/डार्विन" 12176 12177 #. i18n: comment to the previous timezone 12178 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12179 #, kde-format 12180 msgid "Northern Territory" 12181 msgstr "" 12182 12183 #: kdecore/TIMEZONES:1030 12184 #, fuzzy, kde-format 12185 #| msgid "Australia/Adelaide" 12186 msgid "Australia/Eucla" 12187 msgstr "अष्ट्रेलिया/अदेलाइदे" 12188 12189 #. i18n: comment to the previous timezone 12190 #: kdecore/TIMEZONES:1032 12191 #, fuzzy, kde-format 12192 #| msgid "Australia/Adelaide" 12193 msgid "Western Australia - Eucla area" 12194 msgstr "अष्ट्रेलिया/अदेलाइदे" 12195 12196 #. i18n: comment to the previous timezone 12197 #: kdecore/TIMEZONES:1034 12198 #, fuzzy, kde-format 12199 #| msgid "Australia/Adelaide" 12200 msgid "Western Australia (Eucla)" 12201 msgstr "अष्ट्रेलिया/अदेलाइदे" 12202 12203 #: kdecore/TIMEZONES:1035 12204 #, kde-format 12205 msgid "Australia/Hobart" 12206 msgstr "अष्ट्रेलिया/होबर्ट" 12207 12208 #. i18n: comment to the previous timezone 12209 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12210 #, kde-format 12211 msgid "Tasmania - most locations" 12212 msgstr "" 12213 12214 #. i18n: comment to the previous timezone 12215 #: kdecore/TIMEZONES:1039 12216 #, fuzzy, kde-format 12217 #| msgid "Australia/Brisbane" 12218 msgid "Tasmania" 12219 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12220 12221 #: kdecore/TIMEZONES:1040 12222 #, fuzzy, kde-format 12223 #| msgid "Australia/Hobart" 12224 msgid "Australia/LHI" 12225 msgstr "अष्ट्रेलिया/होबर्ट" 12226 12227 #. i18n: comment to the previous timezone 12228 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12229 #, kde-format 12230 msgid "Lord Howe Island" 12231 msgstr "" 12232 12233 #: kdecore/TIMEZONES:1043 12234 #, kde-format 12235 msgid "Australia/Lindeman" 12236 msgstr "अष्ट्रेलिया/लिन्डेम्यान" 12237 12238 #. i18n: comment to the previous timezone 12239 #: kdecore/TIMEZONES:1045 12240 #, kde-format 12241 msgid "Queensland - Holiday Islands" 12242 msgstr "" 12243 12244 #. i18n: comment to the previous timezone 12245 #: kdecore/TIMEZONES:1047 12246 #, kde-format 12247 msgid "Queensland (Whitsunday Islands)" 12248 msgstr "" 12249 12250 #: kdecore/TIMEZONES:1048 12251 #, kde-format 12252 msgid "Australia/Lord_Howe" 12253 msgstr "अष्ट्रेलिया/लर्डहोवे" 12254 12255 #: kdecore/TIMEZONES:1051 12256 #, kde-format 12257 msgid "Australia/Melbourne" 12258 msgstr "अष्ट्रेलिया/मेलबोर्न" 12259 12260 #. i18n: comment to the previous timezone 12261 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12262 #, kde-format 12263 msgid "Victoria" 12264 msgstr "" 12265 12266 #: kdecore/TIMEZONES:1054 12267 #, fuzzy, kde-format 12268 #| msgid "Australia/Sydney" 12269 msgid "Australia/NSW" 12270 msgstr "अष्ट्रेलिया/सिड्नी" 12271 12272 #: kdecore/TIMEZONES:1057 12273 #, fuzzy, kde-format 12274 #| msgid "Australia/Perth" 12275 msgid "Australia/North" 12276 msgstr "अष्ट्रेलिया/पर्थ" 12277 12278 #: kdecore/TIMEZONES:1060 12279 #, kde-format 12280 msgid "Australia/Perth" 12281 msgstr "अष्ट्रेलिया/पर्थ" 12282 12283 #. i18n: comment to the previous timezone 12284 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12285 #, kde-format 12286 msgid "Western Australia - most locations" 12287 msgstr "" 12288 12289 #. i18n: comment to the previous timezone 12290 #: kdecore/TIMEZONES:1064 12291 #, fuzzy, kde-format 12292 #| msgid "Australia/Adelaide" 12293 msgid "Western Australia (most areas)" 12294 msgstr "अष्ट्रेलिया/अदेलाइदे" 12295 12296 #: kdecore/TIMEZONES:1065 12297 #, fuzzy, kde-format 12298 #| msgid "Australia/Adelaide" 12299 msgid "Australia/Queensland" 12300 msgstr "अष्ट्रेलिया/अदेलाइदे" 12301 12302 #: kdecore/TIMEZONES:1068 12303 #, fuzzy, kde-format 12304 #| msgid "Australia/Perth" 12305 msgid "Australia/South" 12306 msgstr "अष्ट्रेलिया/पर्थ" 12307 12308 #: kdecore/TIMEZONES:1071 12309 #, kde-format 12310 msgid "Australia/Sydney" 12311 msgstr "अष्ट्रेलिया/सिड्नी" 12312 12313 #. i18n: comment to the previous timezone 12314 #: kdecore/TIMEZONES:1075 12315 #, kde-format 12316 msgid "New South Wales (most areas)" 12317 msgstr "" 12318 12319 #: kdecore/TIMEZONES:1076 12320 #, fuzzy, kde-format 12321 #| msgid "Australia/Brisbane" 12322 msgid "Australia/Tasmania" 12323 msgstr "अष्ट्रेलिया/ब्रिस्बाने" 12324 12325 #: kdecore/TIMEZONES:1079 12326 #, fuzzy, kde-format 12327 #| msgid "Australia/Adelaide" 12328 msgid "Australia/Victoria" 12329 msgstr "अष्ट्रेलिया/अदेलाइदे" 12330 12331 #: kdecore/TIMEZONES:1082 12332 #, fuzzy, kde-format 12333 #| msgid "Australia/Perth" 12334 msgid "Australia/West" 12335 msgstr "अष्ट्रेलिया/पर्थ" 12336 12337 #: kdecore/TIMEZONES:1085 12338 #, fuzzy, kde-format 12339 #| msgid "Australia/Darwin" 12340 msgid "Australia/Yancowinna" 12341 msgstr "अष्ट्रेलिया/डार्विन" 12342 12343 #: kdecore/TIMEZONES:1088 12344 #, kde-format 12345 msgid "Brazil/Acre" 12346 msgstr "" 12347 12348 #: kdecore/TIMEZONES:1091 12349 #, fuzzy, kde-format 12350 #| msgid "America/Noronha" 12351 msgid "Brazil/DeNoronha" 12352 msgstr "अमेरिका/नोरोन्हा" 12353 12354 #: kdecore/TIMEZONES:1094 12355 #, kde-format 12356 msgid "Brazil/East" 12357 msgstr "" 12358 12359 #: kdecore/TIMEZONES:1097 12360 #, kde-format 12361 msgid "Brazil/West" 12362 msgstr "" 12363 12364 #: kdecore/TIMEZONES:1100 12365 #, kde-format 12366 msgid "Canada/Atlantic" 12367 msgstr "" 12368 12369 #: kdecore/TIMEZONES:1103 12370 #, kde-format 12371 msgid "Canada/Central" 12372 msgstr "" 12373 12374 #: kdecore/TIMEZONES:1106 12375 #, kde-format 12376 msgid "Canada/East-Saskatchewan" 12377 msgstr "" 12378 12379 #: kdecore/TIMEZONES:1109 12380 #, kde-format 12381 msgid "Canada/Eastern" 12382 msgstr "" 12383 12384 #: kdecore/TIMEZONES:1112 12385 #, kde-format 12386 msgid "Canada/Mountain" 12387 msgstr "" 12388 12389 #: kdecore/TIMEZONES:1115 12390 #, kde-format 12391 msgid "Canada/Newfoundland" 12392 msgstr "" 12393 12394 #: kdecore/TIMEZONES:1118 12395 #, kde-format 12396 msgid "Canada/Pacific" 12397 msgstr "" 12398 12399 #: kdecore/TIMEZONES:1121 12400 #, kde-format 12401 msgid "Canada/Saskatchewan" 12402 msgstr "" 12403 12404 #: kdecore/TIMEZONES:1124 12405 #, kde-format 12406 msgid "Canada/Yukon" 12407 msgstr "" 12408 12409 #: kdecore/TIMEZONES:1127 12410 #, kde-format 12411 msgid "Chile/Continental" 12412 msgstr "" 12413 12414 #: kdecore/TIMEZONES:1130 12415 #, kde-format 12416 msgid "Chile/EasterIsland" 12417 msgstr "" 12418 12419 #. i18n: comment to the previous timezone 12420 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12421 #, kde-format 12422 msgid "Easter Island & Sala y Gomez" 12423 msgstr "" 12424 12425 #: kdecore/TIMEZONES:1133 12426 #, kde-format 12427 msgid "Cuba" 12428 msgstr "" 12429 12430 #: kdecore/TIMEZONES:1134 12431 #, kde-format 12432 msgid "Egypt" 12433 msgstr "" 12434 12435 #: kdecore/TIMEZONES:1135 12436 #, kde-format 12437 msgid "Eire" 12438 msgstr "" 12439 12440 #: kdecore/TIMEZONES:1136 12441 #, kde-format 12442 msgid "Europe/Amsterdam" 12443 msgstr "यूरोप/आमस्टर्डम" 12444 12445 #: kdecore/TIMEZONES:1137 12446 #, kde-format 12447 msgid "Europe/Andorra" 12448 msgstr "यूरोप/एन्डोरा" 12449 12450 #: kdecore/TIMEZONES:1138 12451 #, fuzzy, kde-format 12452 #| msgid "Europe/Athens" 12453 msgid "Europe/Astrakhan" 12454 msgstr "यूरोप/एथेन्स" 12455 12456 #. i18n: comment to the previous timezone 12457 #: kdecore/TIMEZONES:1140 12458 #, kde-format 12459 msgid "MSK+01 - Astrakhan" 12460 msgstr "" 12461 12462 #: kdecore/TIMEZONES:1141 12463 #, kde-format 12464 msgid "Europe/Athens" 12465 msgstr "यूरोप/एथेन्स" 12466 12467 #: kdecore/TIMEZONES:1142 12468 #, kde-format 12469 msgid "Europe/Belfast" 12470 msgstr "यूरोप/बेलफास्टोप" 12471 12472 #: kdecore/TIMEZONES:1143 12473 #, kde-format 12474 msgid "Europe/Belgrade" 12475 msgstr "यूरोप/बेलग्रेड" 12476 12477 #: kdecore/TIMEZONES:1144 12478 #, kde-format 12479 msgid "Europe/Berlin" 12480 msgstr "यूरोप/बर्लिन" 12481 12482 #. i18n: comment to the previous timezone 12483 #: kdecore/TIMEZONES:1146 12484 #, kde-format 12485 msgid "Germany (most areas)" 12486 msgstr "" 12487 12488 #: kdecore/TIMEZONES:1147 12489 #, kde-format 12490 msgid "Europe/Bratislava" 12491 msgstr "यूरोप/ब्राटिस्लवा" 12492 12493 #: kdecore/TIMEZONES:1148 12494 #, kde-format 12495 msgid "Europe/Brussels" 12496 msgstr "यूरोप/ब्रुसेल्स" 12497 12498 #: kdecore/TIMEZONES:1149 12499 #, kde-format 12500 msgid "Europe/Bucharest" 12501 msgstr "यूरोप/बुकारेस्ट" 12502 12503 #: kdecore/TIMEZONES:1150 12504 #, kde-format 12505 msgid "Europe/Budapest" 12506 msgstr "यूरोप/बुडापेस्ट" 12507 12508 #: kdecore/TIMEZONES:1151 12509 #, fuzzy, kde-format 12510 #| msgid "Europe/Brussels" 12511 msgid "Europe/Busingen" 12512 msgstr "यूरोप/ब्रुसेल्स" 12513 12514 #. i18n: comment to the previous timezone 12515 #: kdecore/TIMEZONES:1153 12516 #, kde-format 12517 msgid "Busingen" 12518 msgstr "" 12519 12520 #: kdecore/TIMEZONES:1154 12521 #, kde-format 12522 msgid "Europe/Chisinau" 12523 msgstr "यूरोप/चिसिनउ" 12524 12525 #: kdecore/TIMEZONES:1155 12526 #, kde-format 12527 msgid "Europe/Copenhagen" 12528 msgstr "यूरोप/कोपेनहागेन" 12529 12530 #: kdecore/TIMEZONES:1156 12531 #, kde-format 12532 msgid "Europe/Dublin" 12533 msgstr "यूरोप/डब्लिन" 12534 12535 #: kdecore/TIMEZONES:1157 12536 #, kde-format 12537 msgid "Europe/Gibraltar" 12538 msgstr "यूरोप/गिब्राल्टार" 12539 12540 #: kdecore/TIMEZONES:1158 12541 #, fuzzy, kde-format 12542 #| msgid "Europe/Athens" 12543 msgid "Europe/Guernsey" 12544 msgstr "यूरोप/एथेन्स" 12545 12546 #: kdecore/TIMEZONES:1159 12547 #, kde-format 12548 msgid "Europe/Helsinki" 12549 msgstr "यूरोप/हेलसिन्कि" 12550 12551 #: kdecore/TIMEZONES:1160 12552 #, fuzzy, kde-format 12553 #| msgid "Europe/Oslo" 12554 msgid "Europe/Isle_of_Man" 12555 msgstr "यूरोप/ओस्लो" 12556 12557 #: kdecore/TIMEZONES:1161 12558 #, kde-format 12559 msgid "Europe/Istanbul" 12560 msgstr "यूरोप/इस्टानबुल" 12561 12562 #: kdecore/TIMEZONES:1162 12563 #, fuzzy, kde-format 12564 #| msgid "Europe/Paris" 12565 msgid "Europe/Jersey" 12566 msgstr "यूरोप/पेरिस" 12567 12568 #: kdecore/TIMEZONES:1163 12569 #, kde-format 12570 msgid "Europe/Kaliningrad" 12571 msgstr "यूरोप/कालीनिन्गार्ड" 12572 12573 #. i18n: comment to the previous timezone 12574 #: kdecore/TIMEZONES:1165 12575 #, kde-format 12576 msgid "Moscow-01 - Kaliningrad" 12577 msgstr "" 12578 12579 #. i18n: comment to the previous timezone 12580 #: kdecore/TIMEZONES:1167 12581 #, kde-format 12582 msgid "MSK-01 - Kaliningrad" 12583 msgstr "" 12584 12585 #: kdecore/TIMEZONES:1168 12586 #, kde-format 12587 msgid "Europe/Kiev" 12588 msgstr "यूरोप/किएव" 12589 12590 #. i18n: comment to the previous timezone 12591 #: kdecore/TIMEZONES:1172 12592 #, kde-format 12593 msgid "Ukraine (most areas)" 12594 msgstr "" 12595 12596 #: kdecore/TIMEZONES:1173 12597 #, fuzzy, kde-format 12598 #| msgid "Europe/Kiev" 12599 msgid "Europe/Kirov" 12600 msgstr "यूरोप/किएव" 12601 12602 #. i18n: comment to the previous timezone 12603 #: kdecore/TIMEZONES:1175 12604 #, kde-format 12605 msgid "MSK+00 - Kirov" 12606 msgstr "" 12607 12608 #: kdecore/TIMEZONES:1176 12609 #, kde-format 12610 msgid "Europe/Lisbon" 12611 msgstr "यूरोप/लिस्बोन" 12612 12613 #. i18n: comment to the previous timezone 12614 #: kdecore/TIMEZONES:1180 12615 #, kde-format 12616 msgid "Portugal (mainland)" 12617 msgstr "" 12618 12619 #: kdecore/TIMEZONES:1181 12620 #, kde-format 12621 msgid "Europe/Ljubljana" 12622 msgstr "यूरोप/जबल्जाना" 12623 12624 #: kdecore/TIMEZONES:1182 12625 #, kde-format 12626 msgid "Europe/London" 12627 msgstr "यूरोप/लन्डन" 12628 12629 #: kdecore/TIMEZONES:1183 12630 #, kde-format 12631 msgid "Europe/Luxembourg" 12632 msgstr "यूरोप/लक्जेम्बर्ग" 12633 12634 #: kdecore/TIMEZONES:1184 12635 #, kde-format 12636 msgid "Europe/Madrid" 12637 msgstr "यूरोप/म्याड्रिड" 12638 12639 #. i18n: comment to the previous timezone 12640 #: kdecore/TIMEZONES:1188 12641 #, kde-format 12642 msgid "Spain (mainland)" 12643 msgstr "" 12644 12645 #: kdecore/TIMEZONES:1189 12646 #, kde-format 12647 msgid "Europe/Malta" 12648 msgstr "यूरोप/माल्टा" 12649 12650 #: kdecore/TIMEZONES:1190 12651 #, kde-format 12652 msgid "Europe/Mariehamn" 12653 msgstr "युरोप/म्यारिह्याम" 12654 12655 #: kdecore/TIMEZONES:1191 12656 #, kde-format 12657 msgid "Europe/Minsk" 12658 msgstr "यूरोप/मिन्स्क" 12659 12660 #: kdecore/TIMEZONES:1192 12661 #, kde-format 12662 msgid "Europe/Monaco" 12663 msgstr "यूरोप/मोनाको" 12664 12665 #: kdecore/TIMEZONES:1193 12666 #, kde-format 12667 msgid "Europe/Moscow" 12668 msgstr "यूरोप/मस्को" 12669 12670 #. i18n: comment to the previous timezone 12671 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12672 #, kde-format 12673 msgid "Moscow+00 - west Russia" 12674 msgstr "" 12675 12676 #. i18n: comment to the previous timezone 12677 #: kdecore/TIMEZONES:1197 12678 #, kde-format 12679 msgid "MSK+00 - Moscow area" 12680 msgstr "" 12681 12682 #: kdecore/TIMEZONES:1198 12683 #, kde-format 12684 msgid "Europe/Oslo" 12685 msgstr "यूरोप/ओस्लो" 12686 12687 #: kdecore/TIMEZONES:1199 12688 #, kde-format 12689 msgid "Europe/Paris" 12690 msgstr "यूरोप/पेरिस" 12691 12692 #: kdecore/TIMEZONES:1200 12693 #, fuzzy, kde-format 12694 #| msgid "Europe/Andorra" 12695 msgid "Europe/Podgorica" 12696 msgstr "यूरोप/एन्डोरा" 12697 12698 #: kdecore/TIMEZONES:1201 12699 #, kde-format 12700 msgid "Europe/Prague" 12701 msgstr "यूरोप/पराग्वे" 12702 12703 #: kdecore/TIMEZONES:1202 12704 #, kde-format 12705 msgid "Europe/Riga" 12706 msgstr "यूरोप/रिगा" 12707 12708 #: kdecore/TIMEZONES:1203 12709 #, kde-format 12710 msgid "Europe/Rome" 12711 msgstr "यूरोप/रोम" 12712 12713 #: kdecore/TIMEZONES:1204 12714 #, kde-format 12715 msgid "Europe/Samara" 12716 msgstr "यूरोप/समारा" 12717 12718 #. i18n: comment to the previous timezone 12719 #: kdecore/TIMEZONES:1206 12720 #, kde-format 12721 msgid "Moscow+01 - Samara, Udmurtia" 12722 msgstr "" 12723 12724 #. i18n: comment to the previous timezone 12725 #: kdecore/TIMEZONES:1208 12726 #, kde-format 12727 msgid "Moscow+00 - Samara, Udmurtia" 12728 msgstr "" 12729 12730 #. i18n: comment to the previous timezone 12731 #: kdecore/TIMEZONES:1210 12732 #, kde-format 12733 msgid "MSK+01 - Samara, Udmurtia" 12734 msgstr "" 12735 12736 #: kdecore/TIMEZONES:1211 12737 #, kde-format 12738 msgid "Europe/San_Marino" 12739 msgstr "यूरोप/सानमारिनो" 12740 12741 #: kdecore/TIMEZONES:1212 12742 #, kde-format 12743 msgid "Europe/Sarajevo" 12744 msgstr "यूरोप/साराजेवो" 12745 12746 #: kdecore/TIMEZONES:1213 12747 #, fuzzy, kde-format 12748 #| msgid "Europe/Sarajevo" 12749 msgid "Europe/Saratov" 12750 msgstr "यूरोप/साराजेवो" 12751 12752 #. i18n: comment to the previous timezone 12753 #: kdecore/TIMEZONES:1215 12754 #, kde-format 12755 msgid "MSK+01 - Saratov" 12756 msgstr "" 12757 12758 #: kdecore/TIMEZONES:1216 12759 #, kde-format 12760 msgid "Europe/Simferopol" 12761 msgstr "यूरोप/सिमफरोपोल" 12762 12763 #. i18n: comment to the previous timezone 12764 #: kdecore/TIMEZONES:1218 12765 #, kde-format 12766 msgid "central Crimea" 12767 msgstr "" 12768 12769 #. i18n: comment to the previous timezone 12770 #: kdecore/TIMEZONES:1220 12771 #, fuzzy, kde-format 12772 #| msgid "Prime: " 12773 msgid "Crimea" 12774 msgstr "प्राथमिक: " 12775 12776 #: kdecore/TIMEZONES:1221 12777 #, kde-format 12778 msgid "Europe/Skopje" 12779 msgstr "यूरोप/स्कोप्जे" 12780 12781 #: kdecore/TIMEZONES:1222 12782 #, kde-format 12783 msgid "Europe/Sofia" 12784 msgstr "यूरोप/सोफिया" 12785 12786 #: kdecore/TIMEZONES:1223 12787 #, kde-format 12788 msgid "Europe/Stockholm" 12789 msgstr "यूरोप/स्टकहोम" 12790 12791 #: kdecore/TIMEZONES:1224 12792 #, kde-format 12793 msgid "Europe/Tallinn" 12794 msgstr "यूरोप/टल्लिन" 12795 12796 #: kdecore/TIMEZONES:1225 12797 #, kde-format 12798 msgid "Europe/Tirane" 12799 msgstr "यूरोप/टिराने" 12800 12801 #: kdecore/TIMEZONES:1226 12802 #, fuzzy, kde-format 12803 #| msgid "Europe/Tirane" 12804 msgid "Europe/Tiraspol" 12805 msgstr "यूरोप/टिराने" 12806 12807 #: kdecore/TIMEZONES:1227 12808 #, fuzzy, kde-format 12809 #| msgid "Europe/Minsk" 12810 msgid "Europe/Ulyanovsk" 12811 msgstr "यूरोप/मिन्स्क" 12812 12813 #. i18n: comment to the previous timezone 12814 #: kdecore/TIMEZONES:1229 12815 #, kde-format 12816 msgid "MSK+01 - Ulyanovsk" 12817 msgstr "" 12818 12819 #: kdecore/TIMEZONES:1230 12820 #, kde-format 12821 msgid "Europe/Uzhgorod" 12822 msgstr "यूरोप/उजगोरोड" 12823 12824 #. i18n: comment to the previous timezone 12825 #: kdecore/TIMEZONES:1232 12826 #, kde-format 12827 msgid "Ruthenia" 12828 msgstr "" 12829 12830 #. i18n: comment to the previous timezone 12831 #: kdecore/TIMEZONES:1234 12832 #, kde-format 12833 msgid "Transcarpathia" 12834 msgstr "" 12835 12836 #: kdecore/TIMEZONES:1235 12837 #, kde-format 12838 msgid "Europe/Vaduz" 12839 msgstr "यूरोप/वादुज" 12840 12841 #: kdecore/TIMEZONES:1236 12842 #, kde-format 12843 msgid "Europe/Vatican" 12844 msgstr "यूरोप/भेटिकन" 12845 12846 #: kdecore/TIMEZONES:1237 12847 #, kde-format 12848 msgid "Europe/Vienna" 12849 msgstr "यूरोप/भियाना" 12850 12851 #: kdecore/TIMEZONES:1238 12852 #, kde-format 12853 msgid "Europe/Vilnius" 12854 msgstr "यूरोप/भिल्नियस" 12855 12856 #: kdecore/TIMEZONES:1239 12857 #, fuzzy, kde-format 12858 #| msgid "Europe/Belgrade" 12859 msgid "Europe/Volgograd" 12860 msgstr "यूरोप/बेलग्रेड" 12861 12862 #. i18n: comment to the previous timezone 12863 #: kdecore/TIMEZONES:1241 12864 #, kde-format 12865 msgid "Moscow+00 - Caspian Sea" 12866 msgstr "" 12867 12868 #. i18n: comment to the previous timezone 12869 #: kdecore/TIMEZONES:1243 12870 #, kde-format 12871 msgid "MSK+00 - Volgograd" 12872 msgstr "" 12873 12874 #: kdecore/TIMEZONES:1244 12875 #, kde-format 12876 msgid "Europe/Warsaw" 12877 msgstr "यूरोप/वार्स" 12878 12879 #: kdecore/TIMEZONES:1245 12880 #, kde-format 12881 msgid "Europe/Zagreb" 12882 msgstr "यूरोप/जाग्रेब" 12883 12884 #: kdecore/TIMEZONES:1246 12885 #, kde-format 12886 msgid "Europe/Zaporozhye" 12887 msgstr "यूरोप/जापोरोझे" 12888 12889 #. i18n: comment to the previous timezone 12890 #: kdecore/TIMEZONES:1248 12891 #, kde-format 12892 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12893 msgstr "" 12894 12895 #. i18n: comment to the previous timezone 12896 #: kdecore/TIMEZONES:1250 12897 #, kde-format 12898 msgid "Zaporozhye and east Lugansk" 12899 msgstr "" 12900 12901 #: kdecore/TIMEZONES:1251 12902 #, kde-format 12903 msgid "Europe/Zurich" 12904 msgstr "यूरोप/जुरिच" 12905 12906 #: kdecore/TIMEZONES:1252 12907 #, kde-format 12908 msgid "GB" 12909 msgstr "" 12910 12911 #: kdecore/TIMEZONES:1253 12912 #, kde-format 12913 msgid "GB-Eire" 12914 msgstr "" 12915 12916 #: kdecore/TIMEZONES:1254 12917 #, fuzzy, kde-format 12918 #| msgid "Asia/Hong_Kong" 12919 msgid "Hongkong" 12920 msgstr "एशिया/हङ्गकङ्ग" 12921 12922 #: kdecore/TIMEZONES:1255 12923 #, kde-format 12924 msgid "Iceland" 12925 msgstr "" 12926 12927 #: kdecore/TIMEZONES:1256 12928 #, kde-format 12929 msgid "Indian/Antananarivo" 12930 msgstr "इन्डियन/एन्टानानारिवो" 12931 12932 #: kdecore/TIMEZONES:1257 12933 #, kde-format 12934 msgid "Indian/Chagos" 12935 msgstr "इन्डियन/कागोस्" 12936 12937 #: kdecore/TIMEZONES:1258 12938 #, kde-format 12939 msgid "Indian/Christmas" 12940 msgstr "इन्डियन/क्रिस्मस" 12941 12942 #: kdecore/TIMEZONES:1259 12943 #, kde-format 12944 msgid "Indian/Cocos" 12945 msgstr "इन्डियन/कोकोस्" 12946 12947 #: kdecore/TIMEZONES:1260 12948 #, kde-format 12949 msgid "Indian/Comoro" 12950 msgstr "इन्डियन/कोमोरो" 12951 12952 #: kdecore/TIMEZONES:1261 12953 #, kde-format 12954 msgid "Indian/Kerguelen" 12955 msgstr "इन्डियन/कर्गुएलेन" 12956 12957 #: kdecore/TIMEZONES:1262 12958 #, kde-format 12959 msgid "Indian/Mahe" 12960 msgstr "इन्डियन/मेहे" 12961 12962 #: kdecore/TIMEZONES:1263 12963 #, kde-format 12964 msgid "Indian/Maldives" 12965 msgstr "इन्डियन/माल्दिब्स" 12966 12967 #: kdecore/TIMEZONES:1264 12968 #, kde-format 12969 msgid "Indian/Mauritius" 12970 msgstr "इन्डियन/माउरिटिअस" 12971 12972 #: kdecore/TIMEZONES:1265 