Warning, /frameworks/kdelibs4support/po/ms/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # kdelibs4 Bahasa Melayu (Malay) (ms) 0002 # Hasbullah bin Pit <sebol@ikhlas.com>, 2003. 0003 # Muhammad Najmi Ahmad Zabidi <md_najmi@yahoo.com>, 2003. 0004 # Mohd Nasir bin Che Embee <chadtce@linuxmail.org>, 2003. 0005 # Muhammad Najmi bin Ahmad Zabidi <najmi.zabidi@gmail.com>, 2006. 0006 # Sharuzzaman Ahmat Raslan <sharuzzaman@myrealbox.com>, 2006, 2007, 2008, 2009. 0007 # Copyright (C) 2008, 2009 K Desktop Environment 0008 msgid "" 0009 msgstr "" 0010 "Project-Id-Version: kdelibs4\n" 0011 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0012 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0013 "PO-Revision-Date: 2009-11-12 23:50+0800\n" 0014 "Last-Translator: Sharuzzaman Ahmat Raslan <sharuzzaman@myrealbox.com>\n" 0015 "Language-Team: Malay <kedidiemas@yahoogroups.com>\n" 0016 "Language: ms\n" 0017 "MIME-Version: 1.0\n" 0018 "Content-Type: text/plain; charset=UTF-8\n" 0019 "Content-Transfer-Encoding: 8bit\n" 0020 "X-Generator: KBabel 1.11.4\n" 0021 "Plural-Forms: nplurals=2; plural=1;\n" 0022 0023 #, kde-format 0024 msgctxt "NAME OF TRANSLATORS" 0025 msgid "Your names" 0026 msgstr "Muhammad Najmi Ahmad Zabidi, Sharuzzaman Ahmat Raslan" 0027 0028 #, kde-format 0029 msgctxt "EMAIL OF TRANSLATORS" 0030 msgid "Your emails" 0031 msgstr "md_najmi@yahoo.com, sharuzzaman@myrealbox.com" 0032 0033 #, kde-format 0034 msgctxt "color" 0035 msgid "AliceBlue" 0036 msgstr "Biru Alice" 0037 0038 #, kde-format 0039 msgctxt "color" 0040 msgid "AntiqueWhite" 0041 msgstr "Putih Antik" 0042 0043 #, kde-format 0044 msgctxt "color" 0045 msgid "AntiqueWhite1" 0046 msgstr "Putih Antik1" 0047 0048 #, kde-format 0049 msgctxt "color" 0050 msgid "AntiqueWhite2" 0051 msgstr "Putih Antik 2" 0052 0053 #, kde-format 0054 msgctxt "color" 0055 msgid "AntiqueWhite3" 0056 msgstr "Putih Antik 3" 0057 0058 #, kde-format 0059 msgctxt "color" 0060 msgid "AntiqueWhite4" 0061 msgstr "Putih Antik 4" 0062 0063 #, kde-format 0064 msgctxt "color" 0065 msgid "BlanchedAlmond" 0066 msgstr "Badam Celur" 0067 0068 #, kde-format 0069 msgctxt "color" 0070 msgid "BlueViolet" 0071 msgstr "Biru Violet" 0072 0073 #, kde-format 0074 msgctxt "color" 0075 msgid "CadetBlue" 0076 msgstr "Biru Kadet" 0077 0078 #, kde-format 0079 msgctxt "color" 0080 msgid "CadetBlue1" 0081 msgstr "Biru Kadet 1" 0082 0083 #, kde-format 0084 msgctxt "color" 0085 msgid "CadetBlue2" 0086 msgstr "Biru Kadet 2" 0087 0088 #, kde-format 0089 msgctxt "color" 0090 msgid "CadetBlue3" 0091 msgstr "Biru Kadet 3" 0092 0093 #, kde-format 0094 msgctxt "color" 0095 msgid "CadetBlue4" 0096 msgstr "Biru Kadet 4" 0097 0098 #, kde-format 0099 msgctxt "color" 0100 msgid "CornflowerBlue" 0101 msgstr "Biru Tepung Jagung" 0102 0103 #, kde-format 0104 msgctxt "color" 0105 msgid "DarkBlue" 0106 msgstr "Biru Gelap" 0107 0108 #, kde-format 0109 msgctxt "color" 0110 msgid "DarkCyan" 0111 msgstr "Cyan Gelap" 0112 0113 #, kde-format 0114 msgctxt "color" 0115 msgid "DarkGoldenrod" 0116 msgstr "Rod Emas Gelap" 0117 0118 #, kde-format 0119 msgctxt "color" 0120 msgid "DarkGoldenrod1" 0121 msgstr "Rod Emas Gelap 1" 0122 0123 #, kde-format 0124 msgctxt "color" 0125 msgid "DarkGoldenrod2" 0126 msgstr "Rod Emas Gelap 2" 0127 0128 #, kde-format 0129 msgctxt "color" 0130 msgid "DarkGoldenrod3" 0131 msgstr "Rod Emas Gelap 3" 0132 0133 #, kde-format 0134 msgctxt "color" 0135 msgid "DarkGoldenrod4" 0136 msgstr "Rod Emas Gelap 4" 0137 0138 #, kde-format 0139 msgctxt "color" 0140 msgid "DarkGray" 0141 msgstr "Kelabu Tua" 0142 0143 #, kde-format 0144 msgctxt "color" 0145 msgid "DarkGreen" 0146 msgstr "Hijau Gelap" 0147 0148 #, kde-format 0149 msgctxt "color" 0150 msgid "DarkGrey" 0151 msgstr "Kelabu Tua" 0152 0153 #, kde-format 0154 msgctxt "color" 0155 msgid "DarkKhaki" 0156 msgstr "Khaki Tua" 0157 0158 #, fuzzy, kde-format 0159 #| msgctxt "color" 0160 #| msgid "DarkSeaGreen" 0161 msgctxt "color" 0162 msgid "DarkMagenta" 0163 msgstr "Hijau Laut Tua" 0164 0165 #, fuzzy, kde-format 0166 #| msgctxt "color" 0167 #| msgid "DarkOliveGreen1" 0168 msgctxt "color" 0169 msgid "DarkOliveGreen" 0170 msgstr "Hijau Tua Buah Zaitun1" 0171 0172 #, kde-format 0173 msgctxt "color" 0174 msgid "DarkOliveGreen1" 0175 msgstr "Hijau Tua Buah Zaitun1" 0176 0177 #, kde-format 0178 msgctxt "color" 0179 msgid "DarkOliveGreen2" 0180 msgstr "Hijau Tua Buah Zaitun 2" 0181 0182 #, fuzzy, kde-format 0183 #| msgctxt "color" 0184 #| msgid "DarkOliveGreen1" 0185 msgctxt "color" 0186 msgid "DarkOliveGreen3" 0187 msgstr "Hijau Tua Buah Zaitun1" 0188 0189 #, fuzzy, kde-format 0190 #| msgctxt "color" 0191 #| msgid "DarkOliveGreen1" 0192 msgctxt "color" 0193 msgid "DarkOliveGreen4" 0194 msgstr "Hijau Tua Buah Zaitun1" 0195 0196 #, fuzzy, kde-format 0197 #| msgctxt "color" 0198 #| msgid "DarkGray" 0199 msgctxt "color" 0200 msgid "DarkOrange" 0201 msgstr "Kelabu Tua" 0202 0203 #, fuzzy, kde-format 0204 #| msgctxt "color" 0205 #| msgid "DarkGray" 0206 msgctxt "color" 0207 msgid "DarkOrange1" 0208 msgstr "Kelabu Tua" 0209 0210 #, fuzzy, kde-format 0211 #| msgctxt "color" 0212 #| msgid "DarkGray" 0213 msgctxt "color" 0214 msgid "DarkOrange2" 0215 msgstr "Kelabu Tua" 0216 0217 #, fuzzy, kde-format 0218 #| msgctxt "color" 0219 #| msgid "DarkGray" 0220 msgctxt "color" 0221 msgid "DarkOrange3" 0222 msgstr "Kelabu Tua" 0223 0224 #, fuzzy, kde-format 0225 #| msgctxt "color" 0226 #| msgid "DarkGray" 0227 msgctxt "color" 0228 msgid "DarkOrange4" 0229 msgstr "Kelabu Tua" 0230 0231 #, fuzzy, kde-format 0232 #| msgctxt "color" 0233 #| msgid "DarkKhaki" 0234 msgctxt "color" 0235 msgid "DarkOrchid" 0236 msgstr "Khaki Tua" 0237 0238 #, fuzzy, kde-format 0239 #| msgctxt "color" 0240 #| msgid "orchid1" 0241 msgctxt "color" 0242 msgid "DarkOrchid1" 0243 msgstr "orkid1" 0244 0245 #, fuzzy, kde-format 0246 #| msgctxt "color" 0247 #| msgid "orchid2" 0248 msgctxt "color" 0249 msgid "DarkOrchid2" 0250 msgstr "orkid2" 0251 0252 #, fuzzy, kde-format 0253 #| msgctxt "color" 0254 #| msgid "orchid3" 0255 msgctxt "color" 0256 msgid "DarkOrchid3" 0257 msgstr "orkid3" 0258 0259 #, fuzzy, kde-format 0260 #| msgctxt "color" 0261 #| msgid "DarkKhaki" 0262 msgctxt "color" 0263 msgid "DarkOrchid4" 0264 msgstr "Khaki Tua" 0265 0266 #, fuzzy, kde-format 0267 #| msgctxt "color" 0268 #| msgid "DarkGrey" 0269 msgctxt "color" 0270 msgid "DarkRed" 0271 msgstr "Kelabu Tua" 0272 0273 #, kde-format 0274 msgctxt "color" 0275 msgid "DarkSalmon" 0276 msgstr "Salmon Tua" 0277 0278 #, kde-format 0279 msgctxt "color" 0280 msgid "DarkSeaGreen" 0281 msgstr "Hijau Laut Tua" 0282 0283 #, kde-format 0284 msgctxt "color" 0285 msgid "DarkSeaGreen1" 0286 msgstr "Hijau Laut Tua 1" 0287 0288 #, kde-format 0289 msgctxt "color" 0290 msgid "DarkSeaGreen2" 0291 msgstr "Hijau Laut Tua 2" 0292 0293 #, kde-format 0294 msgctxt "color" 0295 msgid "DarkSeaGreen3" 0296 msgstr "Hijau Laut Tua 3" 0297 0298 #, kde-format 0299 msgctxt "color" 0300 msgid "DarkSeaGreen4" 0301 msgstr "Hijau Laut Tua 4" 0302 0303 #, fuzzy, kde-format 0304 #| msgctxt "color" 0305 #| msgid "SlateBlue1" 0306 msgctxt "color" 0307 msgid "DarkSlateBlue" 0308 msgstr "Biru Loh 1" 0309 0310 #, fuzzy, kde-format 0311 #| msgctxt "color" 0312 #| msgid "DarkSlateGray1" 0313 msgctxt "color" 0314 msgid "DarkSlateGray" 0315 msgstr "Kelabu Loh Tua 1" 0316 0317 #, kde-format 0318 msgctxt "color" 0319 msgid "DarkSlateGray1" 0320 msgstr "Kelabu Loh Tua 1" 0321 0322 #, kde-format 0323 msgctxt "color" 0324 msgid "DarkSlateGray2" 0325 msgstr "Kelabu Loh Tua 2" 0326 0327 #, kde-format 0328 msgctxt "color" 0329 msgid "DarkSlateGray3" 0330 msgstr "Kelabu Loh Tua 3" 0331 0332 #, fuzzy, kde-format 0333 #| msgctxt "color" 0334 #| msgid "DarkSlateGray1" 0335 msgctxt "color" 0336 msgid "DarkSlateGray4" 0337 msgstr "Kelabu Loh Tua 1" 0338 0339 #, fuzzy, kde-format 0340 #| msgctxt "color" 0341 #| msgid "DarkSlateGray1" 0342 msgctxt "color" 0343 msgid "DarkSlateGrey" 0344 msgstr "Kelabu Loh Tua 1" 0345 0346 #, fuzzy, kde-format 0347 #| msgctxt "color" 0348 #| msgid "PaleTurquoise" 0349 msgctxt "color" 0350 msgid "DarkTurquoise" 0351 msgstr "Firus Pucat " 0352 0353 #, fuzzy, kde-format 0354 #| msgctxt "color" 0355 #| msgid "violet" 0356 msgctxt "color" 0357 msgid "DarkViolet" 0358 msgstr "violet" 0359 0360 #, fuzzy, kde-format 0361 #| msgctxt "color" 0362 #| msgid "pink" 0363 msgctxt "color" 0364 msgid "DeepPink" 0365 msgstr "merah jambu" 0366 0367 #, fuzzy, kde-format 0368 #| msgctxt "color" 0369 #| msgid "pink1" 0370 msgctxt "color" 0371 msgid "DeepPink1" 0372 msgstr "merah jambu1" 0373 0374 #, fuzzy, kde-format 0375 #| msgctxt "color" 0376 #| msgid "pink2" 0377 msgctxt "color" 0378 msgid "DeepPink2" 0379 msgstr "merah jambu2" 0380 0381 #, fuzzy, kde-format 0382 #| msgctxt "color" 0383 #| msgid "pink3" 0384 msgctxt "color" 0385 msgid "DeepPink3" 0386 msgstr "merah jambu3" 0387 0388 #, fuzzy, kde-format 0389 #| msgctxt "color" 0390 #| msgid "pink" 0391 msgctxt "color" 0392 msgid "DeepPink4" 0393 msgstr "merah jambu" 0394 0395 #, fuzzy, kde-format 0396 #| msgctxt "color" 0397 #| msgid "SkyBlue" 0398 msgctxt "color" 0399 msgid "DeepSkyBlue" 0400 msgstr "Biru Langit" 0401 0402 #, fuzzy, kde-format 0403 #| msgctxt "color" 0404 #| msgid "SkyBlue1" 0405 msgctxt "color" 0406 msgid "DeepSkyBlue1" 0407 msgstr "Biru Langit1" 0408 0409 #, fuzzy, kde-format 0410 #| msgctxt "color" 0411 #| msgid "SkyBlue2" 0412 msgctxt "color" 0413 msgid "DeepSkyBlue2" 0414 msgstr "Biru Langit2" 0415 0416 #, fuzzy, kde-format 0417 #| msgctxt "color" 0418 #| msgid "SkyBlue3" 0419 msgctxt "color" 0420 msgid "DeepSkyBlue3" 0421 msgstr "Biru Langit3" 0422 0423 #, fuzzy, kde-format 0424 #| msgctxt "color" 0425 #| msgid "SkyBlue" 0426 msgctxt "color" 0427 msgid "DeepSkyBlue4" 0428 msgstr "Biru Langit" 0429 0430 #, kde-format 0431 msgctxt "color" 0432 msgid "DimGray" 0433 msgstr "Kelabu Suram" 0434 0435 #, kde-format 0436 msgctxt "color" 0437 msgid "DimGrey" 0438 msgstr "Kelabu Suram " 0439 0440 #, fuzzy, kde-format 0441 #| msgctxt "color" 0442 #| msgid "PowderBlue" 0443 msgctxt "color" 0444 msgid "DodgerBlue" 0445 msgstr "Biru Tepung" 0446 0447 #, fuzzy, kde-format 0448 #| msgctxt "color" 0449 #| msgid "PowderBlue" 0450 msgctxt "color" 0451 msgid "DodgerBlue1" 0452 msgstr "Biru Tepung" 0453 0454 #, fuzzy, kde-format 0455 #| msgctxt "color" 0456 #| msgid "PowderBlue" 0457 msgctxt "color" 0458 msgid "DodgerBlue2" 0459 msgstr "Biru Tepung" 0460 0461 #, fuzzy, kde-format 0462 #| msgctxt "color" 0463 #| msgid "PowderBlue" 0464 msgctxt "color" 0465 msgid "DodgerBlue3" 0466 msgstr "Biru Tepung" 0467 0468 #, fuzzy, kde-format 0469 #| msgctxt "color" 0470 #| msgid "PowderBlue" 0471 msgctxt "color" 0472 msgid "DodgerBlue4" 0473 msgstr "Biru Tepung" 0474 0475 #, kde-format 0476 msgctxt "color" 0477 msgid "FloralWhite" 0478 msgstr "Putih Bunga" 0479 0480 #, fuzzy, kde-format 0481 #| msgctxt "color" 0482 #| msgid "DarkSeaGreen" 0483 msgctxt "color" 0484 msgid "ForestGreen" 0485 msgstr "Hijau Laut Tua" 0486 0487 #, kde-format 0488 msgctxt "color" 0489 msgid "GhostWhite" 0490 msgstr "Putih Hantu" 0491 0492 #, kde-format 0493 msgctxt "color" 0494 msgid "GreenYellow" 0495 msgstr "" 0496 0497 #, kde-format 0498 msgctxt "color" 0499 msgid "HotPink" 0500 msgstr "Merah Jambu Terang" 0501 0502 #, kde-format 0503 msgctxt "color" 0504 msgid "HotPink1" 0505 msgstr "Merah Jambu Terang 1" 0506 0507 #, kde-format 0508 msgctxt "color" 0509 msgid "HotPink2" 0510 msgstr "Merah Jambu Terang 2" 0511 0512 #, fuzzy, kde-format 0513 #| msgctxt "color" 0514 #| msgid "HotPink" 0515 msgctxt "color" 0516 msgid "HotPink3" 0517 msgstr "Merah Jambu Terang" 0518 0519 #, fuzzy, kde-format 0520 #| msgctxt "color" 0521 #| msgid "HotPink" 0522 msgctxt "color" 0523 msgid "HotPink4" 0524 msgstr "Merah Jambu Terang" 0525 0526 #, fuzzy, kde-format 0527 #| msgctxt "color" 0528 #| msgid "IndianRed1" 0529 msgctxt "color" 0530 msgid "IndianRed" 0531 msgstr "Merah India 1" 0532 0533 #, kde-format 0534 msgctxt "color" 0535 msgid "IndianRed1" 0536 msgstr "Merah India 1" 0537 0538 #, fuzzy, kde-format 0539 #| msgctxt "color" 0540 #| msgid "IndianRed1" 0541 msgctxt "color" 0542 msgid "IndianRed2" 0543 msgstr "Merah India 1" 0544 0545 #, fuzzy, kde-format 0546 #| msgctxt "color" 0547 #| msgid "IndianRed1" 0548 msgctxt "color" 0549 msgid "IndianRed3" 0550 msgstr "Merah India 1" 0551 0552 #, fuzzy, kde-format 0553 #| msgctxt "color" 0554 #| msgid "IndianRed1" 0555 msgctxt "color" 0556 msgid "IndianRed4" 0557 msgstr "Merah India 1" 0558 0559 #, kde-format 0560 msgctxt "color" 0561 msgid "LavenderBlush" 0562 msgstr "Merah Lavender" 0563 0564 #, kde-format 0565 msgctxt "color" 0566 msgid "LavenderBlush1" 0567 msgstr "Merah Lavender 1" 0568 0569 #, kde-format 0570 msgctxt "color" 0571 msgid "LavenderBlush2" 0572 msgstr "Merah Lavender 2" 0573 0574 #, kde-format 0575 msgctxt "color" 0576 msgid "LavenderBlush3" 0577 msgstr "Merah Lavender 3" 0578 0579 #, kde-format 0580 msgctxt "color" 0581 msgid "LavenderBlush4" 0582 msgstr "Merah Lavender 4" 0583 0584 #, fuzzy, kde-format 0585 #| msgctxt "color" 0586 #| msgid "PaleGreen" 0587 msgctxt "color" 0588 msgid "LawnGreen" 0589 msgstr "Hijau Pucat" 0590 0591 #, kde-format 0592 msgctxt "color" 0593 msgid "LemonChiffon" 0594 msgstr "Sifon Lemon" 0595 0596 #, kde-format 0597 msgctxt "color" 0598 msgid "LemonChiffon1" 0599 msgstr "Sifon Lemon 1" 0600 0601 #, kde-format 0602 msgctxt "color" 0603 msgid "LemonChiffon2" 0604 msgstr "Sifon Lemon 2" 0605 0606 #, kde-format 0607 msgctxt "color" 0608 msgid "LemonChiffon3" 0609 msgstr "Sifon Lemon 3" 0610 0611 #, kde-format 0612 msgctxt "color" 0613 msgid "LemonChiffon4" 0614 msgstr "Sifon Lemon 4" 0615 0616 #, kde-format 0617 msgctxt "color" 0618 msgid "LightBlue" 0619 msgstr "Biru Muda " 0620 0621 #, kde-format 0622 msgctxt "color" 0623 msgid "LightBlue1" 0624 msgstr "Biru Muda 1" 0625 0626 #, kde-format 0627 msgctxt "color" 0628 msgid "LightBlue2" 0629 msgstr "Biru Muda 2" 0630 0631 #, kde-format 0632 msgctxt "color" 0633 msgid "LightBlue3" 0634 msgstr "Biru Muda 3" 0635 0636 #, kde-format 0637 msgctxt "color" 0638 msgid "LightBlue4" 0639 msgstr "Biru Muda 4" 0640 0641 #, kde-format 0642 msgctxt "color" 0643 msgid "LightCoral" 0644 msgstr "Merah Muda Batu Karang" 0645 0646 #, kde-format 0647 msgctxt "color" 0648 msgid "LightCyan" 0649 msgstr "Sian Muda" 0650 0651 #, kde-format 0652 msgctxt "color" 0653 msgid "LightCyan1" 0654 msgstr "Sian Muda 1" 0655 0656 #, kde-format 0657 msgctxt "color" 0658 msgid "LightCyan2" 0659 msgstr "Sian Muda 2" 0660 0661 #, kde-format 0662 msgctxt "color" 0663 msgid "LightCyan3" 0664 msgstr "Sian Muda 3" 0665 0666 #, kde-format 0667 msgctxt "color" 0668 msgid "LightCyan4" 0669 msgstr "Sian Muda 4" 0670 0671 #, kde-format 0672 msgctxt "color" 0673 msgid "LightGoldenrod" 0674 msgstr "Rod Emas Muda" 0675 0676 #, kde-format 0677 msgctxt "color" 0678 msgid "LightGoldenrod1" 0679 msgstr "Rod Emas Muda 1" 0680 0681 #, kde-format 0682 msgctxt "color" 0683 msgid "LightGoldenrod2" 0684 msgstr "Rod Emas Muda 2" 0685 0686 #, kde-format 0687 msgctxt "color" 0688 msgid "LightGoldenrod3" 0689 msgstr "Rod Emas Muda 3" 0690 0691 #, fuzzy, kde-format 0692 #| msgctxt "color" 0693 #| msgid "LightGoldenrod" 0694 msgctxt "color" 0695 msgid "LightGoldenrod4" 0696 msgstr "Rod Emas Muda" 0697 0698 #, kde-format 0699 msgctxt "color" 0700 msgid "LightGoldenrodYellow" 0701 msgstr "Kuning Rod Emas Muda" 0702 0703 #, kde-format 0704 msgctxt "color" 0705 msgid "LightGray" 0706 msgstr "Kelabu Muda" 0707 0708 #, kde-format 0709 msgctxt "color" 0710 msgid "LightGreen" 0711 msgstr "Hijau Muda" 0712 0713 #, kde-format 0714 msgctxt "color" 0715 msgid "LightGrey" 0716 msgstr "Kelabu Muda" 0717 0718 #, kde-format 0719 msgctxt "color" 0720 msgid "LightPink" 0721 msgstr "Merah Jambu Muda " 0722 0723 #, kde-format 0724 msgctxt "color" 0725 msgid "LightPink1" 0726 msgstr "Merah Jambu Muda 1" 0727 0728 #, kde-format 0729 msgctxt "color" 0730 msgid "LightPink2" 0731 msgstr "Merah Jambu Muda 2" 0732 0733 #, kde-format 0734 msgctxt "color" 0735 msgid "LightPink3" 0736 msgstr "Merah Jambu Muda 3" 0737 0738 #, fuzzy, kde-format 0739 #| msgctxt "color" 0740 #| msgid "LightPink" 0741 msgctxt "color" 0742 msgid "LightPink4" 0743 msgstr "Merah Jambu Muda " 0744 0745 #, kde-format 0746 msgctxt "color" 0747 msgid "LightSalmon" 0748 msgstr "Salmon Muda " 0749 0750 #, kde-format 0751 msgctxt "color" 0752 msgid "LightSalmon1" 0753 msgstr "Salmon Muda 1" 0754 0755 #, kde-format 0756 msgctxt "color" 0757 msgid "LightSalmon2" 0758 msgstr "Salmon Muda 2" 0759 0760 #, fuzzy, kde-format 0761 #| msgctxt "color" 0762 #| msgid "LightSalmon" 0763 msgctxt "color" 0764 msgid "LightSalmon3" 0765 msgstr "Salmon Muda " 0766 0767 #, fuzzy, kde-format 0768 #| msgctxt "color" 0769 #| msgid "LightSalmon" 0770 msgctxt "color" 0771 msgid "LightSalmon4" 0772 msgstr "Salmon Muda " 0773 0774 #, fuzzy, kde-format 0775 #| msgctxt "color" 0776 #| msgid "LightGreen" 0777 msgctxt "color" 0778 msgid "LightSeaGreen" 0779 msgstr "Hijau Muda" 0780 0781 #, kde-format 0782 msgctxt "color" 0783 msgid "LightSkyBlue" 0784 msgstr "Biru Langit Muda" 0785 0786 #, kde-format 0787 msgctxt "color" 0788 msgid "LightSkyBlue1" 0789 msgstr "Biru Langit Muda 1" 0790 0791 #, kde-format 0792 msgctxt "color" 0793 msgid "LightSkyBlue2" 0794 msgstr "Biru Langit Muda 2" 0795 0796 #, kde-format 0797 msgctxt "color" 0798 msgid "LightSkyBlue3" 0799 msgstr "Biru Langit Muda 3" 0800 0801 #, fuzzy, kde-format 0802 #| msgctxt "color" 0803 #| msgid "LightSkyBlue" 0804 msgctxt "color" 0805 msgid "LightSkyBlue4" 0806 msgstr "Biru Langit Muda" 0807 0808 #, kde-format 0809 msgctxt "color" 0810 msgid "LightSlateBlue" 0811 msgstr "Biru Loh Muda" 0812 0813 #, kde-format 0814 msgctxt "color" 0815 msgid "LightSlateGray" 0816 msgstr "Kelabu Loh Muda" 0817 0818 #, kde-format 0819 msgctxt "color" 0820 msgid "LightSlateGrey" 0821 msgstr "Kelabu Loh Muda" 0822 0823 #, kde-format 0824 msgctxt "color" 0825 msgid "LightSteelBlue" 0826 msgstr "Biru Keluli Muda " 0827 0828 #, kde-format 0829 msgctxt "color" 0830 msgid "LightSteelBlue1" 0831 msgstr "Biru Keluli Muda 1" 0832 0833 #, kde-format 0834 msgctxt "color" 0835 msgid "LightSteelBlue2" 0836 msgstr "Biru Keluli Muda 2" 0837 0838 #, kde-format 0839 msgctxt "color" 0840 msgid "LightSteelBlue3" 0841 msgstr "Biru Keluli Muda 3" 0842 0843 #, kde-format 0844 msgctxt "color" 0845 msgid "LightSteelBlue4" 0846 msgstr "Biru Keluli Muda 4" 0847 0848 #, kde-format 0849 msgctxt "color" 0850 msgid "LightYellow" 0851 msgstr "Kuning Muda" 0852 0853 #, kde-format 0854 msgctxt "color" 0855 msgid "LightYellow1" 0856 msgstr "Kuning Muda 1" 0857 0858 #, kde-format 0859 msgctxt "color" 0860 msgid "LightYellow2" 0861 msgstr "Kuning Muda 2" 0862 0863 #, kde-format 0864 msgctxt "color" 0865 msgid "LightYellow3" 0866 msgstr "Kuning Muda 3" 0867 0868 #, kde-format 0869 msgctxt "color" 0870 msgid "LightYellow4" 0871 msgstr "Kuning Muda 4" 0872 0873 #, fuzzy, kde-format 0874 #| msgctxt "color" 0875 #| msgid "LightGreen" 0876 msgctxt "color" 0877 msgid "LimeGreen" 0878 msgstr "Hijau Muda" 0879 0880 #, kde-format 0881 msgctxt "color" 0882 msgid "MediumAquamarine" 0883 msgstr "Akuamarin Sederhana" 0884 0885 #, fuzzy, kde-format 0886 #| msgctxt "color" 0887 #| msgid "MediumSlateBlue" 0888 msgctxt "color" 0889 msgid "MediumBlue" 0890 msgstr "Biru Loh Sederhana" 0891 0892 #, fuzzy, kde-format 0893 #| msgctxt "color" 0894 #| msgid "MediumOrchid1" 0895 msgctxt "color" 0896 msgid "MediumOrchid" 0897 msgstr "Orkid Sederhana 1" 0898 0899 #, kde-format 0900 msgctxt "color" 0901 msgid "MediumOrchid1" 0902 msgstr "Orkid Sederhana 1" 0903 0904 #, fuzzy, kde-format 0905 #| msgctxt "color" 0906 #| msgid "MediumOrchid1" 0907 msgctxt "color" 0908 msgid "MediumOrchid2" 0909 msgstr "Orkid Sederhana 1" 0910 0911 #, fuzzy, kde-format 0912 #| msgctxt "color" 0913 #| msgid "MediumOrchid1" 0914 msgctxt "color" 0915 msgid "MediumOrchid3" 0916 msgstr "Orkid Sederhana 1" 0917 0918 #, fuzzy, kde-format 0919 #| msgctxt "color" 0920 #| msgid "MediumOrchid1" 0921 msgctxt "color" 0922 msgid "MediumOrchid4" 0923 msgstr "Orkid Sederhana 1" 0924 0925 #, kde-format 0926 msgctxt "color" 0927 msgid "MediumPurple" 0928 msgstr "Ungu Sederhana" 0929 0930 #, kde-format 0931 msgctxt "color" 0932 msgid "MediumPurple1" 0933 msgstr "Ungu Sederhana 1" 0934 0935 #, kde-format 0936 msgctxt "color" 0937 msgid "MediumPurple2" 0938 msgstr "Ungu Sederhana 2" 0939 0940 #, kde-format 0941 msgctxt "color" 0942 msgid "MediumPurple3" 0943 msgstr "Ungu Sederhana 3" 0944 0945 #, fuzzy, kde-format 0946 #| msgctxt "color" 0947 #| msgid "MediumPurple" 0948 msgctxt "color" 0949 msgid "MediumPurple4" 0950 msgstr "Ungu Sederhana" 0951 0952 #, fuzzy, kde-format 0953 #| msgctxt "color" 0954 #| msgid "MediumSlateBlue" 0955 msgctxt "color" 0956 msgid "MediumSeaGreen" 0957 msgstr "Biru Loh Sederhana" 0958 0959 #, kde-format 0960 msgctxt "color" 0961 msgid "MediumSlateBlue" 0962 msgstr "Biru Loh Sederhana" 0963 0964 #, fuzzy, kde-format 0965 #| msgctxt "color" 0966 #| msgid "MediumAquamarine" 0967 msgctxt "color" 0968 msgid "MediumSpringGreen" 0969 msgstr "Akuamarin Sederhana" 0970 0971 #, fuzzy, kde-format 0972 #| msgctxt "color" 0973 #| msgid "PaleTurquoise" 0974 msgctxt "color" 0975 msgid "MediumTurquoise" 0976 msgstr "Firus Pucat " 0977 0978 #, fuzzy, kde-format 0979 #| msgctxt "color" 0980 #| msgid "PaleVioletRed" 0981 msgctxt "color" 0982 msgid "MediumVioletRed" 0983 msgstr "Merah Violet Pucat" 0984 0985 #, fuzzy, kde-format 0986 #| msgctxt "color" 0987 #| msgid "LightBlue" 0988 msgctxt "color" 0989 msgid "MidnightBlue" 0990 msgstr "Biru Muda " 0991 0992 #, kde-format 0993 msgctxt "color" 0994 msgid "MintCream" 0995 msgstr "Krim Pudina" 0996 0997 #, kde-format 0998 msgctxt "color" 0999 msgid "MistyRose" 1000 msgstr "Ros Samar" 1001 1002 #, kde-format 1003 msgctxt "color" 1004 msgid "MistyRose1" 1005 msgstr "Ros Samar 1" 1006 1007 #, kde-format 1008 msgctxt "color" 1009 msgid "MistyRose2" 1010 msgstr "Ros Samar 2" 1011 1012 #, kde-format 1013 msgctxt "color" 1014 msgid "MistyRose3" 1015 msgstr "Ros Samar 3" 1016 1017 #, kde-format 1018 msgctxt "color" 1019 msgid "MistyRose4" 1020 msgstr "Ros Samar 4" 1021 1022 #, kde-format 1023 msgctxt "color" 1024 msgid "NavajoWhite" 1025 msgstr "Putih Navajo" 1026 1027 #, kde-format 1028 msgctxt "color" 1029 msgid "NavajoWhite1" 1030 msgstr "Putih Navajo 1" 1031 1032 #, kde-format 1033 msgctxt "color" 1034 msgid "NavajoWhite2" 1035 msgstr "Putih Navajo 2" 1036 1037 #, kde-format 1038 msgctxt "color" 1039 msgid "NavajoWhite3" 1040 msgstr "Putih Navajo 3" 1041 1042 #, fuzzy, kde-format 1043 #| msgctxt "color" 1044 #| msgid "NavajoWhite" 1045 msgctxt "color" 1046 msgid "NavajoWhite4" 1047 msgstr "Putih Navajo" 1048 1049 #, fuzzy, kde-format 1050 #| msgctxt "color" 1051 #| msgid "SkyBlue" 1052 msgctxt "color" 1053 msgid "NavyBlue" 1054 msgstr "Biru Langit" 1055 1056 #, kde-format 1057 msgctxt "color" 1058 msgid "OldLace" 1059 msgstr "Renda Lama" 1060 1061 #, kde-format 1062 msgctxt "color" 1063 msgid "OliveDrab" 1064 msgstr "" 1065 1066 #, kde-format 1067 msgctxt "color" 1068 msgid "OliveDrab1" 1069 msgstr "" 1070 1071 #, kde-format 1072 msgctxt "color" 1073 msgid "OliveDrab2" 1074 msgstr "" 1075 1076 #, kde-format 1077 msgctxt "color" 1078 msgid "OliveDrab3" 1079 msgstr "" 1080 1081 #, kde-format 1082 msgctxt "color" 1083 msgid "OliveDrab4" 1084 msgstr "" 1085 1086 #, kde-format 1087 msgctxt "color" 1088 msgid "OrangeRed" 1089 msgstr "" 1090 1091 #, fuzzy, kde-format 1092 #| msgctxt "color" 1093 #| msgid "IndianRed1" 1094 msgctxt "color" 1095 msgid "OrangeRed1" 1096 msgstr "Merah India 1" 1097 1098 #, kde-format 1099 msgctxt "color" 1100 msgid "OrangeRed2" 1101 msgstr "" 1102 1103 #, kde-format 1104 msgctxt "color" 1105 msgid "OrangeRed3" 1106 msgstr "" 1107 1108 #, kde-format 1109 msgctxt "color" 1110 msgid "OrangeRed4" 1111 msgstr "" 1112 1113 #, kde-format 1114 msgctxt "color" 1115 msgid "PaleGoldenrod" 1116 msgstr "Rod Emas Pucat " 1117 1118 #, kde-format 1119 msgctxt "color" 1120 msgid "PaleGreen" 1121 msgstr "Hijau Pucat" 1122 1123 #, kde-format 1124 msgctxt "color" 1125 msgid "PaleGreen1" 1126 msgstr "Hijau Pucat 1" 1127 1128 #, kde-format 1129 msgctxt "color" 1130 msgid "PaleGreen2" 1131 msgstr "Hijau Pucat 2" 1132 1133 #, kde-format 1134 msgctxt "color" 1135 msgid "PaleGreen3" 1136 msgstr "Hijau Pucat 3" 1137 1138 #, fuzzy, kde-format 1139 #| msgctxt "color" 1140 #| msgid "PaleGreen" 1141 msgctxt "color" 1142 msgid "PaleGreen4" 1143 msgstr "Hijau Pucat" 1144 1145 #, kde-format 1146 msgctxt "color" 1147 msgid "PaleTurquoise" 1148 msgstr "Firus Pucat " 1149 1150 #, kde-format 1151 msgctxt "color" 1152 msgid "PaleTurquoise1" 1153 msgstr "Firus Pucat 1" 1154 1155 #, kde-format 1156 msgctxt "color" 1157 msgid "PaleTurquoise2" 1158 msgstr "Firus Pucat 2" 1159 1160 #, kde-format 1161 msgctxt "color" 1162 msgid "PaleTurquoise3" 1163 msgstr "Firus Pucat 3" 1164 1165 #, kde-format 1166 msgctxt "color" 1167 msgid "PaleTurquoise4" 1168 msgstr "Firus Pucat 4" 1169 1170 #, kde-format 1171 msgctxt "color" 1172 msgid "PaleVioletRed" 1173 msgstr "Merah Violet Pucat" 1174 1175 #, kde-format 1176 msgctxt "color" 1177 msgid "PaleVioletRed1" 1178 msgstr "Merah Violet Pucat 1" 1179 1180 #, kde-format 1181 msgctxt "color" 1182 msgid "PaleVioletRed2" 1183 msgstr "Merah Violet Pucat 2" 1184 1185 #, kde-format 1186 msgctxt "color" 1187 msgid "PaleVioletRed3" 1188 msgstr "Merah Violet Pucat 3" 1189 1190 #, fuzzy, kde-format 1191 #| msgctxt "color" 1192 #| msgid "PaleVioletRed" 1193 msgctxt "color" 1194 msgid "PaleVioletRed4" 1195 msgstr "Merah Violet Pucat" 1196 1197 #, kde-format 1198 msgctxt "color" 1199 msgid "PapayaWhip" 1200 msgstr "Wip Betik" 1201 1202 #, kde-format 1203 msgctxt "color" 1204 msgid "PeachPuff" 1205 msgstr "Paf Pic" 1206 1207 #, kde-format 1208 msgctxt "color" 1209 msgid "PeachPuff1" 1210 msgstr "Paf Pic 1" 1211 1212 #, kde-format 1213 msgctxt "color" 1214 msgid "PeachPuff2" 1215 msgstr "Paf Pic 2" 1216 1217 #, kde-format 1218 msgctxt "color" 1219 msgid "PeachPuff3" 1220 msgstr "Paf Pic 3" 1221 1222 #, kde-format 1223 msgctxt "color" 1224 msgid "PeachPuff4" 1225 msgstr "Paf Pic 4" 1226 1227 #, kde-format 1228 msgctxt "color" 1229 msgid "PowderBlue" 1230 msgstr "Biru Tepung" 1231 1232 #, kde-format 1233 msgctxt "color" 1234 msgid "RosyBrown" 1235 msgstr "Coklat Kemerah-merahan" 1236 1237 #, kde-format 1238 msgctxt "color" 1239 msgid "RosyBrown1" 1240 msgstr "Coklat Kemerah-merahan 1" 1241 1242 #, kde-format 1243 msgctxt "color" 1244 msgid "RosyBrown2" 1245 msgstr "Coklat Kemerah-merahan 2" 1246 1247 #, kde-format 1248 msgctxt "color" 1249 msgid "RosyBrown3" 1250 msgstr "Coklat Kemerah-merahan 3" 1251 1252 #, kde-format 1253 msgctxt "color" 1254 msgid "RosyBrown4" 1255 msgstr "Coklat Kemerah-merahan 4" 1256 1257 #, fuzzy, kde-format 1258 #| msgctxt "color" 1259 #| msgid "SkyBlue" 1260 msgctxt "color" 1261 msgid "RoyalBlue" 1262 msgstr "Biru Langit" 1263 1264 #, fuzzy, kde-format 1265 #| msgctxt "color" 1266 #| msgid "SkyBlue1" 1267 msgctxt "color" 1268 msgid "RoyalBlue1" 1269 msgstr "Biru Langit1" 1270 1271 #, fuzzy, kde-format 1272 #| msgctxt "color" 1273 #| msgid "SkyBlue2" 1274 msgctxt "color" 1275 msgid "RoyalBlue2" 1276 msgstr "Biru Langit2" 1277 1278 #, fuzzy, kde-format 1279 #| msgctxt "color" 1280 #| msgid "SkyBlue3" 1281 msgctxt "color" 1282 msgid "RoyalBlue3" 1283 msgstr "Biru Langit3" 1284 1285 #, kde-format 1286 msgctxt "color" 1287 msgid "RoyalBlue4" 1288 msgstr "" 1289 1290 #, kde-format 1291 msgctxt "color" 1292 msgid "SaddleBrown" 1293 msgstr "" 1294 1295 #, fuzzy, kde-format 1296 #| msgctxt "color" 1297 #| msgid "RosyBrown" 1298 msgctxt "color" 1299 msgid "SandyBrown" 1300 msgstr "Coklat Kemerah-merahan" 1301 1302 #, fuzzy, kde-format 1303 #| msgctxt "color" 1304 #| msgid "DarkSeaGreen" 1305 msgctxt "color" 1306 msgid "SeaGreen" 1307 msgstr "Hijau Laut Tua" 1308 1309 #, fuzzy, kde-format 1310 #| msgctxt "color" 1311 #| msgid "DarkSeaGreen1" 1312 msgctxt "color" 1313 msgid "SeaGreen1" 1314 msgstr "Hijau Laut Tua 1" 1315 1316 #, fuzzy, kde-format 1317 #| msgctxt "color" 1318 #| msgid "DarkSeaGreen2" 1319 msgctxt "color" 1320 msgid "SeaGreen2" 1321 msgstr "Hijau Laut Tua 2" 1322 1323 #, fuzzy, kde-format 1324 #| msgctxt "color" 1325 #| msgid "DarkSeaGreen3" 1326 msgctxt "color" 1327 msgid "SeaGreen3" 1328 msgstr "Hijau Laut Tua 3" 1329 1330 #, fuzzy, kde-format 1331 #| msgctxt "color" 1332 #| msgid "DarkSeaGreen4" 1333 msgctxt "color" 1334 msgid "SeaGreen4" 1335 msgstr "Hijau Laut Tua 4" 1336 1337 #, kde-format 1338 msgctxt "color" 1339 msgid "SkyBlue" 1340 msgstr "Biru Langit" 1341 1342 #, kde-format 1343 msgctxt "color" 1344 msgid "SkyBlue1" 1345 msgstr "Biru Langit1" 1346 1347 #, kde-format 1348 msgctxt "color" 1349 msgid "SkyBlue2" 1350 msgstr "Biru Langit2" 1351 1352 #, kde-format 1353 msgctxt "color" 1354 msgid "SkyBlue3" 1355 msgstr "Biru Langit3" 1356 1357 #, fuzzy, kde-format 1358 #| msgctxt "color" 1359 #| msgid "SkyBlue" 1360 msgctxt "color" 1361 msgid "SkyBlue4" 1362 msgstr "Biru Langit" 1363 1364 #, fuzzy, kde-format 1365 #| msgctxt "color" 1366 #| msgid "SlateBlue1" 1367 msgctxt "color" 1368 msgid "SlateBlue" 1369 msgstr "Biru Loh 1" 1370 1371 #, kde-format 1372 msgctxt "color" 1373 msgid "SlateBlue1" 1374 msgstr "Biru Loh 1" 1375 1376 #, kde-format 1377 msgctxt "color" 1378 msgid "SlateBlue2" 1379 msgstr "Biru Loh 2" 1380 1381 #, fuzzy, kde-format 1382 #| msgctxt "color" 1383 #| msgid "SlateBlue1" 1384 msgctxt "color" 1385 msgid "SlateBlue3" 1386 msgstr "Biru Loh 1" 1387 1388 #, fuzzy, kde-format 1389 #| msgctxt "color" 1390 #| msgid "SlateBlue1" 1391 msgctxt "color" 1392 msgid "SlateBlue4" 1393 msgstr "Biru Loh 1" 1394 1395 #, kde-format 1396 msgctxt "color" 1397 msgid "SlateGray" 1398 msgstr "Kelabu Loh" 1399 1400 #, kde-format 1401 msgctxt "color" 1402 msgid "SlateGray1" 1403 msgstr "Kelabu Loh 1" 1404 1405 #, kde-format 1406 msgctxt "color" 1407 msgid "SlateGray2" 1408 msgstr "Kelabu Loh 2" 1409 1410 #, kde-format 1411 msgctxt "color" 1412 msgid "SlateGray3" 1413 msgstr "Kelabu Loh 3" 1414 1415 #, kde-format 1416 msgctxt "color" 1417 msgid "SlateGray4" 1418 msgstr "Kelabu Loh 4" 1419 1420 #, kde-format 1421 msgctxt "color" 1422 msgid "SlateGrey" 1423 msgstr "Kelabu Loh" 1424 1425 #, fuzzy, kde-format 1426 #| msgctxt "color" 1427 #| msgid "LightGreen" 1428 msgctxt "color" 1429 msgid "SpringGreen" 1430 msgstr "Hijau Muda" 1431 1432 #, fuzzy, kde-format 1433 #| msgctxt "color" 1434 #| msgid "LightGreen" 1435 msgctxt "color" 1436 msgid "SpringGreen1" 1437 msgstr "Hijau Muda" 1438 1439 #, fuzzy, kde-format 1440 #| msgctxt "color" 1441 #| msgid "LightGreen" 1442 msgctxt "color" 1443 msgid "SpringGreen2" 1444 msgstr "Hijau Muda" 1445 1446 #, fuzzy, kde-format 1447 #| msgctxt "color" 1448 #| msgid "LightGreen" 1449 msgctxt "color" 1450 msgid "SpringGreen3" 1451 msgstr "Hijau Muda" 1452 1453 #, fuzzy, kde-format 1454 #| msgctxt "color" 1455 #| msgid "LightGreen" 1456 msgctxt "color" 1457 msgid "SpringGreen4" 1458 msgstr "Hijau Muda" 1459 1460 #, fuzzy, kde-format 1461 #| msgctxt "color" 1462 #| msgid "LightSteelBlue" 1463 msgctxt "color" 1464 msgid "SteelBlue" 1465 msgstr "Biru Keluli Muda " 1466 1467 #, fuzzy, kde-format 1468 #| msgctxt "color" 1469 #| msgid "LightSteelBlue1" 1470 msgctxt "color" 1471 msgid "SteelBlue1" 1472 msgstr "Biru Keluli Muda 1" 1473 1474 #, fuzzy, kde-format 1475 #| msgctxt "color" 1476 #| msgid "LightSteelBlue2" 1477 msgctxt "color" 1478 msgid "SteelBlue2" 1479 msgstr "Biru Keluli Muda 2" 1480 1481 #, fuzzy, kde-format 1482 #| msgctxt "color" 1483 #| msgid "LightSteelBlue3" 1484 msgctxt "color" 1485 msgid "SteelBlue3" 1486 msgstr "Biru Keluli Muda 3" 1487 1488 #, fuzzy, kde-format 1489 #| msgctxt "color" 1490 #| msgid "LightSteelBlue4" 1491 msgctxt "color" 1492 msgid "SteelBlue4" 1493 msgstr "Biru Keluli Muda 4" 1494 1495 #, fuzzy, kde-format 1496 #| msgctxt "color" 1497 #| msgid "PaleVioletRed" 1498 msgctxt "color" 1499 msgid "VioletRed" 1500 msgstr "Merah Violet Pucat" 1501 1502 #, fuzzy, kde-format 1503 #| msgctxt "color" 1504 #| msgid "PaleVioletRed1" 1505 msgctxt "color" 1506 msgid "VioletRed1" 1507 msgstr "Merah Violet Pucat 1" 1508 1509 #, fuzzy, kde-format 1510 #| msgctxt "color" 1511 #| msgid "PaleVioletRed2" 1512 msgctxt "color" 1513 msgid "VioletRed2" 1514 msgstr "Merah Violet Pucat 2" 1515 1516 #, fuzzy, kde-format 1517 #| msgctxt "color" 1518 #| msgid "PaleVioletRed3" 1519 msgctxt "color" 1520 msgid "VioletRed3" 1521 msgstr "Merah Violet Pucat 3" 1522 1523 #, fuzzy, kde-format 1524 #| msgctxt "color" 1525 #| msgid "PaleVioletRed" 1526 msgctxt "color" 1527 msgid "VioletRed4" 1528 msgstr "Merah Violet Pucat" 1529 1530 #, kde-format 1531 msgctxt "color" 1532 msgid "WhiteSmoke" 1533 msgstr "Asap Putih" 1534 1535 #, fuzzy, kde-format 1536 #| msgctxt "color" 1537 #| msgid "PaleGreen" 1538 msgctxt "color" 1539 msgid "YellowGreen" 1540 msgstr "Hijau Pucat" 1541 1542 #, kde-format 1543 msgctxt "color" 1544 msgid "aquamarine" 1545 msgstr "akuamarin" 1546 1547 #, kde-format 1548 msgctxt "color" 1549 msgid "aquamarine1" 1550 msgstr "akuamarin 1" 1551 1552 #, kde-format 1553 msgctxt "color" 1554 msgid "aquamarine2" 1555 msgstr "akuamarin 2" 1556 1557 #, kde-format 1558 msgctxt "color" 1559 msgid "aquamarine3" 1560 msgstr "akuamarin 3" 1561 1562 #, fuzzy, kde-format 1563 #| msgctxt "color" 1564 #| msgid "aquamarine" 1565 msgctxt "color" 1566 msgid "aquamarine4" 1567 msgstr "akuamarin" 1568 1569 #, kde-format 1570 msgctxt "color" 1571 msgid "azure" 1572 msgstr "biru langit " 1573 1574 #, kde-format 1575 msgctxt "color" 1576 msgid "azure1" 1577 msgstr "biru langit 1" 1578 1579 #, kde-format 1580 msgctxt "color" 1581 msgid "azure2" 1582 msgstr "biru langit 2" 1583 1584 #, kde-format 1585 msgctxt "color" 1586 msgid "azure3" 1587 msgstr "biru langit 3" 1588 1589 #, kde-format 1590 msgctxt "color" 1591 msgid "azure4" 1592 msgstr "biru langit 4" 1593 1594 #, kde-format 1595 msgctxt "color" 1596 msgid "beige" 1597 msgstr "kuning air" 1598 1599 #, kde-format 1600 msgctxt "color" 1601 msgid "bisque" 1602 msgstr "bisque" 1603 1604 #, kde-format 1605 msgctxt "color" 1606 msgid "bisque1" 1607 msgstr "bisque 1" 1608 1609 #, kde-format 1610 msgctxt "color" 1611 msgid "bisque2" 1612 msgstr "bisque 2" 1613 1614 #, kde-format 1615 msgctxt "color" 1616 msgid "bisque3" 1617 msgstr "bisque 3" 1618 1619 #, kde-format 1620 msgctxt "color" 1621 msgid "bisque4" 1622 msgstr "bisque 4" 1623 1624 #, kde-format 1625 msgctxt "color" 1626 msgid "black" 1627 msgstr "" 1628 1629 #, fuzzy, kde-format 1630 #| msgctxt "color" 1631 #| msgid "bisque" 1632 msgctxt "color" 1633 msgid "blue" 1634 msgstr "bisque" 1635 1636 #, fuzzy, kde-format 1637 #| msgctxt "color" 1638 #| msgid "bisque1" 1639 msgctxt "color" 1640 msgid "blue1" 1641 msgstr "bisque 1" 1642 1643 #, fuzzy, kde-format 1644 #| msgctxt "color" 1645 #| msgid "bisque2" 1646 msgctxt "color" 1647 msgid "blue2" 1648 msgstr "bisque 2" 1649 1650 #, fuzzy, kde-format 1651 #| msgctxt "color" 1652 #| msgid "bisque3" 1653 msgctxt "color" 1654 msgid "blue3" 1655 msgstr "bisque 3" 1656 1657 #, fuzzy, kde-format 1658 #| msgctxt "color" 1659 #| msgid "bisque4" 1660 msgctxt "color" 1661 msgid "blue4" 1662 msgstr "bisque 4" 1663 1664 #, kde-format 1665 msgctxt "color" 1666 msgid "brown" 1667 msgstr "" 1668 1669 #, fuzzy, kde-format 1670 #| msgctxt "color" 1671 #| msgid "RosyBrown1" 1672 msgctxt "color" 1673 msgid "brown1" 1674 msgstr "Coklat Kemerah-merahan 1" 1675 1676 #, fuzzy, kde-format 1677 #| msgctxt "color" 1678 #| msgid "RosyBrown2" 1679 msgctxt "color" 1680 msgid "brown2" 1681 msgstr "Coklat Kemerah-merahan 2" 1682 1683 #, fuzzy, kde-format 1684 #| msgctxt "color" 1685 #| msgid "RosyBrown3" 1686 msgctxt "color" 1687 msgid "brown3" 1688 msgstr "Coklat Kemerah-merahan 3" 1689 1690 #, fuzzy, kde-format 1691 #| msgctxt "color" 1692 #| msgid "RosyBrown4" 1693 msgctxt "color" 1694 msgid "brown4" 1695 msgstr "Coklat Kemerah-merahan 4" 1696 1697 #, kde-format 1698 msgctxt "color" 1699 msgid "burlywood" 1700 msgstr "burlywood" 1701 1702 #, kde-format 1703 msgctxt "color" 1704 msgid "burlywood1" 1705 msgstr "burlywood 1" 1706 1707 #, kde-format 1708 msgctxt "color" 1709 msgid "burlywood2" 1710 msgstr "burlywood 2" 1711 1712 #, kde-format 1713 msgctxt "color" 1714 msgid "burlywood3" 1715 msgstr "burlywood 3" 1716 1717 #, fuzzy, kde-format 1718 #| msgctxt "color" 1719 #| msgid "burlywood" 1720 msgctxt "color" 1721 msgid "burlywood4" 1722 msgstr "burlywood" 1723 1724 #, kde-format 1725 msgctxt "color" 1726 msgid "chartreuse" 1727 msgstr "" 1728 1729 #, kde-format 1730 msgctxt "color" 1731 msgid "chartreuse1" 