12973 #, kde-format 12974 msgid "Indian/Mayotte" 12975 msgstr "इन्डियन/मायोट्टे" 12976 12977 #: kdecore/TIMEZONES:1266 12978 #, kde-format 12979 msgid "Indian/Reunion" 12980 msgstr "इन्डियन/रियूनियन" 12981 12982 #: kdecore/TIMEZONES:1267 12983 #, kde-format 12984 msgid "Iran" 12985 msgstr "" 12986 12987 #: kdecore/TIMEZONES:1268 12988 #, fuzzy, kde-format 12989 #| msgid "Pacific/Kosrae" 12990 msgid "Israel" 12991 msgstr "प्यासिफिक/कोस्राये" 12992 12993 #: kdecore/TIMEZONES:1269 12994 #, fuzzy, kde-format 12995 #| msgid "America/Jamaica" 12996 msgid "Jamaica" 12997 msgstr "अमेरिका/जमैका" 12998 12999 #: kdecore/TIMEZONES:1270 13000 #, kde-format 13001 msgid "Japan" 13002 msgstr "" 13003 13004 #. i18n: comment to the previous timezone 13005 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 13006 #, fuzzy, kde-format 13007 #| msgid "Pacific/Kwajalein" 13008 msgid "Kwajalein" 13009 msgstr "प्यासिफिक/क्वाजालेइन" 13010 13011 #: kdecore/TIMEZONES:1274 13012 #, kde-format 13013 msgid "Libya" 13014 msgstr "" 13015 13016 #: kdecore/TIMEZONES:1275 13017 #, kde-format 13018 msgid "Mexico/BajaNorte" 13019 msgstr "" 13020 13021 #: kdecore/TIMEZONES:1278 13022 #, kde-format 13023 msgid "Mexico/BajaSur" 13024 msgstr "" 13025 13026 #: kdecore/TIMEZONES:1281 13027 #, kde-format 13028 msgid "Mexico/General" 13029 msgstr "" 13030 13031 #: kdecore/TIMEZONES:1284 13032 #, kde-format 13033 msgid "NZ" 13034 msgstr "" 13035 13036 #: kdecore/TIMEZONES:1287 13037 #, kde-format 13038 msgid "NZ-CHAT" 13039 msgstr "" 13040 13041 #. i18n: comment to the previous timezone 13042 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 13043 #, kde-format 13044 msgid "Chatham Islands" 13045 msgstr "" 13046 13047 #: kdecore/TIMEZONES:1290 13048 #, kde-format 13049 msgid "Navajo" 13050 msgstr "" 13051 13052 #: kdecore/TIMEZONES:1293 13053 #, kde-format 13054 msgid "PRC" 13055 msgstr "" 13056 13057 #: kdecore/TIMEZONES:1296 13058 #, kde-format 13059 msgid "Pacific/Apia" 13060 msgstr "प्यासिफिक/एपिया" 13061 13062 #: kdecore/TIMEZONES:1297 13063 #, kde-format 13064 msgid "Pacific/Auckland" 13065 msgstr "प्यासिफिक/अकल्याण्ड" 13066 13067 #. i18n: comment to the previous timezone 13068 #: kdecore/TIMEZONES:1301 13069 #, kde-format 13070 msgid "New Zealand (most areas)" 13071 msgstr "" 13072 13073 #: kdecore/TIMEZONES:1302 13074 #, fuzzy, kde-format 13075 #| msgid "Pacific/Honolulu" 13076 msgid "Pacific/Bougainville" 13077 msgstr "प्यासिफिक/होनोलुलु" 13078 13079 #. i18n: comment to the previous timezone 13080 #: kdecore/TIMEZONES:1304 13081 #, kde-format 13082 msgid "Bougainville" 13083 msgstr "" 13084 13085 #: kdecore/TIMEZONES:1305 13086 #, kde-format 13087 msgid "Pacific/Chatham" 13088 msgstr "प्यासिफिक/च्याथम" 13089 13090 #: kdecore/TIMEZONES:1308 13091 #, fuzzy, kde-format 13092 #| msgid "Pacific/Truk" 13093 msgid "Pacific/Chuuk" 13094 msgstr "प्यासिफिक/ट्रक" 13095 13096 #. i18n: comment to the previous timezone 13097 #: kdecore/TIMEZONES:1310 13098 #, kde-format 13099 msgid "Chuuk (Truk) and Yap" 13100 msgstr "" 13101 13102 #. i18n: comment to the previous timezone 13103 #: kdecore/TIMEZONES:1312 13104 #, kde-format 13105 msgid "Chuuk/Truk, Yap" 13106 msgstr "" 13107 13108 #: kdecore/TIMEZONES:1313 13109 #, kde-format 13110 msgid "Pacific/Easter" 13111 msgstr "प्यासिफिक/इस्टर" 13112 13113 #. i18n: comment to the previous timezone 13114 #: kdecore/TIMEZONES:1317 13115 #, kde-format 13116 msgid "Easter Island" 13117 msgstr "" 13118 13119 #: kdecore/TIMEZONES:1318 13120 #, kde-format 13121 msgid "Pacific/Efate" 13122 msgstr "प्यासिफिक/इफेट" 13123 13124 #: kdecore/TIMEZONES:1319 13125 #, kde-format 13126 msgid "Pacific/Enderbury" 13127 msgstr "प्यासिफिक/इन्डरबरी" 13128 13129 #. i18n: comment to the previous timezone 13130 #: kdecore/TIMEZONES:1321 13131 #, kde-format 13132 msgid "Phoenix Islands" 13133 msgstr "" 13134 13135 #: kdecore/TIMEZONES:1322 13136 #, kde-format 13137 msgid "Pacific/Fakaofo" 13138 msgstr "प्यासिफिक/फकाओफो" 13139 13140 #: kdecore/TIMEZONES:1323 13141 #, kde-format 13142 msgid "Pacific/Fiji" 13143 msgstr "प्यासिफिक/फिजी" 13144 13145 #: kdecore/TIMEZONES:1324 13146 #, kde-format 13147 msgid "Pacific/Funafuti" 13148 msgstr "प्यासिफिक/फनाफुटि" 13149 13150 #: kdecore/TIMEZONES:1325 13151 #, kde-format 13152 msgid "Pacific/Galapagos" 13153 msgstr "प्यासिफिक/गलापागोस" 13154 13155 #. i18n: comment to the previous timezone 13156 #: kdecore/TIMEZONES:1327 13157 #, kde-format 13158 msgid "Galapagos Islands" 13159 msgstr "" 13160 13161 #: kdecore/TIMEZONES:1328 13162 #, kde-format 13163 msgid "Pacific/Gambier" 13164 msgstr "प्यासिफिक/ग्याम्बिएर" 13165 13166 #. i18n: comment to the previous timezone 13167 #: kdecore/TIMEZONES:1330 13168 #, kde-format 13169 msgid "Gambier Islands" 13170 msgstr "" 13171 13172 #: kdecore/TIMEZONES:1331 13173 #, kde-format 13174 msgid "Pacific/Guadalcanal" 13175 msgstr "प्यासिफिक/गुएडालक्यानल" 13176 13177 #: kdecore/TIMEZONES:1332 13178 #, kde-format 13179 msgid "Pacific/Guam" 13180 msgstr "प्यासिफिक/गुआम" 13181 13182 #: kdecore/TIMEZONES:1333 13183 #, kde-format 13184 msgid "Pacific/Honolulu" 13185 msgstr "प्यासिफिक/होनोलुलु" 13186 13187 #. i18n: comment to the previous timezone 13188 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13189 #, kde-format 13190 msgid "Hawaii" 13191 msgstr "" 13192 13193 #: kdecore/TIMEZONES:1336 13194 #, kde-format 13195 msgid "Pacific/Johnston" 13196 msgstr "प्यासिफिक/जोन्सटन" 13197 13198 #. i18n: comment to the previous timezone 13199 #: kdecore/TIMEZONES:1338 13200 #, kde-format 13201 msgid "Johnston Atoll" 13202 msgstr "" 13203 13204 #: kdecore/TIMEZONES:1339 13205 #, kde-format 13206 msgid "Pacific/Kiritimati" 13207 msgstr "प्यासिफिक/किरिटिमटी" 13208 13209 #. i18n: comment to the previous timezone 13210 #: kdecore/TIMEZONES:1341 13211 #, kde-format 13212 msgid "Line Islands" 13213 msgstr "" 13214 13215 #: kdecore/TIMEZONES:1342 13216 #, kde-format 13217 msgid "Pacific/Kosrae" 13218 msgstr "प्यासिफिक/कोस्राये" 13219 13220 #. i18n: comment to the previous timezone 13221 #: kdecore/TIMEZONES:1344 13222 #, fuzzy, kde-format 13223 #| msgid "Pacific/Kosrae" 13224 msgid "Kosrae" 13225 msgstr "प्यासिफिक/कोस्राये" 13226 13227 #: kdecore/TIMEZONES:1345 13228 #, kde-format 13229 msgid "Pacific/Kwajalein" 13230 msgstr "प्यासिफिक/क्वाजालेइन" 13231 13232 #: kdecore/TIMEZONES:1348 13233 #, kde-format 13234 msgid "Pacific/Majuro" 13235 msgstr "प्यासिफिक/मजुरो" 13236 13237 #. i18n: comment to the previous timezone 13238 #: kdecore/TIMEZONES:1352 13239 #, kde-format 13240 msgid "Marshall Islands (most areas)" 13241 msgstr "" 13242 13243 #: kdecore/TIMEZONES:1353 13244 #, kde-format 13245 msgid "Pacific/Marquesas" 13246 msgstr "प्यासिफिक/मार्कसस" 13247 13248 #. i18n: comment to the previous timezone 13249 #: kdecore/TIMEZONES:1355 13250 #, kde-format 13251 msgid "Marquesas Islands" 13252 msgstr "" 13253 13254 #: kdecore/TIMEZONES:1356 13255 #, kde-format 13256 msgid "Pacific/Midway" 13257 msgstr "प्यासिफिक/मिडवे" 13258 13259 #. i18n: comment to the previous timezone 13260 #: kdecore/TIMEZONES:1358 13261 #, kde-format 13262 msgid "Midway Islands" 13263 msgstr "" 13264 13265 #: kdecore/TIMEZONES:1359 13266 #, kde-format 13267 msgid "Pacific/Nauru" 13268 msgstr "प्यासिफिक/नाउरू" 13269 13270 #: kdecore/TIMEZONES:1360 13271 #, kde-format 13272 msgid "Pacific/Niue" 13273 msgstr "प्यासिफिक/निउ" 13274 13275 #: kdecore/TIMEZONES:1361 13276 #, kde-format 13277 msgid "Pacific/Norfolk" 13278 msgstr "प्यासिफिक/नर्फल्क" 13279 13280 #: kdecore/TIMEZONES:1362 13281 #, kde-format 13282 msgid "Pacific/Noumea" 13283 msgstr "प्यासिफिक/नोमिआ" 13284 13285 #: kdecore/TIMEZONES:1363 13286 #, kde-format 13287 msgid "Pacific/Pago_Pago" 13288 msgstr "प्यासिफिक/पागोपागो" 13289 13290 #: kdecore/TIMEZONES:1364 13291 #, kde-format 13292 msgid "Pacific/Palau" 13293 msgstr "प्यासिफिक/पालौ" 13294 13295 #: kdecore/TIMEZONES:1365 13296 #, kde-format 13297 msgid "Pacific/Pitcairn" 13298 msgstr "प्यासिफिक/पिटकेइरन" 13299 13300 #: kdecore/TIMEZONES:1366 13301 #, fuzzy, kde-format 13302 #| msgid "Pacific/Ponape" 13303 msgid "Pacific/Pohnpei" 13304 msgstr "प्यासिफिक/पोनापे" 13305 13306 #. i18n: comment to the previous timezone 13307 #: kdecore/TIMEZONES:1368 13308 #, kde-format 13309 msgid "Pohnpei (Ponape)" 13310 msgstr "" 13311 13312 #. i18n: comment to the previous timezone 13313 #: kdecore/TIMEZONES:1370 13314 #, fuzzy, kde-format 13315 #| msgid "Pacific/Ponape" 13316 msgid "Pohnpei/Ponape" 13317 msgstr "प्यासिफिक/पोनापे" 13318 13319 #: kdecore/TIMEZONES:1371 13320 #, kde-format 13321 msgid "Pacific/Ponape" 13322 msgstr "प्यासिफिक/पोनापे" 13323 13324 #. i18n: comment to the previous timezone 13325 #: kdecore/TIMEZONES:1373 13326 #, kde-format 13327 msgid "Ponape (Pohnpei)" 13328 msgstr "" 13329 13330 #: kdecore/TIMEZONES:1374 13331 #, kde-format 13332 msgid "Pacific/Port_Moresby" 13333 msgstr "प्यासिफिक/पोर्टमोरेस्बि" 13334 13335 #. i18n: comment to the previous timezone 13336 #: kdecore/TIMEZONES:1376 13337 #, kde-format 13338 msgid "Papua New Guinea (most areas)" 13339 msgstr "" 13340 13341 #: kdecore/TIMEZONES:1377 13342 #, kde-format 13343 msgid "Pacific/Rarotonga" 13344 msgstr "प्यासिफिक/रारोटोङ्गा" 13345 13346 #: kdecore/TIMEZONES:1378 13347 #, kde-format 13348 msgid "Pacific/Saipan" 13349 msgstr "प्यासिफिक/साइपन" 13350 13351 #: kdecore/TIMEZONES:1379 13352 #, fuzzy, kde-format 13353 #| msgid "Pacific/Saipan" 13354 msgid "Pacific/Samoa" 13355 msgstr "प्यासिफिक/साइपन" 13356 13357 #: kdecore/TIMEZONES:1380 13358 #, kde-format 13359 msgid "Pacific/Tahiti" 13360 msgstr "प्यासिफिक/टाहिटी" 13361 13362 #. i18n: comment to the previous timezone 13363 #: kdecore/TIMEZONES:1382 13364 #, kde-format 13365 msgid "Society Islands" 13366 msgstr "" 13367 13368 #: kdecore/TIMEZONES:1383 13369 #, kde-format 13370 msgid "Pacific/Tarawa" 13371 msgstr "प्यासिफिक/टारावा" 13372 13373 #. i18n: comment to the previous timezone 13374 #: kdecore/TIMEZONES:1385 