1732 msgstr "" 1733 1734 #, kde-format 1735 msgctxt "color" 1736 msgid "chartreuse2" 1737 msgstr "" 1738 1739 #, kde-format 1740 msgctxt "color" 1741 msgid "chartreuse3" 1742 msgstr "" 1743 1744 #, kde-format 1745 msgctxt "color" 1746 msgid "chartreuse4" 1747 msgstr "" 1748 1749 #, kde-format 1750 msgctxt "color" 1751 msgid "chocolate" 1752 msgstr "" 1753 1754 #, kde-format 1755 msgctxt "color" 1756 msgid "chocolate1" 1757 msgstr "" 1758 1759 #, kde-format 1760 msgctxt "color" 1761 msgid "chocolate2" 1762 msgstr "" 1763 1764 #, kde-format 1765 msgctxt "color" 1766 msgid "chocolate3" 1767 msgstr "" 1768 1769 #, kde-format 1770 msgctxt "color" 1771 msgid "chocolate4" 1772 msgstr "" 1773 1774 #, fuzzy, kde-format 1775 #| msgctxt "color" 1776 #| msgid "cornsilk" 1777 msgctxt "color" 1778 msgid "coral" 1779 msgstr "bulu jagung" 1780 1781 #, fuzzy, kde-format 1782 #| msgctxt "color" 1783 #| msgid "cornsilk1" 1784 msgctxt "color" 1785 msgid "coral1" 1786 msgstr "bulu jagung 1" 1787 1788 #, fuzzy, kde-format 1789 #| msgctxt "color" 1790 #| msgid "cornsilk2" 1791 msgctxt "color" 1792 msgid "coral2" 1793 msgstr "bulu jagung 2" 1794 1795 #, fuzzy, kde-format 1796 #| msgctxt "color" 1797 #| msgid "cornsilk3" 1798 msgctxt "color" 1799 msgid "coral3" 1800 msgstr "bulu jagung 3" 1801 1802 #, fuzzy, kde-format 1803 #| msgctxt "color" 1804 #| msgid "cornsilk4" 1805 msgctxt "color" 1806 msgid "coral4" 1807 msgstr "bulu jagung 4" 1808 1809 #, kde-format 1810 msgctxt "color" 1811 msgid "cornsilk" 1812 msgstr "bulu jagung" 1813 1814 #, kde-format 1815 msgctxt "color" 1816 msgid "cornsilk1" 1817 msgstr "bulu jagung 1" 1818 1819 #, kde-format 1820 msgctxt "color" 1821 msgid "cornsilk2" 1822 msgstr "bulu jagung 2" 1823 1824 #, kde-format 1825 msgctxt "color" 1826 msgid "cornsilk3" 1827 msgstr "bulu jagung 3" 1828 1829 #, kde-format 1830 msgctxt "color" 1831 msgid "cornsilk4" 1832 msgstr "bulu jagung 4" 1833 1834 #, kde-format 1835 msgctxt "color" 1836 msgid "cyan" 1837 msgstr "" 1838 1839 #, kde-format 1840 msgctxt "color" 1841 msgid "cyan1" 1842 msgstr "" 1843 1844 #, kde-format 1845 msgctxt "color" 1846 msgid "cyan2" 1847 msgstr "" 1848 1849 #, kde-format 1850 msgctxt "color" 1851 msgid "cyan3" 1852 msgstr "" 1853 1854 #, kde-format 1855 msgctxt "color" 1856 msgid "cyan4" 1857 msgstr "" 1858 1859 #, kde-format 1860 msgctxt "color" 1861 msgid "firebrick" 1862 msgstr "" 1863 1864 #, kde-format 1865 msgctxt "color" 1866 msgid "firebrick1" 1867 msgstr "" 1868 1869 #, kde-format 1870 msgctxt "color" 1871 msgid "firebrick2" 1872 msgstr "" 1873 1874 #, kde-format 1875 msgctxt "color" 1876 msgid "firebrick3" 1877 msgstr "" 1878 1879 #, kde-format 1880 msgctxt "color" 1881 msgid "firebrick4" 1882 msgstr "" 1883 1884 #, kde-format 1885 msgctxt "color" 1886 msgid "gainsboro" 1887 msgstr "gainsboro" 1888 1889 #, kde-format 1890 msgctxt "color" 1891 msgid "gold" 1892 msgstr "" 1893 1894 #, kde-format 1895 msgctxt "color" 1896 msgid "gold1" 1897 msgstr "" 1898 1899 #, kde-format 1900 msgctxt "color" 1901 msgid "gold2" 1902 msgstr "" 1903 1904 #, kde-format 1905 msgctxt "color" 1906 msgid "gold3" 1907 msgstr "" 1908 1909 #, kde-format 1910 msgctxt "color" 1911 msgid "gold4" 1912 msgstr "" 1913 1914 #, fuzzy, kde-format 1915 #| msgctxt "color" 1916 #| msgid "LightGoldenrod" 1917 msgctxt "color" 1918 msgid "goldenrod" 1919 msgstr "Rod Emas Muda" 1920 1921 #, fuzzy, kde-format 1922 #| msgctxt "color" 1923 #| msgid "LightGoldenrod1" 1924 msgctxt "color" 1925 msgid "goldenrod1" 1926 msgstr "Rod Emas Muda 1" 1927 1928 #, fuzzy, kde-format 1929 #| msgctxt "color" 1930 #| msgid "LightGoldenrod2" 1931 msgctxt "color" 1932 msgid "goldenrod2" 1933 msgstr "Rod Emas Muda 2" 1934 1935 #, fuzzy, kde-format 1936 #| msgctxt "color" 1937 #| msgid "LightGoldenrod3" 1938 msgctxt "color" 1939 msgid "goldenrod3" 1940 msgstr "Rod Emas Muda 3" 1941 1942 #, fuzzy, kde-format 1943 #| msgctxt "color" 1944 #| msgid "LightGoldenrod" 1945 msgctxt "color" 1946 msgid "goldenrod4" 1947 msgstr "Rod Emas Muda" 1948 1949 #, fuzzy, kde-format 1950 #| msgctxt "color" 1951 #| msgid "LightGreen" 1952 msgctxt "color" 1953 msgid "green" 1954 msgstr "Hijau Muda" 1955 1956 #, fuzzy, kde-format 1957 #| msgctxt "color" 1958 #| msgid "LightGreen" 1959 msgctxt "color" 1960 msgid "green1" 1961 msgstr "Hijau Muda" 1962 1963 #, fuzzy, kde-format 1964 #| msgctxt "color" 1965 #| msgid "LightGreen" 1966 msgctxt "color" 1967 msgid "green2" 1968 msgstr "Hijau Muda" 1969 1970 #, fuzzy, kde-format 1971 #| msgctxt "color" 1972 #| msgid "LightGreen" 1973 msgctxt "color" 1974 msgid "green3" 1975 msgstr "Hijau Muda" 1976 1977 #, fuzzy, kde-format 1978 #| msgctxt "color" 1979 #| msgid "LightGreen" 1980 msgctxt "color" 1981 msgid "green4" 1982 msgstr "Hijau Muda" 1983 1984 #, kde-format 1985 msgctxt "color" 1986 msgid "honeydew" 1987 msgstr "tembikai susu" 1988 1989 #, kde-format 1990 msgctxt "color" 1991 msgid "honeydew1" 1992 msgstr "tembikai susu 1" 1993 1994 #, kde-format 1995 msgctxt "color" 1996 msgid "honeydew2" 1997 msgstr "tembikai susu 2" 1998 1999 #, kde-format 2000 msgctxt "color" 2001 msgid "honeydew3" 2002 msgstr "tembikai susu 3" 2003 2004 #, kde-format 2005 msgctxt "color" 2006 msgid "honeydew4" 2007 msgstr "tembikai susu 4" 2008 2009 #, kde-format 2010 msgctxt "color" 2011 msgid "ivory" 2012 msgstr "gading" 2013 2014 #, kde-format 2015 msgctxt "color" 2016 msgid "ivory1" 2017 msgstr "gading 1" 2018 2019 #, kde-format 2020 msgctxt "color" 2021 msgid "ivory2" 2022 msgstr "gading 2" 2023 2024 #, kde-format 2025 msgctxt "color" 2026 msgid "ivory3" 2027 msgstr "gading 3" 2028 2029 #, kde-format 2030 msgctxt "color" 2031 msgid "ivory4" 2032 msgstr "gading 4" 2033 2034 #, kde-format 2035 msgctxt "color" 2036 msgid "khaki" 2037 msgstr "khaki" 2038 2039 #, kde-format 2040 msgctxt "color" 2041 msgid "khaki1" 2042 msgstr "khaki 1" 2043 2044 #, kde-format 2045 msgctxt "color" 2046 msgid "khaki2" 2047 msgstr "khaki 2" 2048 2049 #, kde-format 2050 msgctxt "color" 2051 msgid "khaki3" 2052 msgstr "khaki 3" 2053 2054 #, fuzzy, kde-format 2055 #| msgctxt "color" 2056 #| msgid "khaki" 2057 msgctxt "color" 2058 msgid "khaki4" 2059 msgstr "khaki" 2060 2061 #, kde-format 2062 msgctxt "color" 2063 msgid "lavender" 2064 msgstr "lavender" 2065 2066 #, kde-format 2067 msgctxt "color" 2068 msgid "linen" 2069 msgstr "linen" 2070 2071 #, kde-format 2072 msgctxt "color" 2073 msgid "magenta" 2074 msgstr "" 2075 2076 #, kde-format 2077 msgctxt "color" 2078 msgid "magenta1" 2079 msgstr "" 2080 2081 #, kde-format 2082 msgctxt "color" 2083 msgid "magenta2" 2084 msgstr "" 2085 2086 #, kde-format 2087 msgctxt "color" 2088 msgid "magenta3" 2089 msgstr "" 2090 2091 #, kde-format 2092 msgctxt "color" 2093 msgid "magenta4" 2094 msgstr "" 2095 2096 #, kde-format 2097 msgctxt "color" 2098 msgid "maroon" 2099 msgstr "" 2100 2101 #, kde-format 2102 msgctxt "color" 2103 msgid "maroon1" 2104 msgstr "" 2105 2106 #, kde-format 2107 msgctxt "color" 2108 msgid "maroon2" 2109 msgstr "" 2110 2111 #, kde-format 2112 msgctxt "color" 2113 msgid "maroon3" 2114 msgstr "" 2115 2116 #, kde-format 2117 msgctxt "color" 2118 msgid "maroon4" 2119 msgstr "" 2120 2121 #, kde-format 2122 msgctxt "color" 2123 msgid "moccasin" 2124 msgstr "mokasin" 2125 2126 #, kde-format 2127 msgctxt "color" 2128 msgid "navy" 2129 msgstr "" 2130 2131 #, kde-format 2132 msgctxt "color" 2133 msgid "orange" 2134 msgstr "" 2135 2136 #, kde-format 2137 msgctxt "color" 2138 msgid "orange1" 2139 msgstr "" 2140 2141 #, kde-format 2142 msgctxt "color" 2143 msgid "orange2" 2144 msgstr "" 2145 2146 #, kde-format 2147 msgctxt "color" 2148 msgid "orange3" 2149 msgstr "" 2150 2151 #, kde-format 2152 msgctxt "color" 2153 msgid "orange4" 2154 msgstr "" 2155 2156 #, kde-format 2157 msgctxt "color" 2158 msgid "orchid" 2159 msgstr "orkid" 2160 2161 #, kde-format 2162 msgctxt "color" 2163 msgid "orchid1" 2164 msgstr "orkid1" 2165 2166 #, kde-format 2167 msgctxt "color" 2168 msgid "orchid2" 2169 msgstr "orkid2" 2170 2171 #, kde-format 2172 msgctxt "color" 2173 msgid "orchid3" 2174 msgstr "orkid3" 2175 2176 #, fuzzy, kde-format 2177 #| msgctxt "color" 2178 #| msgid "orchid" 2179 msgctxt "color" 2180 msgid "orchid4" 2181 msgstr "orkid" 2182 2183 #, kde-format 2184 msgctxt "color" 2185 msgid "peru" 2186 msgstr "" 2187 2188 #, kde-format 2189 msgctxt "color" 2190 msgid "pink" 2191 msgstr "merah jambu" 2192 2193 #, kde-format 2194 msgctxt "color" 2195 msgid "pink1" 2196 msgstr "merah jambu1" 2197 2198 #, kde-format 2199 msgctxt "color" 2200 msgid "pink2" 2201 msgstr "merah jambu2" 2202 2203 #, kde-format 2204 msgctxt "color" 2205 msgid "pink3" 2206 msgstr "merah jambu3" 2207 2208 #, fuzzy, kde-format 2209 #| msgctxt "color" 2210 #| msgid "pink" 2211 msgctxt "color" 2212 msgid "pink4" 2213 msgstr "merah jambu" 2214 2215 #, kde-format 2216 msgctxt "color" 2217 msgid "plum" 2218 msgstr "plum" 2219 2220 #, kde-format 2221 msgctxt "color" 2222 msgid "plum1" 2223 msgstr "plum 1" 2224 2225 #, kde-format 2226 msgctxt "color" 2227 msgid "plum2" 2228 msgstr "plum 2" 2229 2230 #, kde-format 2231 msgctxt "color" 2232 msgid "plum3" 2233 msgstr "plum 3" 2234 2235 #, kde-format 2236 msgctxt "color" 2237 msgid "plum4" 2238 msgstr "plum 4" 2239 2240 #, kde-format 2241 msgctxt "color" 2242 msgid "purple" 2243 msgstr "" 2244 2245 #, fuzzy, kde-format 2246 #| msgctxt "color" 2247 #| msgid "azure1" 2248 msgctxt "color" 2249 msgid "purple1" 2250 msgstr "biru langit 1" 2251 2252 #, fuzzy, kde-format 2253 #| msgctxt "color" 2254 #| msgid "azure2" 2255 msgctxt "color" 2256 msgid "purple2" 2257 msgstr "biru langit 2" 2258 2259 #, fuzzy, kde-format 2260 #| msgctxt "color" 2261 #| msgid "azure3" 2262 msgctxt "color" 2263 msgid "purple3" 2264 msgstr "biru langit 3" 2265 2266 #, fuzzy, kde-format 2267 #| msgctxt "color" 2268 #| msgid "azure4" 2269 msgctxt "color" 2270 msgid "purple4" 2271 msgstr "biru langit 4" 2272 2273 #, fuzzy, kde-format 2274 msgctxt "color" 2275 msgid "red" 2276 msgstr "Rab" 2277 2278 #, fuzzy, kde-format 2279 #| msgctxt "color" 2280 #| msgid "azure1" 2281 msgctxt "color" 2282 msgid "red1" 2283 msgstr "biru langit 1" 2284 2285 #, fuzzy, kde-format 2286 #| msgctxt "color" 2287 #| msgid "azure2" 2288 msgctxt "color" 2289 msgid "red2" 2290 msgstr "biru langit 2" 2291 2292 #, fuzzy, kde-format 2293 #| msgctxt "color" 2294 #| msgid "azure3" 2295 msgctxt "color" 2296 msgid "red3" 2297 msgstr "biru langit 3" 2298 2299 #, fuzzy, kde-format 2300 #| msgctxt "color" 2301 #| msgid "azure4" 2302 msgctxt "color" 2303 msgid "red4" 2304 msgstr "biru langit 4" 2305 2306 #, kde-format 2307 msgctxt "color" 2308 msgid "salmon" 2309 msgstr "salmon" 2310 2311 #, kde-format 2312 msgctxt "color" 2313 msgid "salmon1" 2314 msgstr "salmon 1" 2315 2316 #, fuzzy, kde-format 2317 #| msgctxt "color" 2318 #| msgid "salmon" 2319 msgctxt "color" 2320 msgid "salmon2" 2321 msgstr "salmon" 2322 2323 #, fuzzy, kde-format 2324 #| msgctxt "color" 2325 #| msgid "salmon" 2326 msgctxt "color" 2327 msgid "salmon3" 2328 msgstr "salmon" 2329 2330 #, fuzzy, kde-format 2331 #| msgctxt "color" 2332 #| msgid "salmon" 2333 msgctxt "color" 2334 msgid "salmon4" 2335 msgstr "salmon" 2336 2337 #, kde-format 2338 msgctxt "color" 2339 msgid "seashell" 2340 msgstr "cangkerang laut" 2341 2342 #, kde-format 2343 msgctxt "color" 2344 msgid "seashell1" 2345 msgstr "cangkerang laut1" 2346 2347 #, kde-format 2348 msgctxt "color" 2349 msgid "seashell2" 2350 msgstr "cangkerang laut 2" 2351 2352 #, kde-format 2353 msgctxt "color" 2354 msgid "seashell3" 2355 msgstr "cangkerang laut 3" 2356 2357 #, kde-format 2358 msgctxt "color" 2359 msgid "seashell4" 2360 msgstr "cangkerang laut 4" 2361 2362 #, kde-format 2363 msgctxt "color" 2364 msgid "sienna" 2365 msgstr "" 2366 2367 #, kde-format 2368 msgctxt "color" 2369 msgid "sienna1" 2370 msgstr "" 2371 2372 #, kde-format 2373 msgctxt "color" 2374 msgid "sienna2" 2375 msgstr "" 2376 2377 #, kde-format 2378 msgctxt "color" 2379 msgid "sienna3" 2380 msgstr "" 2381 2382 #, kde-format 2383 msgctxt "color" 2384 msgid "sienna4" 2385 msgstr "" 2386 2387 #, kde-format 2388 msgctxt "color" 2389 msgid "snow" 2390 msgstr "salji" 2391 2392 #, kde-format 2393 msgctxt "color" 2394 msgid "snow1" 2395 msgstr "salji1" 2396 2397 #, kde-format 2398 msgctxt "color" 2399 msgid "snow2" 2400 msgstr "salji2" 2401 2402 #, kde-format 2403 msgctxt "color" 2404 msgid "snow3" 2405 msgstr "salji3" 2406 2407 #, kde-format 2408 msgctxt "color" 2409 msgid "snow4" 2410 msgstr "salji4" 2411 2412 #, fuzzy, kde-format 2413 msgctxt "color" 2414 msgid "tan" 2415 msgstr "Pan" 2416 2417 #, fuzzy, kde-format 2418 #| msgctxt "color" 2419 #| msgid "tan" 2420 msgctxt "color" 2421 msgid "tan1" 2422 msgstr "sawo matang" 2423 2424 #, fuzzy, kde-format 2425 #| msgctxt "color" 2426 #| msgid "tan" 2427 msgctxt "color" 2428 msgid "tan2" 2429 msgstr "sawo matang" 2430 2431 #, fuzzy, kde-format 2432 #| msgctxt "color" 2433 #| msgid "tan" 2434 msgctxt "color" 2435 msgid "tan3" 2436 msgstr "sawo matang" 2437 2438 #, fuzzy, kde-format 2439 #| msgctxt "color" 2440 #| msgid "tan" 2441 msgctxt "color" 2442 msgid "tan4" 2443 msgstr "sawo matang" 2444 2445 #, kde-format 2446 msgctxt "color" 2447 msgid "thistle" 2448 msgstr "thistle" 2449 2450 #, kde-format 2451 msgctxt "color" 2452 msgid "thistle1" 2453 msgstr "thistle 1" 2454 2455 #, kde-format 2456 msgctxt "color" 2457 msgid "thistle2" 2458 msgstr "thistle 2" 2459 2460 #, kde-format 2461 msgctxt "color" 2462 msgid "thistle3" 2463 msgstr "thistle 3" 2464 2465 #, kde-format 2466 msgctxt "color" 2467 msgid "thistle4" 2468 msgstr "thistle 4" 2469 2470 #, kde-format 2471 msgctxt "color" 2472 msgid "tomato" 2473 msgstr "" 2474 2475 #, kde-format 2476 msgctxt "color" 2477 msgid "tomato1" 2478 msgstr "" 2479 2480 #, kde-format 2481 msgctxt "color" 2482 msgid "tomato2" 2483 msgstr "" 2484 2485 #, kde-format 2486 msgctxt "color" 2487 msgid "tomato3" 2488 msgstr "" 2489 2490 #, kde-format 2491 msgctxt "color" 2492 msgid "tomato4" 2493 msgstr "" 2494 2495 #, fuzzy, kde-format 2496 #| msgctxt "color" 2497 #| msgid "PaleTurquoise" 2498 msgctxt "color" 2499 msgid "turquoise" 2500 msgstr "Firus Pucat " 2501 2502 #, fuzzy, kde-format 2503 #| msgctxt "color" 2504 #| msgid "PaleTurquoise1" 2505 msgctxt "color" 2506 msgid "turquoise1" 2507 msgstr "Firus Pucat 1" 2508 2509 #, fuzzy, kde-format 2510 #| msgctxt "color" 2511 #| msgid "PaleTurquoise2" 2512 msgctxt "color" 2513 msgid "turquoise2" 2514 msgstr "Firus Pucat 2" 2515 2516 #, fuzzy, kde-format 2517 #| msgctxt "color" 2518 #| msgid "PaleTurquoise3" 2519 msgctxt "color" 2520 msgid "turquoise3" 2521 msgstr "Firus Pucat 3" 2522 2523 #, fuzzy, kde-format 2524 #| msgctxt "color" 2525 #| msgid "PaleTurquoise4" 2526 msgctxt "color" 2527 msgid "turquoise4" 2528 msgstr "Firus Pucat 4" 2529 2530 #, kde-format 2531 msgctxt "color" 2532 msgid "violet" 2533 msgstr "violet" 2534 2535 #, kde-format 2536 msgctxt "color" 2537 msgid "wheat" 2538 msgstr "gandum" 2539 2540 #, kde-format 2541 msgctxt "color" 2542 msgid "wheat1" 2543 msgstr "gandum1" 2544 2545 #, kde-format 2546 msgctxt "color" 2547 msgid "wheat2" 2548 msgstr "gandum2" 2549 2550 #, kde-format 2551 msgctxt "color" 2552 msgid "wheat3" 2553 msgstr "gandum3" 2554 2555 #, kde-format 2556 msgctxt "color" 2557 msgid "wheat4" 2558 msgstr "gandum4" 2559 2560 #, kde-format 2561 msgctxt "color" 2562 msgid "white" 2563 msgstr "putih" 2564 2565 #, kde-format 2566 msgctxt "color" 2567 msgid "yellow" 2568 msgstr "" 2569 2570 #, fuzzy, kde-format 2571 #| msgctxt "color" 2572 #| msgid "LightYellow1" 2573 msgctxt "color" 2574 msgid "yellow1" 2575 msgstr "Kuning Muda 1" 2576 2577 #, fuzzy, kde-format 2578 #| msgctxt "color" 2579 #| msgid "LightYellow2" 2580 msgctxt "color" 2581 msgid "yellow2" 2582 msgstr "Kuning Muda 2" 2583 2584 #, fuzzy, kde-format 2585 #| msgctxt "color" 2586 #| msgid "LightYellow3" 2587 msgctxt "color" 2588 msgid "yellow3" 2589 msgstr "Kuning Muda 3" 2590 2591 #, fuzzy, kde-format 2592 #| msgctxt "color" 2593 #| msgid "LightYellow4" 2594 msgctxt "color" 2595 msgid "yellow4" 2596 msgstr "Kuning Muda 4" 2597 2598 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2599 #, kde-format 2600 msgid "Debug Settings" 2601 msgstr "Tetapan Nyahpepijat" 2602 2603 #: kdebugdialog/kdebugdialog.cpp:59 2604 #, kde-format 2605 msgid "File" 2606 msgstr "Fail" 2607 2608 #: kdebugdialog/kdebugdialog.cpp:60 2609 #, kde-format 2610 msgid "Message Box" 2611 msgstr "Kotak Mesej" 2612 2613 #: kdebugdialog/kdebugdialog.cpp:61 2614 #, kde-format 2615 msgid "Shell" 2616 msgstr "Cengkerang" 2617 2618 #: kdebugdialog/kdebugdialog.cpp:62 2619 #, kde-format 2620 msgid "Syslog" 2621 msgstr "Syslog" 2622 2623 #: kdebugdialog/kdebugdialog.cpp:63 2624 #, kde-format 2625 msgid "None" 2626 msgstr "Tiada" 2627 2628 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2629 #: kdebugdialog/kdebugdialog.ui:48 2630 #, kde-format 2631 msgid "Information" 2632 msgstr "Maklumat" 2633 2634 #. i18n: ectx: property (text), widget (QLabel, label_2) 2635 #. i18n: ectx: property (text), widget (QLabel, label_8) 2636 #. i18n: ectx: property (text), widget (QLabel, label_4) 2637 #. i18n: ectx: property (text), widget (QLabel, label_6) 2638 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2639 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2640 #, kde-format 2641 msgid "Output to:" 2642 msgstr "Output kepada:" 2643 2644 #. i18n: ectx: property (text), widget (QLabel, label_3) 2645 #. i18n: ectx: property (text), widget (QLabel, label_9) 2646 #. i18n: ectx: property (text), widget (QLabel, label_5) 2647 #. i18n: ectx: property (text), widget (QLabel, label_7) 2648 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2649 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2650 #, kde-format 2651 msgid "Filename:" 2652 msgstr "Namafail:" 2653 2654 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2655 #: kdebugdialog/kdebugdialog.ui:83 2656 #, kde-format 2657 msgid "Error" 2658 msgstr "Ralat" 2659 2660 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2661 #: kdebugdialog/kdebugdialog.ui:118 2662 #, kde-format 2663 msgid "Abort on fatal errors" 2664 msgstr "Tamatkan semasa ralat maut" 2665 2666 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2667 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2668 #, kde-format 2669 msgid "Disable all debug output" 2670 msgstr "Matikan semua keluaran nyahpepijat" 2671 2672 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2673 #: kdebugdialog/kdebugdialog.ui:145 2674 #, kde-format 2675 msgid "Warning" 2676 msgstr "Amaran" 2677 2678 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2679 #: kdebugdialog/kdebugdialog.ui:180 2680 #, kde-format 2681 msgid "Fatal Error" 2682 msgstr "Ralat Maut" 2683 2684 #: kdebugdialog/klistdebugdialog.cpp:69 2685 #, kde-format 2686 msgid "&Select All" 2687 msgstr "Pilih &Semua" 2688 2689 #: kdebugdialog/klistdebugdialog.cpp:70 2690 #, kde-format 2691 msgid "&Deselect All" 2692 msgstr "Ti&dak Pilih Semua" 2693 2694 #: kdebugdialog/main.cpp:100 2695 #, kde-format 2696 msgid "KDebugDialog" 2697 msgstr "KDebugDialog" 2698 2699 #: kdebugdialog/main.cpp:101 2700 #, kde-format 2701 msgid "A dialog box for setting preferences for debug output" 2702 msgstr "Kotak dialog untuk tetapan keutamaan bagi output nyah-pepijat" 2703 2704 #: kdebugdialog/main.cpp:102 2705 #, fuzzy, kde-format 2706 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2707 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2708 msgstr "Hakcipta 1999-2009, David Faure <email>faure@kde.org</email>" 2709 2710 #: kdebugdialog/main.cpp:103 2711 #, kde-format 2712 msgid "David Faure" 2713 msgstr "David Faure" 2714 2715 #: kdebugdialog/main.cpp:103 2716 #, kde-format 2717 msgid "Maintainer" 2718 msgstr "Penyelenggara" 2719 2720 #: kdebugdialog/main.cpp:108 2721 #, kde-format 2722 msgid "Show the fully-fledged dialog instead of the default list dialog" 2723 msgstr "Paparkan keseluruhan dialog selain daripada dialog senarai default." 2724 2725 #: kdebugdialog/main.cpp:109 2726 #, kde-format 2727 msgid "Turn area on" 2728 msgstr "Hidupkan kawasan" 2729 2730 #: kdebugdialog/main.cpp:110 2731 #, kde-format 2732 msgid "Turn area off" 2733 msgstr "Matikan kawasan" 2734 2735 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2736 #, kde-format 2737 msgid "no error" 2738 msgstr "tiada ralat" 2739 2740 #: kdecore/k3resolver.cpp:534 2741 #, kde-format 2742 msgid "requested family not supported for this host name" 2743 msgstr "kelompok yang diminta tidak disokong untuk nama hos ini" 2744 2745 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2746 #, kde-format 2747 msgid "temporary failure in name resolution" 2748 msgstr "kegagalan sementara di dalam resolusi nama" 2749 2750 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2751 #, kde-format 2752 msgid "non-recoverable failure in name resolution" 2753 msgstr "Ralat-tidak-dapat-pulih pada resolusi nama" 2754 2755 #: kdecore/k3resolver.cpp:537 2756 #, kde-format 2757 msgid "invalid flags" 2758 msgstr "penanda tidak sah" 2759 2760 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2761 #, kde-format 2762 msgid "memory allocation failure" 2763 msgstr "Kegagalan perletakan memori" 2764 2765 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2766 #, kde-format 2767 msgid "name or service not known" 2768 msgstr "nama atau servis tidak diketahui" 2769 2770 #: kdecore/k3resolver.cpp:540 2771 #, kde-format 2772 msgid "requested family not supported" 2773 msgstr "keluarga diminta tidak disokong" 2774 2775 #: kdecore/k3resolver.cpp:541 2776 #, kde-format 2777 msgid "requested service not supported for this socket type" 2778 msgstr "servis yang diminta tidak disokong untuk jenis soket ini" 2779 2780 #: kdecore/k3resolver.cpp:542 2781 #, kde-format 2782 msgid "requested socket type not supported" 2783 msgstr "jenis soket diminta tidak disokong" 2784 2785 #: kdecore/k3resolver.cpp:543 2786 #, kde-format 2787 msgid "unknown error" 2788 msgstr "ralat tidak diketahui" 2789 2790 #: kdecore/k3resolver.cpp:545 2791 #, kde-format 2792 msgctxt "1: the i18n'ed system error code, from errno" 2793 msgid "system error: %1" 2794 msgstr "ralat sistem: %1" 2795 2796 #: kdecore/k3resolver.cpp:556 2797 #, kde-format 2798 msgid "request was canceled" 2799 msgstr "permintaan dibatalkan" 2800 2801 #: kdecore/k3socketaddress.cpp:631 2802 #, kde-format 2803 msgctxt "1: the unknown socket address family number" 2804 msgid "Unknown family %1" 2805 msgstr "Kelompok tidak diketahui %1" 2806 2807 #: kdecore/k3socketbase.cpp:215 2808 #, kde-format 2809 msgctxt "Socket error code NoError" 2810 msgid "no error" 2811 msgstr "tiada ralat" 2812 2813 #: kdecore/k3socketbase.cpp:220 2814 #, kde-format 2815 msgctxt "Socket error code LookupFailure" 2816 msgid "name lookup has failed" 2817 msgstr "carian nama domain gagal" 2818 2819 #: kdecore/k3socketbase.cpp:225 2820 #, kde-format 2821 msgctxt "Socket error code AddressInUse" 2822 msgid "address already in use" 2823 msgstr "alamat sudah diguna" 2824 2825 #: kdecore/k3socketbase.cpp:230 2826 #, kde-format 2827 msgctxt "Socket error code AlreadyBound" 2828 msgid "socket is already bound" 2829 msgstr "soket sudah digunakan" 2830 2831 #: kdecore/k3socketbase.cpp:235 2832 #, kde-format 2833 msgctxt "Socket error code AlreadyCreated" 2834 msgid "socket is already created" 2835 msgstr "soket telah dicipta" 2836 2837 #: kdecore/k3socketbase.cpp:240 2838 #, kde-format 2839 msgctxt "Socket error code NotBound" 2840 msgid "socket is not bound" 2841 msgstr "soket tidak digunakan" 2842 2843 #: kdecore/k3socketbase.cpp:245 2844 #, kde-format 2845 msgctxt "Socket error code NotCreated" 2846 msgid "socket has not been created" 2847 msgstr "soket telah belum dicipta" 2848 2849 #: kdecore/k3socketbase.cpp:250 2850 #, kde-format 2851 msgctxt "Socket error code WouldBlock" 2852 msgid "operation would block" 2853 msgstr "operasi akan blok" 2854 2855 #: kdecore/k3socketbase.cpp:255 2856 #, kde-format 2857 msgctxt "Socket error code ConnectionRefused" 2858 msgid "connection actively refused" 2859 msgstr "sambungan ditolak secara aktif" 2860 2861 #: kdecore/k3socketbase.cpp:260 2862 #, kde-format 2863 msgctxt "Socket error code ConnectionTimedOut" 2864 msgid "connection timed out" 2865 msgstr "sambungan gagal" 2866 2867 #: kdecore/k3socketbase.cpp:265 2868 #, kde-format 2869 msgctxt "Socket error code InProgress" 2870 msgid "operation is already in progress" 2871 msgstr "operasi sedang berjalan" 2872 2873 #: kdecore/k3socketbase.cpp:270 2874 #, kde-format 2875 msgctxt "Socket error code NetFailure" 2876 msgid "network failure occurred" 2877 msgstr "kegagalan rangkaian berlaku" 2878 2879 #: kdecore/k3socketbase.cpp:275 2880 #, kde-format 2881 msgctxt "Socket error code NotSupported" 2882 msgid "operation is not supported" 2883 msgstr "operasi tidak disokong" 2884 2885 #: kdecore/k3socketbase.cpp:280 2886 #, kde-format 2887 msgctxt "Socket error code Timeout" 2888 msgid "timed operation timed out" 2889 msgstr "operasi masa gagal" 2890 2891 #: kdecore/k3socketbase.cpp:285 2892 #, kde-format 2893 msgctxt "Socket error code UnknownError" 2894 msgid "an unknown/unexpected error has happened" 2895 msgstr "ralat tidak diketahui/tidak dijangka telah berlaku" 2896 2897 #: kdecore/k3socketbase.cpp:290 2898 #, kde-format 2899 msgctxt "Socket error code RemotelyDisconnected" 2900 msgid "remote host closed connection" 2901 msgstr "hos jauh menutup sambungan" 2902 2903 #: kdecore/k4aboutdata.cpp:267 2904 #, kde-format 2905 msgid "" 2906 "No licensing terms for this program have been specified.\n" 2907 "Please check the documentation or the source for any\n" 2908 "licensing terms.\n" 2909 msgstr "" 2910 2911 #: kdecore/k4aboutdata.cpp:273 2912 #, kde-format 2913 msgid "This program is distributed under the terms of the %1." 2914 msgstr "" 2915 2916 #: kdecore/k4aboutdata.cpp:297 2917 #, kde-format 2918 msgctxt "@item license (short name)" 2919 msgid "GPL v2" 2920 msgstr "GPL v2" 2921 2922 #: kdecore/k4aboutdata.cpp:298 2923 #, kde-format 2924 msgctxt "@item license" 2925 msgid "GNU General Public License Version 2" 2926 msgstr "GNU General Public License Version 2" 2927 2928 #: kdecore/k4aboutdata.cpp:301 2929 #, kde-format 2930 msgctxt "@item license (short name)" 2931 msgid "LGPL v2" 2932 msgstr "LGPL v2" 2933 2934 #: kdecore/k4aboutdata.cpp:302 2935 #, kde-format 2936 msgctxt "@item license" 2937 msgid "GNU Lesser General Public License Version 2" 2938 msgstr "GNU Lesser General Public License Version 2" 2939 2940 #: kdecore/k4aboutdata.cpp:305 2941 #, kde-format 2942 msgctxt "@item license (short name)" 2943 msgid "BSD License" 2944 msgstr "Lesen BSD" 2945 2946 #: kdecore/k4aboutdata.cpp:306 2947 #, kde-format 2948 msgctxt "@item license" 2949 msgid "BSD License" 2950 msgstr "Lesen BSD" 2951 2952 #: kdecore/k4aboutdata.cpp:309 2953 #, kde-format 2954 msgctxt "@item license (short name)" 2955 msgid "Artistic License" 2956 msgstr "Lesen Artistik" 2957 2958 #: kdecore/k4aboutdata.cpp:310 2959 #, kde-format 2960 msgctxt "@item license" 2961 msgid "Artistic License" 2962 msgstr "Lesen Artistik" 2963 2964 #: kdecore/k4aboutdata.cpp:313 2965 #, kde-format 2966 msgctxt "@item license (short name)" 2967 msgid "QPL v1.0" 2968 msgstr "QPL v1.0" 2969 2970 #: kdecore/k4aboutdata.cpp:314 2971 #, kde-format 2972 msgctxt "@item license" 2973 msgid "Q Public License" 2974 msgstr "Lesen Awam Q" 2975 2976 #: kdecore/k4aboutdata.cpp:317 2977 #, kde-format 2978 msgctxt "@item license (short name)" 2979 msgid "GPL v3" 2980 msgstr "GPL v3" 2981 2982 #: kdecore/k4aboutdata.cpp:318 2983 #, kde-format 2984 msgctxt "@item license" 2985 msgid "GNU General Public License Version 3" 2986 msgstr "GNU General Public License Version 3" 2987 2988 #: kdecore/k4aboutdata.cpp:321 2989 #, kde-format 2990 msgctxt "@item license (short name)" 2991 msgid "LGPL v3" 2992 msgstr "LGPL v3" 2993 2994 #: kdecore/k4aboutdata.cpp:322 2995 #, kde-format 2996 msgctxt "@item license" 2997 msgid "GNU Lesser General Public License Version 3" 2998 msgstr "GNU Lesser General Public License Version 3" 2999 3000 #: kdecore/k4aboutdata.cpp:326 3001 #, kde-format 3002 msgctxt "@item license" 3003 msgid "Custom" 3004 msgstr "Tersendiri" 3005 3006 #: kdecore/k4aboutdata.cpp:329 3007 #, kde-format 3008 msgctxt "@item license" 3009 msgid "Not specified" 3010 msgstr "Tidak dinyatakan" 3011 3012 #: kdecore/k4aboutdata.cpp:891 3013 #, kde-format 3014 msgctxt "replace this with information about your translation team" 3015 msgid "" 3016 "<p>KDE is translated into many languages thanks to the work of the " 3017 "translation teams all over the world.