13375 #, kde-format 13376 msgid "Gilbert Islands" 13377 msgstr "" 13378 13379 #: kdecore/TIMEZONES:1386 13380 #, kde-format 13381 msgid "Pacific/Tongatapu" 13382 msgstr "प्यासिफिक/टोङ्गाटापु" 13383 13384 #: kdecore/TIMEZONES:1387 13385 #, kde-format 13386 msgid "Pacific/Truk" 13387 msgstr "प्यासिफिक/ट्रक" 13388 13389 #. i18n: comment to the previous timezone 13390 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13391 #, kde-format 13392 msgid "Truk (Chuuk) and Yap" 13393 msgstr "" 13394 13395 #: kdecore/TIMEZONES:1390 13396 #, kde-format 13397 msgid "Pacific/Wake" 13398 msgstr "प्यासिफिक/वेक" 13399 13400 #. i18n: comment to the previous timezone 13401 #: kdecore/TIMEZONES:1392 13402 #, kde-format 13403 msgid "Wake Island" 13404 msgstr "" 13405 13406 #: kdecore/TIMEZONES:1393 13407 #, kde-format 13408 msgid "Pacific/Wallis" 13409 msgstr "प्यासिफिक/वालिस्" 13410 13411 #: kdecore/TIMEZONES:1394 13412 #, kde-format 13413 msgid "Pacific/Yap" 13414 msgstr "प्यासिफिक/याप" 13415 13416 #: kdecore/TIMEZONES:1397 13417 #, kde-format 13418 msgid "Poland" 13419 msgstr "" 13420 13421 #: kdecore/TIMEZONES:1398 13422 #, kde-format 13423 msgid "Portugal" 13424 msgstr "" 13425 13426 #: kdecore/TIMEZONES:1401 13427 #, kde-format 13428 msgid "ROC" 13429 msgstr "" 13430 13431 #: kdecore/TIMEZONES:1402 13432 #, kde-format 13433 msgid "ROK" 13434 msgstr "" 13435 13436 #: kdecore/TIMEZONES:1403 13437 #, fuzzy, kde-format 13438 #| msgid "Asia/Singapore" 13439 msgid "Singapore" 13440 msgstr "एशिया/सिङ्गापुर" 13441 13442 #: kdecore/TIMEZONES:1404 13443 #, kde-format 13444 msgid "Turkey" 13445 msgstr "" 13446 13447 #: kdecore/TIMEZONES:1405 13448 #, kde-format 13449 msgid "US/Alaska" 13450 msgstr "" 13451 13452 #: kdecore/TIMEZONES:1408 13453 #, kde-format 13454 msgid "US/Aleutian" 13455 msgstr "" 13456 13457 #: kdecore/TIMEZONES:1411 13458 #, kde-format 13459 msgid "US/Arizona" 13460 msgstr "" 13461 13462 #: kdecore/TIMEZONES:1414 13463 #, kde-format 13464 msgid "US/Central" 13465 msgstr "" 13466 13467 #: kdecore/TIMEZONES:1417 13468 #, kde-format 13469 msgid "US/East-Indiana" 13470 msgstr "" 13471 13472 #: kdecore/TIMEZONES:1420 13473 #, kde-format 13474 msgid "US/Eastern" 13475 msgstr "" 13476 13477 #: kdecore/TIMEZONES:1423 13478 #, kde-format 13479 msgid "US/Hawaii" 13480 msgstr "" 13481 13482 #: kdecore/TIMEZONES:1426 13483 #, kde-format 13484 msgid "US/Indiana-Starke" 13485 msgstr "" 13486 13487 #: kdecore/TIMEZONES:1429 13488 #, kde-format 13489 msgid "US/Michigan" 13490 msgstr "" 13491 13492 #: kdecore/TIMEZONES:1432 13493 #, kde-format 13494 msgid "US/Mountain" 13495 msgstr "" 13496 13497 #: kdecore/TIMEZONES:1435 13498 #, fuzzy, kde-format 13499 #| msgid "Pacific/Yap" 13500 msgid "US/Pacific" 13501 msgstr "प्यासिफिक/याप" 13502 13503 #: kdecore/TIMEZONES:1438 13504 #, kde-format 13505 msgid "US/Samoa" 13506 msgstr "" 13507 13508 #: kdecore/TIMEZONES:1439 13509 #, kde-format 13510 msgid "W-SU" 13511 msgstr "" 13512 13513 #. i18n: Generic sans serif font presented in font choosers. When selected, 13514 #. the system will choose a real font, mandated by distro settings. 13515 #: kdeui/fonthelpers.cpp:29 13516 #, kde-format 13517 msgctxt "@item Font name" 13518 msgid "Sans Serif" 13519 msgstr "" 13520 13521 #. i18n: Generic serif font presented in font choosers. When selected, 13522 #. the system will choose a real font, mandated by distro settings. 13523 #: kdeui/fonthelpers.cpp:32 13524 #, fuzzy, kde-format 13525 #| msgid "&Verify:" 13526 msgctxt "@item Font name" 13527 msgid "Serif" 13528 msgstr "रूजू गर्नुहोस्:" 13529 13530 #. i18n: Generic monospace font presented in font choosers. When selected, 13531 #. the system will choose a real font, mandated by distro settings. 13532 #: kdeui/fonthelpers.cpp:35 13533 #, kde-format 13534 msgctxt "@item Font name" 13535 msgid "Monospace" 13536 msgstr "" 13537 13538 #: kdeui/k4timezonewidget.cpp:62 13539 #, fuzzy, kde-format 13540 #| msgid "Area" 13541 msgctxt "Define an area in the time zone, like a town area" 13542 msgid "Area" 13543 msgstr "क्षेत्र" 13544 13545 #: kdeui/k4timezonewidget.cpp:62 13546 #, fuzzy, kde-format 13547 #| msgid "Region" 13548 msgctxt "Time zone" 13549 msgid "Region" 13550 msgstr "प्रदेश" 13551 13552 #: kdeui/k4timezonewidget.cpp:62 13553 #, fuzzy, kde-format 13554 msgid "Comment" 13555 msgstr "टिप्पणी" 13556 13557 #: kdeui/kapplication.cpp:741 13558 #, kde-format 13559 msgid "The style '%1' was not found" 13560 msgstr "शैली '%1' फेला परेन" 13561 13562 #: kdeui/kcolordialog.cpp:102 13563 #, kde-format 13564 msgctxt "palette name" 13565 msgid "* Recent Colors *" 13566 msgstr "* Recent Colors *" 13567 13568 #: kdeui/kcolordialog.cpp:103 13569 #, kde-format 13570 msgctxt "palette name" 13571 msgid "* Custom Colors *" 13572 msgstr "* Custom Colors *" 13573 13574 #: kdeui/kcolordialog.cpp:104 13575 #, kde-format 13576 msgctxt "palette name" 13577 msgid "Forty Colors" 13578 msgstr "चालीसवटा रङ" 13579 13580 #: kdeui/kcolordialog.cpp:105 13581 #, kde-format 13582 msgctxt "palette name" 13583 msgid "Oxygen Colors" 13584 msgstr "अक्सिजन रङ" 13585 13586 #: kdeui/kcolordialog.cpp:106 13587 #, kde-format 13588 msgctxt "palette name" 13589 msgid "Rainbow Colors" 13590 msgstr "इन्द्रेणी रङ" 13591 13592 #: kdeui/kcolordialog.cpp:107 13593 #, kde-format 13594 msgctxt "palette name" 13595 msgid "Royal Colors" 13596 msgstr "रोयल रङ" 13597 13598 #: kdeui/kcolordialog.cpp:108 13599 #, kde-format 13600 msgctxt "palette name" 13601 msgid "Web Colors" 13602 msgstr "वेब रङ" 13603 13604 #: kdeui/kcolordialog.cpp:572 13605 #, kde-format 13606 msgid "Named Colors" 13607 msgstr "नामकरण गरिएको रङ" 13608 13609 #: kdeui/kcolordialog.cpp:746 13610 #, kde-format 13611 msgctxt "" 13612 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13613 "them)" 13614 msgid "" 13615 "Unable to read X11 RGB color strings. The following file location was " 13616 "examined:\n" 13617 "%2" 13618 msgid_plural "" 13619 "Unable to read X11 RGB color strings. The following file locations were " 13620 "examined:\n" 13621 "%2" 13622 msgstr[0] "" 13623 msgstr[1] "" 13624 13625 #: kdeui/kcolordialog.cpp:997 13626 #, kde-format 13627 msgid "Select Color" 13628 msgstr "रङ चयन गर्नुहोस्" 13629 13630 #: kdeui/kcolordialog.cpp:1077 13631 #, kde-format 13632 msgid "Hue:" 13633 msgstr "ह्यु:" 13634 13635 #: kdeui/kcolordialog.cpp:1083 13636 #, kde-format 13637 msgctxt "The angular degree unit (for hue)" 13638 msgid "°" 13639 msgstr "" 13640 13641 #: kdeui/kcolordialog.cpp:1088 13642 #, fuzzy, kde-format 13643 #| msgid "Saturday" 13644 msgid "Saturation:" 13645 msgstr "शनिबार" 13646 13647 #: kdeui/kcolordialog.cpp:1098 13648 #, fuzzy, kde-format 13649 #| msgid "Value:" 13650 msgctxt "This is the V of HSV" 13651 msgid "Value:" 13652 msgstr "मान:" 13653 13654 #: kdeui/kcolordialog.cpp:1111 13655 #, kde-format 13656 msgid "Red:" 13657 msgstr "रातो:" 13658 13659 #: kdeui/kcolordialog.cpp:1121 13660 #, kde-format 13661 msgid "Green:" 13662 msgstr "हरियो:" 13663 13664 #: kdeui/kcolordialog.cpp:1131 13665 #, kde-format 13666 msgid "Blue:" 13667 msgstr "निलो:" 13668 13669 #: kdeui/kcolordialog.cpp:1152 13670 #, kde-format 13671 msgid "Alpha:" 13672 msgstr "" 13673 13674 #: kdeui/kcolordialog.cpp:1206 13675 #, kde-format 13676 msgid "&Add to Custom Colors" 13677 msgstr "अनुकूल रङलाई थप्नुहोस्" 13678 13679 #: kdeui/kcolordialog.cpp:1234 13680 #, kde-format 13681 msgid "Name:" 13682 msgstr "नाम:" 13683 13684 #: kdeui/kcolordialog.cpp:1241 13685 #, kde-format 13686 msgid "HTML:" 13687 msgstr "एचटीएमएल:" 13688 13689 #: kdeui/kcolordialog.cpp:1328 13690 #, kde-format 13691 msgid "Default color" 13692 msgstr "पूर्वनिर्धारित रङ" 13693 13694 #: kdeui/kcolordialog.cpp:1393 13695 #, kde-format 13696 msgid "-default-" 13697 msgstr "-पूर्वनिर्धारण-" 13698 13699 #: kdeui/kcolordialog.cpp:1668 13700 #, kde-format 13701 msgid "-unnamed-" 13702 msgstr "-बेनामी-" 13703 13704 #: kdeui/kdeprintdialog.cpp:40 13705 #, fuzzy, kde-format 13706 #| msgid "Print" 13707 msgctxt "@title:window" 13708 msgid "Print" 13709 msgstr "मुद्रण गर्नुहोस्" 13710 13711 #: kdeui/kdialog.cpp:271 13712 #, kde-format 13713 msgid "&Try" 13714 msgstr "प्रयास गर्नुहोस्" 13715 13716 #: kdeui/kdialog.cpp:484 13717 #, kde-format 13718 msgid "modified" 13719 msgstr "परिमार्जित" 13720 13721 #: kdeui/kdialog.cpp:495 13722 #, kde-format 13723 msgctxt "Document/application separator in titlebar" 13724 msgid " – " 13725 msgstr "" 13726 13727 #: kdeui/kdialog.cpp:896 13728 #, kde-format 13729 msgid "&Details" 13730 msgstr "विवरण" 13731 13732 #: kdeui/kdialog.cpp:1054 13733 #, kde-format 13734 msgid "Get help..." 13735 msgstr "मद्दत प्राप्त गर्नुहोस्..." 13736 13737 #: kdeui/keditlistbox.cpp:324 13738 #, kde-format 13739 msgid "&Add" 13740 msgstr "थप्नुहोस्" 13741 13742 #: kdeui/keditlistbox.cpp:336 13743 #, kde-format 13744 msgid "&Remove" 13745 msgstr "हटाउनुहोस्" 13746 13747 #: kdeui/keditlistbox.cpp:348 13748 #, kde-format 13749 msgid "Move &Up" 13750 msgstr "माथि सार्नुहोस्" 13751 13752 #: kdeui/keditlistbox.cpp:353 13753 #, kde-format 13754 msgid "Move &Down" 13755 msgstr "तल सार्नुहोस्" 13756 13757 #. i18n: A shorter version of the alphabet test phrase translated in 13758 #. another message. It is displayed in the dropdown list of font previews 13759 #. (the font selection combo box), so keep it under the length equivalent 13760 #. to 60 or so proportional Latin characters. 13761 #: kdeui/kfontcombobox.cpp:48 13762 #, fuzzy, kde-format 13763 #| msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13764 msgctxt "short" 13765 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13766 msgstr "The Quick Brown Fox Jumps Over The Lazy Dog" 13767 13768 #. i18n: Integer which indicates the script you used in the sample text 13769 #. for font previews in your language. For the possible values, see 13770 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13771 #. If the sample text contains several scripts, their IDs can be given 13772 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13773 #: kdeui/kfontcombobox.cpp:119 13774 #, fuzzy, kde-format 13775 #| msgid "1" 13776 msgctxt "Numeric IDs of scripts for font previews" 13777 msgid "1" 13778 msgstr "1" 13779 13780 #: kdeui/kfontdialog.cpp:51 13781 #, kde-format 13782 msgid "Select Font" 13783 msgstr "फन्ट चयन गर्नुहोस्" 13784 13785 #: kdeui/kprintpreview.cpp:118 13786 #, kde-format 13787 msgid "Could not load print preview part" 13788 msgstr "मुद्रण पूर्वालोकन भाग लोड गर्न सकेन" 13789 13790 #: kdeui/kprintpreview.cpp:135 13791 #, kde-format 13792 msgid "Print Preview" 13793 msgstr "मुद्रण पूर्वावलोकन" 13794 13795 #: kdeui/ksystemtrayicon.cpp:153 13796 #, kde-format 13797 msgid "Minimize" 13798 msgstr "सानो पार्नुहोस्" 13799 13800 #: kdeui/ksystemtrayicon.cpp:205 13801 #, kde-format 13802 msgid "&Minimize" 13803 msgstr "सानो पार्नुहोस्" 13804 13805 #: kdeui/ksystemtrayicon.cpp:207 13806 #, kde-format 13807 msgid "&Restore" 13808 msgstr "पूर्वावस्थामा ल्याउनुहोस्" 13809 13810 #: kdeui/ksystemtrayicon.cpp:226 13811 #, kde-format 13812 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13813 msgstr "<qt>तपाईँ <b>%1</b> अन्त्य गर्न निश्चित हुनुहुन्छ ?</qt>" 13814 13815 #: kdeui/ksystemtrayicon.cpp:229 13816 #, kde-format 13817 msgid "Confirm Quit From System Tray" 13818 msgstr "प्रणाली ट्रेबाट निस्कन यकीन गर्नुहोस्" 13819 13820 #: kdeui/kundostack.cpp:47 13821 #, kde-format 13822 msgid "Redo" 13823 msgstr "रिडू गर्नुहोस्" 13824 13825 #: kdeui/kundostack.cpp:66 13826 #, kde-format 13827 msgid "Undo" 13828 msgstr "पूर्वस्थितिमा फर्काउनुहोस्" 13829 13830 #: kdeui/kuniqueapplication.cpp:79 13831 #, kde-format 13832 msgid "Do not run in the background." 13833 msgstr "पृष्ठभूमिमा नचलाउनुहोस् ।" 13834 13835 #: kdeui/kuniqueapplication.cpp:81 13836 #, kde-format 13837 msgid "Internally added if launched from Finder" 13838 msgstr "खोजकर्ताबाट सुरु गरिएमा आन्तरिक रूपमा थपिन्छ" 13839 13840 #: kio/kcommentwidget.cpp:68 13841 #, fuzzy, kde-format 13842 #| msgid "Add Entry..." 13843 msgctxt "@label" 13844 msgid "Add Comment..." 13845 msgstr "प्रविष्ट थप्नुहोस्..." 13846 13847 #: kio/kcommentwidget.cpp:74 13848 #, fuzzy, kde-format 13849 #| msgid "Change &Icon..." 13850 msgctxt "@label" 13851 msgid "Change..." 13852 msgstr "प्रतिमा परिवर्तन गर्नुहोस्..." 13853 13854 #: kio/kcommentwidget.cpp:128 13855 #, fuzzy, kde-format 13856 #| msgid "Comment" 13857 msgctxt "@title:window" 13858 msgid "Change Comment" 13859 msgstr "टिप्पणी" 13860 13861 #: kio/kcommentwidget.cpp:129 13862 #, fuzzy, kde-format 13863 #| msgid "Comment" 13864 msgctxt "@title:window" 13865 msgid "Add Comment" 13866 msgstr "टिप्पणी" 13867 13868 #: kio/kdevicelistmodel.cpp:115 13869 #, kde-format 13870 msgid "Device name" 13871 msgstr "यन्त्र नाम" 13872 13873 #: kio/kdirselectdialog.cpp:136 13874 #, fuzzy, kde-format 13875 #| msgid "New Folder" 13876 msgctxt "folder name" 13877 msgid "New Folder" 13878 msgstr "नयाँ फोल्डर" 13879 13880 #: kio/kdirselectdialog.cpp:141 13881 #, fuzzy, kde-format 13882 #| msgid "New Folder" 13883 msgctxt "@title:window" 13884 msgid "New Folder" 13885 msgstr "नयाँ फोल्डर" 13886 13887 #: kio/kdirselectdialog.cpp:142 13888 #, fuzzy, kde-format 13889 #| msgid "" 13890 #| "Create new folder in:\n" 13891 #| "%1" 13892 msgctxt "@label:textbox" 13893 msgid "" 13894 "Create new folder in:\n" 13895 "%1" 13896 msgstr "" 13897 "नयाँ फोल्डर यसमा सिर्जना गर्नुहोस्:\n" 13898 "%1" 13899 13900 #: kio/kdirselectdialog.cpp:172 13901 #, kde-format 13902 msgid "A file or folder named %1 already exists." 13903 msgstr "%1 नाम भएको फाइल वा फोल्डर पहिला नै अवस्थित छ ।" 13904 13905 #: kio/kdirselectdialog.cpp:175 13906 #, kde-format 13907 msgid "You do not have permission to create that folder." 13908 msgstr "तपाईँलाई त्यो फोल्डर सिर्जना गर्ने अनुमति छैन ।" 13909 13910 #: kio/kdirselectdialog.cpp:290 13911 #, fuzzy, kde-format 13912 #| msgid "Select Folder" 13913 msgctxt "@title:window" 13914 msgid "Select Folder" 13915 msgstr "फोल्डर चयन गर्नुहोस्" 13916 13917 #: kio/kdirselectdialog.cpp:299 13918 #, fuzzy, kde-format 13919 #| msgid "New Folder..." 13920 msgctxt "@action:button" 13921 msgid "New Folder..." 13922 msgstr "नयाँ फोल्डर..." 13923 13924 #: kio/kdirselectdialog.cpp:345 13925 #, fuzzy, kde-format 13926 #| msgid "New Folder..." 13927 msgctxt "@action:inmenu" 13928 msgid "New Folder..." 13929 msgstr "नयाँ फोल्डर..." 13930 13931 #: kio/kdirselectdialog.cpp:352 13932 #, fuzzy, kde-format 13933 #| msgid "Move to Trash" 13934 msgctxt "@action:inmenu" 13935 msgid "Move to Trash" 13936 msgstr "रद्दी टोकरीमा सार्नुहोस्" 13937 13938 #: kio/kdirselectdialog.cpp:359 13939 #, fuzzy, kde-format 13940 #| msgid "Delete" 13941 msgctxt "@action:inmenu" 13942 msgid "Delete" 13943 msgstr "मेट्नुहोस्" 13944 13945 #: kio/kdirselectdialog.cpp:368 13946 #, fuzzy, kde-format 13947 #| msgid "Show Hidden Folders" 13948 msgctxt "@option:check" 13949 msgid "Show Hidden Folders" 13950 msgstr "लुकेका फोल्डर देखाउनुहोस्" 13951 13952 #: kio/kdirselectdialog.cpp:375 13953 #, fuzzy, kde-format 13954 #| msgid "Properties" 13955 msgctxt "@action:inmenu" 13956 msgid "Properties" 13957 msgstr "गुण" 13958 13959 #: kio/kfiledialog.cpp:132 13960 #, fuzzy, kde-format 13961 #| msgid "*|All Files" 13962 msgid "*|All files" 13963 msgstr "*|सबै फाइल" 13964 13965 #: kio/kfiledialog.cpp:332 13966 #, kde-format 13967 msgid "All Supported Files" 13968 msgstr "सबै समर्थित फाइल" 13969 13970 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13971 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13972 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13973 #, kde-format 13974 msgid "Open" 13975 msgstr "खोल्नुहोस्" 13976 13977 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13978 #: kio/kfiledialog.cpp:838 13979 #, kde-format 13980 msgid "Save As" 13981 msgstr "यस रूपमा बचत गर्नुहोस्" 13982 13983 #: kio/kfilemetadataprovider.cpp:245 13984 #, kde-format 13985 msgctxt "@item:intable" 13986 msgid "%1 item" 13987 msgid_plural "%1 items" 13988 msgstr[0] "" 13989 msgstr[1] "" 13990 13991 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13992 #, fuzzy, kde-format 13993 msgctxt "@label" 13994 msgid "Comment" 13995 msgstr "टिप्पणी" 13996 13997 #: kio/kfilemetadataprovider.cpp:447 13998 #, fuzzy, kde-format 13999 #| msgid "Modified" 14000 msgctxt "@label" 14001 msgid "Modified" 14002 msgstr "परिमार्जित" 14003 14004 #: kio/kfilemetadataprovider.cpp:448 14005 #, fuzzy, kde-format 14006 #| msgid "Owner" 14007 msgctxt "@label" 14008 msgid "Owner" 14009 msgstr "मालिक" 14010 14011 #: kio/kfilemetadataprovider.cpp:449 14012 #, fuzzy, kde-format 14013 #| msgid "Permissions" 14014 msgctxt "@label" 14015 msgid "Permissions" 14016 msgstr "अनुमति" 14017 14018 #: kio/kfilemetadataprovider.cpp:450 14019 #, fuzzy, kde-format 14020 #| msgid "Stating" 14021 msgctxt "@label" 14022 msgid "Rating" 14023 msgstr "अवस्थित गर्दै" 14024 14025 #: kio/kfilemetadataprovider.cpp:451 14026 #, fuzzy, kde-format 14027 #| msgid "Size" 14028 msgctxt "@label" 14029 msgid "Size" 14030 msgstr "साइज" 14031 14032 #: kio/kfilemetadataprovider.cpp:452 14033 #, fuzzy, kde-format 14034 #| msgid "Trash" 14035 msgctxt "@label" 14036 msgid "Tags" 14037 msgstr "रद्दीटोकरी" 14038 14039 #: kio/kfilemetadataprovider.cpp:453 14040 #, fuzzy, kde-format 14041 #| msgid "Size:" 14042 msgctxt "@label" 14043 msgid "Total Size" 14044 msgstr "साइज:" 14045 14046 #: kio/kfilemetadataprovider.cpp:454 14047 #, fuzzy, kde-format 14048 #| msgid "Type" 14049 msgctxt "@label" 14050 msgid "Type" 14051 msgstr "प्रकार" 14052 14053 #: kio/kfilemetadatareaderprocess.cpp:234 14054 #, kde-format 14055 msgid "KFileMetaDataReader" 14056 msgstr "" 14057 14058 #: kio/kfilemetadatareaderprocess.cpp:236 14059 #, kde-format 14060 msgid "KFileMetaDataReader can be used to read metadata from a file" 14061 msgstr "" 14062 14063 #: kio/kfilemetadatareaderprocess.cpp:238 14064 #, kde-format 14065 msgid "(C) 2011, Peter Penz" 14066 msgstr "" 14067 14068 #: kio/kfilemetadatareaderprocess.cpp:239 14069 #, kde-format 14070 msgid "Peter Penz" 14071 msgstr "" 14072 14073 #: kio/kfilemetadatareaderprocess.cpp:239 14074 #, fuzzy, kde-format 14075 #| msgid "Current location" 14076 msgid "Current maintainer" 14077 msgstr "हालको स्थान" 14078 14079 #: kio/kfilemetadatareaderprocess.cpp:244 14080 #, kde-format 14081 msgid "Only the meta data that is part of the file is read" 14082 msgstr "" 14083 14084 #: kio/kfilemetadatareaderprocess.cpp:245 14085 #, kde-format 14086 msgid "List of URLs where the meta-data should be read from" 14087 msgstr "" 14088 14089 #: kio/kfilemetainfowidget.cpp:161 14090 #, kde-format 14091 msgid "<Error>" 14092 msgstr "<Error>" 14093 14094 #: kio/kfiletreeview.cpp:192 14095 #, fuzzy, kde-format 14096 #| msgid "Show Hidden Folders" 14097 msgid "Show Hidden Folders" 14098 msgstr "लुकेका फोल्डर देखाउनुहोस्" 14099 14100 #: kio/kimageio.cpp:46 14101 #, kde-format 14102 msgid "All Pictures" 14103 msgstr "सबै तस्वीर" 14104 14105 #: kio/kmetaprops.cpp:57 14106 #, fuzzy, kde-format 14107 #| msgid "Configure" 14108 msgctxt "@title:window" 14109 msgid "Configure Shown Data" 14110 msgstr "कन्फिगर गर्नुहोस्" 14111 14112 #: kio/kmetaprops.cpp:60 14113 #, kde-format 14114 msgctxt "@label::textbox" 14115 msgid "Select which data should be shown:" 14116 msgstr "" 14117 14118 #: kio/kmetaprops.cpp:123 14119 #, fuzzy, kde-format 14120 #| msgid "Configure" 14121 msgctxt "@action:button" 14122 msgid "Configure..." 14123 msgstr "कन्फिगर गर्नुहोस्" 14124 14125 #: kio/kmetaprops.cpp:133 14126 #, fuzzy, kde-format 14127 #| msgid "Information" 14128 msgctxt "@title:tab" 14129 msgid "Information" 14130 msgstr "जानकारी" 14131 14132 #: kio/knfotranslator.cpp:40 14133 #, fuzzy, kde-format 14134 #| msgid "Created:" 14135 msgctxt "@label creation date" 14136 msgid "Created" 14137 msgstr "सिर्जना गरिएको:" 14138 14139 #: kio/knfotranslator.cpp:41 14140 #, fuzzy, kde-format 14141 #| msgid "Size" 14142 msgctxt "@label file content size" 14143 msgid "Size" 14144 msgstr "साइज" 14145 14146 #: kio/knfotranslator.cpp:42 14147 #, kde-format 14148 msgctxt "@label file depends from" 14149 msgid "Depends" 14150 msgstr "" 14151 14152 #: kio/knfotranslator.cpp:43 14153 #, fuzzy, kde-format 14154 #| msgid "Description" 14155 msgctxt "@label" 14156 msgid "Description" 14157 msgstr "वर्णन" 14158 14159 #: kio/knfotranslator.cpp:44 14160 #, fuzzy, kde-format 14161 #| msgid "&General" 14162 msgctxt "@label Software used to generate content" 14163 msgid "Generator" 14164 msgstr "सामान्य" 14165 14166 #: kio/knfotranslator.cpp:45 14167 #, kde-format 14168 msgctxt "" 14169 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14170 msgid "Has Part" 14171 msgstr "" 14172 14173 #: kio/knfotranslator.cpp:46 14174 #, kde-format 14175 msgctxt "" 14176 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14177 "nie#hasLogicalPart" 14178 msgid "Has Logical Part" 14179 msgstr "" 14180 14181 #: kio/knfotranslator.cpp:47 14182 #, fuzzy, kde-format 14183 #| msgid "Parent Folder" 14184 msgctxt "@label parent directory" 14185 msgid "Part of" 14186 msgstr "प्रमूल फोल्डर" 14187 14188 #: kio/knfotranslator.cpp:48 14189 #, kde-format 14190 msgctxt "@label" 14191 msgid "Keyword" 14192 msgstr "" 14193 14194 #: kio/knfotranslator.cpp:49 14195 #, fuzzy, kde-format 14196 #| msgid "Modified" 14197 msgctxt "@label modified date of file" 14198 msgid "Modified" 14199 msgstr "परिमार्जित" 14200 14201 #: kio/knfotranslator.cpp:50 14202 #, fuzzy, kde-format 14203 #| msgid "Mime Type" 14204 msgctxt "@label" 14205 msgid "MIME Type" 14206 msgstr "माइम प्रकार" 14207 14208 #: kio/knfotranslator.cpp:51 14209 #, fuzzy, kde-format 14210 #| msgid "Contents:" 14211 msgctxt "@label" 14212 msgid "Content" 14213 msgstr "सामाग्रीहरू:" 14214 14215 #: kio/knfotranslator.cpp:52 14216 #, fuzzy, kde-format 14217 #| msgid "created on %1" 14218 msgctxt "@label" 14219 msgid "Related To" 14220 msgstr "%1 मा सिर्जना गरिएको" 14221 14222 #: kio/knfotranslator.cpp:53 14223 #, fuzzy, kde-format 14224 #| msgid "Subject line" 14225 msgctxt "@label" 14226 msgid "Subject" 14227 msgstr "विषय रेखा" 14228 14229 #: kio/knfotranslator.cpp:54 14230 #, fuzzy, kde-format 14231 #| msgid "File" 14232 msgctxt "@label music title" 14233 msgid "Title" 14234 msgstr "फाइल" 14235 14236 #: kio/knfotranslator.cpp:55 14237 #, kde-format 14238 msgctxt "@label file URL" 14239 msgid "File Location" 14240 msgstr "" 14241 14242 #: kio/knfotranslator.cpp:56 14243 #, fuzzy, kde-format 14244 #| msgid "Created:" 14245 msgctxt "@label" 14246 msgid "Creator" 14247 msgstr "सिर्जना गरिएको:" 14248 14249 #: kio/knfotranslator.cpp:57 14250 #, kde-format 14251 msgctxt "@label" 14252 msgid "Average Bitrate" 14253 msgstr "" 14254 14255 #: kio/knfotranslator.cpp:58 14256 #, kde-format 14257 msgctxt "@label" 14258 msgid "Channels" 14259 msgstr "" 14260 14261 #: kio/knfotranslator.cpp:59 14262 #, fuzzy, kde-format 14263 #| msgid "Categories" 14264 msgctxt "@label number of characters" 14265 msgid "Characters" 14266 msgstr "कोटि" 14267 14268 #: kio/knfotranslator.cpp:60 14269 #, fuzzy, kde-format 14270 #| msgid "C&onnect" 14271 msgctxt "@label" 14272 msgid "Codec" 14273 msgstr "जडान गर्नुहोस्" 14274 14275 #: kio/knfotranslator.cpp:61 14276 #, kde-format 14277 msgctxt "@label" 14278 msgid "Color Depth" 14279 msgstr "" 14280 14281 #: kio/knfotranslator.cpp:62 14282 #, fuzzy, kde-format 14283 #| msgid "Destination" 14284 msgctxt "@label" 14285 msgid "Duration" 14286 msgstr "गन्तव्य" 14287 14288 #: kio/knfotranslator.cpp:63 14289 #, fuzzy, kde-format 14290 #| msgid "Device name" 14291 msgctxt "@label" 14292 msgid "Filename" 14293 msgstr "यन्त्र नाम" 14294 14295 #: kio/knfotranslator.cpp:64 14296 #, kde-format 14297 msgctxt "@label" 14298 msgid "Hash" 14299 msgstr "" 14300 14301 #: kio/knfotranslator.cpp:65 14302 #, kde-format 14303 msgctxt "@label" 14304 msgid "Height" 14305 msgstr "" 14306 14307 #: kio/knfotranslator.cpp:66 14308 #, kde-format 14309 msgctxt "@label" 14310 msgid "Interlace Mode" 14311 msgstr "" 14312 14313 #: kio/knfotranslator.cpp:67 14314 #, fuzzy, kde-format 14315 #| msgid "Link" 14316 msgctxt "@label number of lines" 14317 msgid "Lines" 14318 msgstr "लिङ्क गर्नुहोस्" 14319 14320 #: kio/knfotranslator.cpp:68 14321 #, kde-format 14322 msgctxt "@label" 14323 msgid "Programming Language" 14324 msgstr "" 14325 14326 #: kio/knfotranslator.cpp:69 14327 #, kde-format 14328 msgctxt "@label" 14329 msgid "Sample Rate" 14330 msgstr "" 14331 14332 #: kio/knfotranslator.cpp:70 14333 #, fuzzy, kde-format 14334 #| msgid "Write" 14335 msgctxt "@label" 14336 msgid "Width" 14337 msgstr "लेख्नुहोस्" 14338 14339 #: kio/knfotranslator.cpp:71 14340 #, kde-format 14341 msgctxt "@label number of words" 14342 msgid "Words" 14343 msgstr "" 14344 14345 #: kio/knfotranslator.cpp:72 14346 #, kde-format 14347 msgctxt "@label EXIF aperture value" 14348 msgid "Aperture" 14349 msgstr "" 14350 14351 #: kio/knfotranslator.cpp:73 14352 #, kde-format 14353 msgctxt "@label EXIF" 14354 msgid "Exposure Bias Value" 14355 msgstr "" 14356 14357 #: kio/knfotranslator.cpp:74 14358 #, fuzzy, kde-format 14359 #| msgid "Exposure:" 14360 msgctxt "@label EXIF" 14361 msgid "Exposure Time" 14362 msgstr "प्रदर्शन:" 14363 14364 #: kio/knfotranslator.cpp:75 14365 #, fuzzy, kde-format 14366 #| msgid "Class" 14367 msgctxt "@label EXIF" 14368 msgid "Flash" 14369 msgstr "वर्ग" 14370 14371 #: kio/knfotranslator.cpp:76 14372 #, kde-format 14373 msgctxt "@label EXIF" 14374 msgid "Focal Length" 14375 msgstr "" 14376 14377 #: kio/knfotranslator.cpp:77 14378 #, kde-format 14379 msgctxt "@label EXIF" 14380 msgid "Focal Length 35 mm" 14381 msgstr "" 14382 14383 #: kio/knfotranslator.cpp:78 14384 #, kde-format 14385 msgctxt "@label EXIF" 14386 msgid "ISO Speed Ratings" 14387 msgstr "" 14388 14389 #: kio/knfotranslator.cpp:79 14390 #, fuzzy, kde-format 14391 #| msgid "Mask" 14392 msgctxt "@label EXIF" 14393 msgid "Make" 14394 msgstr "मास्क" 14395 14396 #: kio/knfotranslator.cpp:80 14397 #, kde-format 14398 msgctxt "@label EXIF" 14399 msgid "Metering Mode" 14400 msgstr "" 14401 14402 #: kio/knfotranslator.cpp:81 14403 #, fuzzy, kde-format 14404 #| msgid "Modified" 14405 msgctxt "@label EXIF" 14406 msgid "Model" 14407 msgstr "परिमार्जित" 14408 14409 #: kio/knfotranslator.cpp:82 14410 #, fuzzy, kde-format 14411 #| msgid "Organization:" 14412 msgctxt "@label EXIF" 14413 msgid "Orientation" 14414 msgstr "सङ्गठन:" 14415 14416 #: kio/knfotranslator.cpp:83 14417 #, kde-format 14418 msgctxt "@label EXIF" 14419 msgid "White Balance" 14420 msgstr "" 14421 14422 #: kio/knfotranslator.cpp:84 14423 #, fuzzy, kde-format 14424 #| msgid "Directory" 14425 msgctxt "@label video director" 14426 msgid "Director" 14427 msgstr "डाइरेक्टरी" 14428 14429 #: kio/knfotranslator.cpp:85 14430 #, fuzzy, kde-format 14431 #| msgid "&General" 14432 msgctxt "@label music genre" 14433 msgid "Genre" 14434 msgstr "सामान्य" 14435 14436 #: kio/knfotranslator.cpp:86 14437 #, kde-format 14438 msgctxt "@label music album" 14439 msgid "Album" 14440 msgstr "" 14441 14442 #: kio/knfotranslator.cpp:87 14443 #, kde-format 14444 msgctxt "@label" 14445 msgid "Performer" 14446 msgstr "" 14447 14448 #: kio/knfotranslator.cpp:88 14449 #, fuzzy, kde-format 14450 #| msgid "&Remove '%1'" 14451 msgctxt "@label" 14452 msgid "Release Date" 14453 msgstr "'%1' हटाउनुहोस्" 14454 14455 #: kio/knfotranslator.cpp:89 14456 #, kde-format 14457 msgctxt "@label music track number" 14458 msgid "Track" 14459 msgstr "" 14460 14461 #: kio/knfotranslator.cpp:90 14462 #, fuzzy, kde-format 14463 #| msgid "URL Resource Invalid" 14464 msgctxt "@label resource created time" 14465 msgid "Resource Created" 14466 msgstr "URL संसाधन अवैद्य छ" 14467 14468 #: kio/knfotranslator.cpp:91 14469 #, fuzzy, kde-format 14470 #| msgid "Source" 14471 msgctxt "@label" 14472 msgid "Sub Resource" 14473 msgstr "स्रोत:" 14474 14475 #: kio/knfotranslator.cpp:92 14476 #, fuzzy, kde-format 14477 #| msgid "Modified" 14478 msgctxt "@label resource last modified" 14479 msgid "Resource Modified" 14480 msgstr "परिमार्जित" 14481 14482 #: kio/knfotranslator.cpp:93 14483 #, fuzzy, kde-format 14484 #| msgid "Stating" 14485 msgctxt "@label" 14486 msgid "Numeric Rating" 14487 msgstr "अवस्थित गर्दै" 14488 14489 #: kio/knfotranslator.cpp:94 14490 #, kde-format 14491 msgctxt "@label" 14492 msgid "Copied From" 14493 msgstr "" 14494 14495 #: kio/knfotranslator.cpp:95 14496 #, kde-format 14497 msgctxt "@label" 14498 msgid "First Usage" 14499 msgstr "" 14500 14501 #: kio/knfotranslator.cpp:96 14502 #, kde-format 14503 msgctxt "@label" 14504 msgid "Last Usage" 14505 msgstr "" 14506 14507 #: kio/knfotranslator.cpp:97 14508 #, fuzzy, kde-format 14509 #| msgid "Comment" 14510 msgctxt "@label" 14511 msgid "Usage Count" 14512 msgstr "टिप्पणी" 14513 14514 #: kio/knfotranslator.cpp:98 14515 #, kde-format 14516 msgctxt "@label" 14517 msgid "Unix File Group" 14518 msgstr "" 14519 14520 #: kio/knfotranslator.cpp:99 14521 #, kde-format 14522 msgctxt "@label" 14523 msgid "Unix File Mode" 14524 msgstr "" 14525 14526 #: kio/knfotranslator.cpp:100 14527 #, fuzzy, kde-format 14528 #| msgid "Open file dialog" 14529 msgctxt "@label" 14530 msgid "Unix File Owner" 14531 msgstr "संवाद फाइल खोल्नुहोस्" 14532 14533 #: kio/knfotranslator.cpp:101 14534 #, fuzzy, kde-format 14535 #| msgid "Type" 14536 msgctxt "@label file type" 14537 msgid "Type" 14538 msgstr "प्रकार" 14539 14540 #: kio/knfotranslator.cpp:102 14541 #, kde-format 14542 msgctxt "@label Number of fuzzy translations" 14543 msgid "Fuzzy Translations" 14544 msgstr "" 14545 14546 #: kio/knfotranslator.cpp:103 14547 #, kde-format 14548 msgctxt "@label Name of last translator" 14549 msgid "Last Translator" 14550 msgstr "" 14551 14552 #: kio/knfotranslator.cpp:104 14553 #, kde-format 14554 msgctxt "@label Number of obsolete translations" 14555 msgid "Obsolete Translations" 14556 msgstr "" 14557 14558 #: kio/knfotranslator.cpp:105 14559 #, kde-format 14560 msgctxt "@label" 14561 msgid "Translation Source Date" 14562 msgstr "" 14563 14564 #: kio/knfotranslator.cpp:106 14565 #, kde-format 14566 msgctxt "@label Number of total translations" 14567 msgid "Total Translations" 14568 msgstr "" 14569 14570 #: kio/knfotranslator.cpp:107 14571 #, fuzzy, kde-format 14572 #| msgid "Created:" 14573 msgctxt "@label Number of translated strings" 14574 msgid "Translated" 14575 msgstr "सिर्जना गरिएको:" 14576 14577 #: kio/knfotranslator.cpp:108 14578 #, kde-format 14579 msgctxt "@label" 14580 msgid "Translation Date" 14581 msgstr "" 14582 14583 #: kio/knfotranslator.cpp:109 14584 #, kde-format 14585 msgctxt "@label Number of untranslated strings" 14586 msgid "Untranslated" 14587 msgstr "" 14588 14589 #: kio/kpreviewprops.cpp:51 14590 #, kde-format 14591 msgid "P&review" 14592 msgstr "पूर्वावलोकन" 14593 14594 #: kio/kscan.cpp:49 14595 #, kde-format 14596 msgid "Acquire Image" 14597 msgstr "प्राप्त छवि" 14598 14599 #: kio/kscan.cpp:97 14600 #, kde-format 14601 msgid "OCR Image" 14602 msgstr "ओसीआर छवि" 14603 14604 #: kio/netaccess.cpp:102 14605 #, kde-format 14606 msgid "File '%1' is not readable" 14607 msgstr "'%1' फाइल पढ्नयोग्य छैन" 14608 14609 #: kio/netaccess.cpp:435 14610 #, kde-format 14611 msgid "ERROR: Unknown protocol '%1'" 14612 msgstr "त्रुटि: अज्ञात प्रोटोकल '%1'" 14613 14614 #: kio/passworddialog.cpp:56 14615 #, kde-format 14616 msgid "Authorization Dialog" 14617 msgstr "प्रमाणीकरण संवाद" 14618 14619 #: kioslave/metainfo/metainfo.cpp:98 14620 #, kde-format 14621 msgid "No metainfo for %1" 14622 msgstr "%1 का लागि बहुसूचना छैन" 14623 14624 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14625 #: kssl/kcm/cacertificates.ui:24 14626 #, fuzzy, kde-format 14627 #| msgid "Organization:" 14628 msgid "Organization / Common Name" 14629 msgstr "सङ्गठन:" 14630 14631 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14632 #: kssl/kcm/cacertificates.ui:29 14633 #, fuzzy, kde-format 14634 #| msgid "Organizational unit:" 14635 msgid "Organizational Unit" 14636 msgstr "सङ्गठनात्मक एकाइ:" 14637 14638 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14639 #: kssl/kcm/cacertificates.ui:42 14640 #, kde-format 14641 msgid "Display..." 14642 msgstr "" 14643 14644 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14645 #: kssl/kcm/cacertificates.ui:68 14646 #, fuzzy, kde-format 14647 #| msgid "disable XIM" 14648 msgid "Disable" 14649 msgstr "XIM अक्षम पार्नुहोस्" 14650 14651 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14652 #: kssl/kcm/cacertificates.ui:78 14653 #, fuzzy, kde-format 14654 #| msgid "Emblems" 14655 msgid "Enable" 14656 msgstr "चिन्ह लगाउँछ" 14657 14658 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14659 #: kssl/kcm/cacertificates.ui:104 14660 #, kde-format 14661 msgid "Remove" 14662 msgstr "हटाउनुहोस्" 14663 14664 #. i18n: ectx: property (text), widget (QPushButton, add) 14665 #: kssl/kcm/cacertificates.ui:111 14666 #, kde-format 14667 msgid "Add..." 14668 msgstr "थप्नुहोस्..." 14669 14670 #: kssl/kcm/cacertificatespage.cpp:140 14671 #, fuzzy, kde-format 14672 #| msgid "Send certificate" 14673 msgid "System certificates" 14674 msgstr "प्रमाणपत्र पठाउनुहोस्" 14675 14676 #: kssl/kcm/cacertificatespage.cpp:147 14677 #, fuzzy, kde-format 14678 #| msgid "Send certificate" 14679 msgid "User-added certificates" 14680 msgstr "प्रमाणपत्र पठाउनुहोस्" 14681 14682 #: kssl/kcm/cacertificatespage.cpp:302 14683 #, fuzzy, kde-format 14684 #| msgid "Certificate" 14685 msgid "Pick Certificates" 14686 msgstr "प्रमाणपत्र" 14687 14688 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14689 #: kssl/kcm/displaycert.ui:23 14690 #, fuzzy, kde-format 14691 #| msgid "Security Information" 14692 msgid "<b>Subject Information</b>" 14693 msgstr "सुरक्षा सूचना" 14694 14695 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14696 #: kssl/kcm/displaycert.ui:39 14697 #, fuzzy, kde-format 14698 #| msgid " <b>[Cross Domain]</b>" 14699 msgid "<b>Issuer Information</b>" 14700 msgstr " <b>[क्रस डोमेन]</b>" 14701 14702 #. i18n: ectx: property (text), widget (QLabel, label) 14703 #: kssl/kcm/displaycert.ui:55 14704 #, fuzzy, kde-format 14705 #| msgid "<b>%1</b>" 14706 msgid "<b>Other</b>" 14707 msgstr "<b>%1</b>" 14708 14709 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14710 #: kssl/kcm/displaycert.ui:64 14711 #, fuzzy, kde-format 14712 #| msgid "Valid from:" 14713 msgid "Validity period" 14714 msgstr "वैद्यता सुरु मिति:" 14715 14716 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14717 #: kssl/kcm/displaycert.ui:78 14718 #, fuzzy, kde-format 14719 #| msgid "Serial number:" 14720 msgid "Serial number" 14721 msgstr "क्रम सङ्ख्या:" 14722 14723 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14724 #: kssl/kcm/displaycert.ui:92 14725 #, fuzzy, kde-format 14726 #| msgid "MD5 digest:" 14727 msgid "MD5 digest" 14728 msgstr "MD5 सङ्ग्रह:" 14729 14730 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14731 #: kssl/kcm/displaycert.ui:106 14732 #, fuzzy, kde-format 14733 #| msgid "MD5 digest:" 14734 msgid "SHA1 digest" 14735 msgstr "MD5 सङ्ग्रह:" 14736 14737 #: kssl/kcm/displaycertdialog.cpp:73 14738 #, fuzzy, kde-format 14739 #| msgid "%1 (%2)" 14740 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14741 msgid "%1 to %2" 14742 msgstr "%1 (%2)" 14743 14744 #: kssl/kcm/kcmssl.cpp:37 14745 #, fuzzy, kde-format 14746 #| msgid "Reload configuration file" 14747 msgid "SSL Configuration Module" 14748 msgstr "कन्फिगरेसन फाइल पुन: लोड गर्नुहोस्" 14749 14750 #: kssl/kcm/kcmssl.cpp:39 14751 #, kde-format 14752 msgid "Copyright 2010 Andreas Hartmetz" 14753 msgstr "" 14754 14755 #: kssl/kcm/kcmssl.cpp:40 14756 #, kde-format 14757 msgid "Andreas Hartmetz" 14758 msgstr "" 14759 14760 #: kssl/kcm/kcmssl.cpp:52 14761 #, fuzzy, kde-format 14762 #| msgid "Link" 14763 msgid "SSL Signers" 14764 msgstr "लिङ्क गर्नुहोस्" 14765 14766 #: kssl/ksslcertificate.cpp:202 14767 #, kde-format 14768 msgid "Signature Algorithm: " 14769 msgstr "हस्ताक्षर अल्गोरिदम:" 14770 14771 #: kssl/ksslcertificate.cpp:203 14772 #, kde-format 14773 msgid "Unknown" 14774 msgstr "अज्ञात" 14775 14776 #: kssl/ksslcertificate.cpp:206 14777 #, kde-format 14778 msgid "Signature Contents:" 14779 msgstr "हस्ताक्षर सामाग्रीहरू:" 14780 14781 #: kssl/ksslcertificate.cpp:341 14782 #, kde-format 14783 msgctxt "Unknown" 14784 msgid "Unknown key algorithm" 14785 msgstr "अज्ञात कुञ्जी अल्गोरिदम" 14786 14787 #: kssl/ksslcertificate.cpp:347 14788 #, kde-format 14789 msgid "Key type: RSA (%1 bit)" 14790 msgstr "कुञ्जी प्रकार: RSA (%1 बिट)" 14791 14792 #: kssl/ksslcertificate.cpp:349 14793 #, kde-format 14794 msgid "Modulus: " 14795 msgstr "मोड्युल: " 14796 14797 #: kssl/ksslcertificate.cpp:362 14798 #, kde-format 14799 msgid "Exponent: 0x" 14800 msgstr "घाताङ्क: 0x" 14801 14802 #: kssl/ksslcertificate.cpp:374 14803 #, kde-format 14804 msgid "Key type: DSA (%1 bit)" 14805 msgstr "कुञ्जी प्रकार: DSA (%1 बिट)" 14806 14807 #: kssl/ksslcertificate.cpp:376 14808 #, kde-format 14809 msgid "Prime: " 14810 msgstr "प्राथमिक: " 14811 14812 #: kssl/ksslcertificate.cpp:389 14813 #, kde-format 14814 msgid "160 bit prime factor: " 14815 msgstr "१६० बिट प्राथमिक तत्व: " 14816 14817 #: kssl/ksslcertificate.cpp:417 14818 #, kde-format 14819 msgid "Public key: " 14820 msgstr "सार्वजनिक कुञ्जी: " 14821 14822 #: kssl/ksslcertificate.cpp:1065 14823 #, kde-format 14824 msgid "The certificate is valid." 14825 msgstr "प्रमाणपत्र वैद्य छ ।" 14826 14827 #: kssl/ksslcertificate.cpp:1067 14828 #, kde-format 14829 msgid "" 14830 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14831 "Authority) certificate can not be found." 14832 msgstr "" 14833 14834 #: kssl/ksslcertificate.cpp:1069 14835 #, fuzzy, kde-format 14836 #| msgid "" 14837 #| "Certificate signing authority root files could not be found so the " 14838 #| "certificate is not verified." 14839 msgid "" 14840 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14841 "CA's (Certificate Authority) CRL can not be found." 14842 msgstr "" 14843 "प्रमाणपत्र हस्ताक्षर अधिकार रुट फाइलहरू फेला पार्न सकेन त्यसैले प्रमाणपत्र रुजूगरिएको छैन ।" 14844 14845 #: kssl/ksslcertificate.cpp:1071 14846 #, kde-format 14847 msgid "" 14848 "The decryption of the certificate's signature failed. This means it could " 14849 "not even be calculated as opposed to just not matching the expected result." 14850 msgstr "" 14851 14852 #: kssl/ksslcertificate.cpp:1073 14853 #, kde-format 14854 msgid "" 14855 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14856 "This means it could not even be calculated as opposed to just not matching " 14857 "the expected result." 14858 msgstr "" 14859 14860 #: kssl/ksslcertificate.cpp:1075 14861 #, kde-format 14862 msgid "" 14863 "The decoding of the public key of the issuer failed. This means that the " 14864 "CA's (Certificate Authority) certificate can not be used to verify the " 14865 "certificate you wanted to use." 14866 msgstr "" 14867 14868 #: kssl/ksslcertificate.cpp:1077 14869 #, fuzzy, kde-format 14870 #| msgid "" 14871 #| "Certificate signing authority root files could not be found so the " 14872 #| "certificate is not verified." 14873 msgid "" 14874 "The certificate's signature is invalid. This means that the certificate can " 14875 "not be verified." 14876 msgstr "" 14877 "प्रमाणपत्र हस्ताक्षर अधिकार रुट फाइलहरू फेला पार्न सकेन त्यसैले प्रमाणपत्र रुजूगरिएको छैन ।" 14878 14879 #: kssl/ksslcertificate.cpp:1079 14880 #, fuzzy, kde-format 14881 #| msgid "" 14882 #| "Certificate signing authority root files could not be found so the " 14883 #| "certificate is not verified." 14884 msgid "" 14885 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14886 "that the CRL can not be verified." 14887 msgstr "" 14888 "प्रमाणपत्र हस्ताक्षर अधिकार रुट फाइलहरू फेला पार्न सकेन त्यसैले प्रमाणपत्र रुजूगरिएको छैन ।" 14889 14890 #: kssl/ksslcertificate.cpp:1081 14891 #, fuzzy, kde-format 14892 #| msgid "The certificate is invalid." 14893 msgid "The certificate is not valid, yet." 14894 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14895 14896 #: kssl/ksslcertificate.cpp:1083 14897 #, fuzzy, kde-format 14898 #| msgid "The certificate is invalid." 14899 msgid "The certificate is not valid, any more." 14900 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14901 14902 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14903 #, fuzzy, kde-format 14904 #| msgid "The certificate is invalid." 14905 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14906 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14907 14908 #: kssl/ksslcertificate.cpp:1089 14909 #, kde-format 14910 msgid "The time format of the certificate's 'notBefore' field is invalid." 14911 msgstr "" 14912 14913 #: kssl/ksslcertificate.cpp:1091 14914 #, kde-format 14915 msgid "The time format of the certificate's 'notAfter' field is invalid." 14916 msgstr "" 14917 14918 #: kssl/ksslcertificate.cpp:1093 14919 #, fuzzy, kde-format 14920 #| msgid "The certificate is invalid." 14921 msgid "" 14922 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14923 "field is invalid." 14924 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14925 14926 #: kssl/ksslcertificate.cpp:1095 14927 #, fuzzy, kde-format 14928 #| msgid "The certificate is invalid." 14929 msgid "" 14930 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14931 "field is invalid." 14932 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14933 14934 #: kssl/ksslcertificate.cpp:1097 14935 #, kde-format 14936 msgid "The OpenSSL process ran out of memory." 14937 msgstr "" 14938 14939 #: kssl/ksslcertificate.cpp:1099 14940 #, kde-format 14941 msgid "" 14942 "The certificate is self-signed and not in the list of trusted certificates. " 14943 "If you want to accept this certificate, import it into the list of trusted " 14944 "certificates." 14945 msgstr "" 14946 14947 #: kssl/ksslcertificate.cpp:1102 14948 #, kde-format 14949 msgid "" 14950 "The certificate is self-signed. While the trust chain could be built up, the " 14951 "root CA's (Certificate Authority) certificate can not be found." 14952 msgstr "" 14953 14954 #: kssl/ksslcertificate.cpp:1104 14955 #, kde-format 14956 msgid "" 14957 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14958 "your trust chain is broken." 14959 msgstr "" 14960 14961 #: kssl/ksslcertificate.cpp:1106 14962 #, kde-format 14963 msgid "" 14964 "The certificate can not be verified as it is the only certificate in the " 14965 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14966 "to import it into the list of trusted certificates." 14967 msgstr "" 14968 14969 #: kssl/ksslcertificate.cpp:1108 14970 #, kde-format 14971 msgid "The certificate chain is longer than the maximum depth specified." 14972 msgstr "" 14973 14974 #: kssl/ksslcertificate.cpp:1111 14975 #, fuzzy, kde-format 14976 #| msgid "Certificate has been revoked." 14977 msgid "The certificate has been revoked." 14978 msgstr "प्रमाणपत्र रद्द भएको छ ।" 14979 14980 #: kssl/ksslcertificate.cpp:1113 14981 #, fuzzy, kde-format 14982 #| msgid "The certificate is invalid." 14983 msgid "The certificate's CA (Certificate Authority) is invalid." 14984 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 14985 14986 #: kssl/ksslcertificate.cpp:1115 14987 #, kde-format 14988 msgid "" 14989 "The length of the trust chain exceeded one of the CA's (Certificate " 14990 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14991 msgstr "" 14992 14993 #: kssl/ksslcertificate.cpp:1117 14994 #, kde-format 14995 msgid "" 14996 "The certificate has not been signed for the purpose you tried to use it for. " 14997 "This means the CA (Certificate Authority) does not allow this usage." 14998 msgstr "" 14999 15000 #: kssl/ksslcertificate.cpp:1120 15001 #, kde-format 15002 msgid "" 15003 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 15004 "to use this certificate for." 15005 msgstr "" 15006 15007 #: kssl/ksslcertificate.cpp:1123 15008 #, kde-format 15009 msgid "" 15010 "The root CA (Certificate Authority) has been marked to be rejected for the " 15011 "purpose you tried to use it for." 15012 msgstr "" 15013 15014 #: kssl/ksslcertificate.cpp:1125 15015 #, fuzzy, kde-format 15016 #| msgid "" 15017 #| "The IP address of the host %1 does not match the one the certificate was " 15018 #| "issued to." 15019 msgid "" 15020 "The certificate's CA (Certificate Authority) does not match the CA name of " 15021 "the certificate." 15022 msgstr "%1 होस्टको IP ठेगाना वितरण गरिएको एउटा प्रमाणपत्रसँग मिल्दैन ।" 15023 15024 #: kssl/ksslcertificate.cpp:1127 15025 #, fuzzy, kde-format 15026 #| msgid "" 15027 #| "The IP address of the host %1 does not match the one the certificate was " 15028 #| "issued to." 15029 msgid "" 15030 "The CA (Certificate Authority) certificate's key ID does not match the key " 15031 "ID in the 'Issuer' section of the certificate you are trying to use." 15032 msgstr "%1 होस्टको IP ठेगाना वितरण गरिएको एउटा प्रमाणपत्रसँग मिल्दैन ।" 15033 15034 #: kssl/ksslcertificate.cpp:1129 15035 #, kde-format 15036 msgid "" 15037 "The CA (Certificate Authority) certificate's key ID and name do not match " 15038 "the key ID and name in the 'Issuer' section of the certificate you are " 15039 "trying to use." 15040 msgstr "" 15041 15042 #: kssl/ksslcertificate.cpp:1131 15043 #, kde-format 15044 msgid "" 15045 "The certificate's CA (Certificate Authority) is not allowed to sign " 15046 "certificates." 15047 msgstr "" 15048 15049 #: kssl/ksslcertificate.cpp:1133 15050 #, kde-format 15051 msgid "OpenSSL could not be verified." 15052 msgstr "" 15053 15054 #: kssl/ksslcertificate.cpp:1137 15055 #, kde-format 15056 msgid "" 15057 "The signature test for this certificate failed. This could mean that the " 15058 "signature of this certificate or any in its trust path are invalid, could " 15059 "not be decoded or that the CRL (Certificate Revocation List) could not be " 15060 "verified. If you see this message, please let the author of the software you " 15061 "are using know that he or she should use the new, more specific error " 15062 "messages." 15063 msgstr "" 15064 15065 #: kssl/ksslcertificate.cpp:1139 15066 #, kde-format 15067 msgid "" 15068 "This certificate, any in its trust path or its CA's (Certificate Authority) " 15069 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 15070 "valid yet or not valid any more. If you see this message, please let the " 15071 "author of the software you are using know that he or she should use the new, " 15072 "more specific error messages." 15073 msgstr "" 15074 15075 #: kssl/ksslcertificate.cpp:1145 15076 #, kde-format 15077 msgid "" 15078 "Certificate signing authority root files could not be found so the " 15079 "certificate is not verified." 15080 msgstr "" 15081 "प्रमाणपत्र हस्ताक्षर अधिकार रुट फाइलहरू फेला पार्न सकेन त्यसैले प्रमाणपत्र रुजूगरिएको छैन ।" 15082 15083 #: kssl/ksslcertificate.cpp:1147 15084 #, kde-format 15085 msgid "SSL support was not found." 15086 msgstr "एसएसएल समर्थन फेला परेको थिएन ।" 15087 15088 #: kssl/ksslcertificate.cpp:1149 15089 #, kde-format 15090 msgid "Private key test failed." 15091 msgstr "निजी कुञ्जी परीक्षण असफल भयो ।" 15092 15093 #: kssl/ksslcertificate.cpp:1151 15094 #, kde-format 15095 msgid "The certificate has not been issued for this host." 15096 msgstr "यो होस्टका लागि प्रमाणपत्र निस्काशन गरिएको छैन ।" 15097 15098 #: kssl/ksslcertificate.cpp:1153 15099 #, kde-format 15100 msgid "This certificate is not relevant." 15101 msgstr "यो प्रमाणपत्र सान्दर्भिक छैन ।" 15102 15103 #: kssl/ksslcertificate.cpp:1158 15104 #, kde-format 15105 msgid "The certificate is invalid." 15106 msgstr "यो प्रमाणपत्र अवैद्य छ ।" 15107 15108 #: kssl/ksslutils.cpp:90 15109 #, kde-format 15110 msgid "GMT" 15111 msgstr "GMT" 15112 15113 #, fuzzy 15114 #~ msgctxt "color" 15115 #~ msgid "hot" 15116 #~ msgstr "Thl" 15117 15118 #, fuzzy 15119 #~ msgctxt "color" 15120 #~ msgid "sea" 15121 #~ msgstr "पज गर्नुहोस्" 15122 15123 #, fuzzy 15124 #~ msgctxt "@item Calendar system" 15125 #~ msgid "Gregorian (Proleptic)" 15126 #~ msgstr "जर्जियाली" 15127 15128 #, fuzzy 15129 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15130 #~ msgid "of Mes" 15131 #~ msgstr "of Meh" 15132 15133 #, fuzzy 15134 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15135 #~ msgid "of Ter" 15136 #~ msgstr "of Tir" 15137 15138 #, fuzzy 15139 #~ msgctxt "Ethiopian month 1 - ShortName" 15140 #~ msgid "Mes" 15141 #~ msgstr "हो" 15142 15143 #, fuzzy 15144 #~ msgctxt "Ethiopian month 5 - LongName" 15145 #~ msgid "Ter" 15146 #~ msgstr "मङ्गल" 15147 15148 #, fuzzy 15149 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15150 #~ msgid "Ham" 15151 #~ msgstr "पूर्वान्ह" 15152 15153 #, fuzzy 15154 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15155 #~ msgid "Arb" 15156 #~ msgstr "Arb" 15157 15158 #, fuzzy 15159 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15160 #~ msgid "Rob" 15161 #~ msgstr "Jom" 15162 15163 #, fuzzy 15164 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15165 #~ msgid "Arb" 15166 #~ msgstr "Arb" 15167 15168 #~ msgctxt "of May long" 15169 #~ msgid "of May" 15170 #~ msgstr "मेको" 15171 15172 #~ msgctxt "May long" 15173 #~ msgid "May" 15174 #~ msgstr "मे" 15175 15176 #~ msgid "R. Thaani" 15177 #~ msgstr "आर. थानी" 15178 15179 #~ msgid "J. Thaani" 15180 #~ msgstr "जे. थानी" 15181 15182 #~ msgid "Hijjah" 15183 #~ msgstr "हिज्जा" 15184 15185 #~ msgctxt "of Tir long" 15186 #~ msgid "of Tir" 15187 #~ msgstr "of Tir" 15188 15189 #~ msgctxt "of Dei long" 15190 #~ msgid "of Dei" 15191 #~ msgstr "of Dei" 15192 15193 #~ msgctxt "Tir long" 15194 #~ msgid "Tir" 15195 #~ msgstr "Tir" 15196 15197 #~ msgctxt "Dei long" 15198 #~ msgid "Dei" 15199 #~ msgstr "Dei" 15200 15201 #~ msgctxt "Shanbe short" 15202 #~ msgid "shn" 15203 #~ msgstr "shn"