</p><p>For more information on KDE " 3018 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 3019 "org</a></p>" 3020 msgstr "" 3021 "<p>KDE diterjemahkan kepada pelbagai bahasa oleh pasukan penterjemah di " 3022 "serata dunia.</p><p>Untuk maklumat lanjut berkaitan pengantarabangsaan KDE, " 3023 "sila lawat http://i18n.kde.org</p>" 3024 3025 #: kdecore/kcalendarsystem.cpp:108 3026 #, kde-format 3027 msgctxt "@item Calendar system" 3028 msgid "Gregorian" 3029 msgstr "Gregorian" 3030 3031 #: kdecore/kcalendarsystem.cpp:110 3032 #, fuzzy, kde-format 3033 msgctxt "@item Calendar system" 3034 msgid "Coptic" 3035 msgstr "Coptic" 3036 3037 #: kdecore/kcalendarsystem.cpp:112 3038 #, fuzzy, kde-format 3039 msgctxt "@item Calendar system" 3040 msgid "Ethiopian" 3041 msgstr "Ethiopic" 3042 3043 #: kdecore/kcalendarsystem.cpp:114 3044 #, kde-format 3045 msgctxt "@item Calendar system" 3046 msgid "Hebrew" 3047 msgstr "Hebrew" 3048 3049 #: kdecore/kcalendarsystem.cpp:116 3050 #, kde-format 3051 msgctxt "@item Calendar system" 3052 msgid "Islamic / Hijri (Civil)" 3053 msgstr "" 3054 3055 #: kdecore/kcalendarsystem.cpp:118 3056 #, kde-format 3057 msgctxt "@item Calendar system" 3058 msgid "Indian National" 3059 msgstr "" 3060 3061 #: kdecore/kcalendarsystem.cpp:120 3062 #, kde-format 3063 msgctxt "@item Calendar system" 3064 msgid "Jalali" 3065 msgstr "Jalali" 3066 3067 #: kdecore/kcalendarsystem.cpp:122 3068 #, kde-format 3069 msgctxt "@item Calendar system" 3070 msgid "Japanese" 3071 msgstr "" 3072 3073 #: kdecore/kcalendarsystem.cpp:124 3074 #, fuzzy, kde-format 3075 msgctxt "@item Calendar system" 3076 msgid "Julian" 3077 msgstr "Jan" 3078 3079 #: kdecore/kcalendarsystem.cpp:126 3080 #, kde-format 3081 msgctxt "@item Calendar system" 3082 msgid "Taiwanese" 3083 msgstr "" 3084 3085 #: kdecore/kcalendarsystem.cpp:128 3086 #, fuzzy, kde-format 3087 #| msgid "R. Thaani" 3088 msgctxt "@item Calendar system" 3089 msgid "Thai" 3090 msgstr "R. Thaani" 3091 3092 #: kdecore/kcalendarsystem.cpp:131 3093 #, kde-format 3094 msgctxt "@item Calendar system" 3095 msgid "Invalid Calendar Type" 3096 msgstr "Jenis Kalendar Tidak Sah" 3097 3098 #: kdecore/kcalendarsystem.cpp:1495 3099 #, kde-format 3100 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 3101 msgid "-" 3102 msgstr "" 3103 3104 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 3105 #: kio/kfilemetadataprovider.cpp:199 3106 #, kde-format 3107 msgid "Today" 3108 msgstr "Hari ini" 3109 3110 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 3111 #: kio/kfilemetadataprovider.cpp:202 3112 #, kde-format 3113 msgid "Yesterday" 3114 msgstr "Semalam" 3115 3116 #: kdecore/kcalendarsystemcoptic.cpp:45 3117 #, kde-format 3118 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 3119 msgid "Anno Martyrum" 3120 msgstr "" 3121 3122 #: kdecore/kcalendarsystemcoptic.cpp:46 3123 #, kde-format 3124 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 3125 msgid "AM" 3126 msgstr "" 3127 3128 #: kdecore/kcalendarsystemcoptic.cpp:47 3129 #, kde-format 3130 msgctxt "" 3131 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 3132 msgid "%Ey %EC" 3133 msgstr "" 3134 3135 #: kdecore/kcalendarsystemcoptic.cpp:153 3136 #, kde-format 3137 msgctxt "Coptic month 1 - KLocale::NarrowName" 3138 msgid "T" 3139 msgstr "" 3140 3141 #: kdecore/kcalendarsystemcoptic.cpp:155 3142 #, kde-format 3143 msgctxt "Coptic month 2 - KLocale::NarrowName" 3144 msgid "P" 3145 msgstr "" 3146 3147 #: kdecore/kcalendarsystemcoptic.cpp:157 3148 #, kde-format 3149 msgctxt "Coptic month 3 - KLocale::NarrowName" 3150 msgid "H" 3151 msgstr "" 3152 3153 #: kdecore/kcalendarsystemcoptic.cpp:159 3154 #, kde-format 3155 msgctxt "Coptic month 4 - KLocale::NarrowName" 3156 msgid "K" 3157 msgstr "" 3158 3159 #: kdecore/kcalendarsystemcoptic.cpp:161 3160 #, kde-format 3161 msgctxt "Coptic month 5 - KLocale::NarrowName" 3162 msgid "T" 3163 msgstr "" 3164 3165 #: kdecore/kcalendarsystemcoptic.cpp:163 3166 #, kde-format 3167 msgctxt "Coptic month 6 - KLocale::NarrowName" 3168 msgid "M" 3169 msgstr "" 3170 3171 #: kdecore/kcalendarsystemcoptic.cpp:165 3172 #, kde-format 3173 msgctxt "Coptic month 7 - KLocale::NarrowName" 3174 msgid "P" 3175 msgstr "" 3176 3177 #: kdecore/kcalendarsystemcoptic.cpp:167 3178 #, kde-format 3179 msgctxt "Coptic month 8 - KLocale::NarrowName" 3180 msgid "P" 3181 msgstr "" 3182 3183 #: kdecore/kcalendarsystemcoptic.cpp:169 3184 #, kde-format 3185 msgctxt "Coptic month 9 - KLocale::NarrowName" 3186 msgid "P" 3187 msgstr "" 3188 3189 #: kdecore/kcalendarsystemcoptic.cpp:171 3190 #, kde-format 3191 msgctxt "Coptic month 10 - KLocale::NarrowName" 3192 msgid "P" 3193 msgstr "" 3194 3195 #: kdecore/kcalendarsystemcoptic.cpp:173 3196 #, kde-format 3197 msgctxt "Coptic month 11 - KLocale::NarrowName" 3198 msgid "E" 3199 msgstr "" 3200 3201 #: kdecore/kcalendarsystemcoptic.cpp:175 3202 #, kde-format 3203 msgctxt "Coptic month 12 - KLocale::NarrowName" 3204 msgid "M" 3205 msgstr "" 3206 3207 #: kdecore/kcalendarsystemcoptic.cpp:177 3208 #, kde-format 3209 msgctxt "Coptic month 13 - KLocale::NarrowName" 3210 msgid "K" 3211 msgstr "" 3212 3213 #: kdecore/kcalendarsystemcoptic.cpp:186 3214 #, fuzzy, kde-format 3215 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 3216 msgid "of Tho" 3217 msgstr "bagi Kho" 3218 3219 #: kdecore/kcalendarsystemcoptic.cpp:188 3220 #, fuzzy, kde-format 3221 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 3222 msgid "of Pao" 3223 msgstr "bagi Tamuz" 3224 3225 #: kdecore/kcalendarsystemcoptic.cpp:190 3226 #, fuzzy, kde-format 3227 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 3228 msgid "of Hat" 3229 msgstr "bagi Shvat" 3230 3231 #: kdecore/kcalendarsystemcoptic.cpp:192 3232 #, fuzzy, kde-format 3233 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 3234 msgid "of Kia" 3235 msgstr "bagi Nisan" 3236 3237 #: kdecore/kcalendarsystemcoptic.cpp:194 3238 #, fuzzy, kde-format 3239 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 3240 msgid "of Tob" 3241 msgstr "Februari" 3242 3243 #: kdecore/kcalendarsystemcoptic.cpp:196 3244 #, fuzzy, kde-format 3245 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 3246 msgid "of Mes" 3247 msgstr "bagi Meh" 3248 3249 #: kdecore/kcalendarsystemcoptic.cpp:198 3250 #, fuzzy, kde-format 3251 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 3252 msgid "of Par" 3253 msgstr "Mac" 3254 3255 #: kdecore/kcalendarsystemcoptic.cpp:200 3256 #, fuzzy, kde-format 3257 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 3258 msgid "of Pam" 3259 msgstr "bagi Tamuz" 3260 3261 #: kdecore/kcalendarsystemcoptic.cpp:202 3262 #, fuzzy, kde-format 3263 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 3264 msgid "of Pas" 3265 msgstr "bagi Bah" 3266 3267 #: kdecore/kcalendarsystemcoptic.cpp:204 3268 #, fuzzy, kde-format 3269 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 3270 msgid "of Pan" 3271 msgstr "Januari" 3272 3273 #: kdecore/kcalendarsystemcoptic.cpp:206 3274 #, fuzzy, kde-format 3275 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 3276 msgid "of Epe" 3277 msgstr "Februari" 3278 3279 #: kdecore/kcalendarsystemcoptic.cpp:208 3280 #, fuzzy, kde-format 3281 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 3282 msgid "of Meo" 3283 msgstr "bagi Mor" 3284 3285 #: kdecore/kcalendarsystemcoptic.cpp:210 3286 #, fuzzy, kde-format 3287 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3288 msgid "of Kou" 3289 msgstr "bagi Kho" 3290 3291 #: kdecore/kcalendarsystemcoptic.cpp:219 3292 #, fuzzy, kde-format 3293 msgctxt "Coptic month 1 - KLocale::ShortName" 3294 msgid "Tho" 3295 msgstr "Sel" 3296 3297 #: kdecore/kcalendarsystemcoptic.cpp:221 3298 #, fuzzy, kde-format 3299 msgctxt "Coptic month 2 - KLocale::ShortName" 3300 msgid "Pao" 3301 msgstr "Jeda" 3302 3303 #: kdecore/kcalendarsystemcoptic.cpp:223 3304 #, fuzzy, kde-format 3305 msgctxt "Coptic month 3 - KLocale::ShortName" 3306 msgid "Hat" 3307 msgstr "Sab" 3308 3309 #: kdecore/kcalendarsystemcoptic.cpp:225 3310 #, fuzzy, kde-format 3311 msgctxt "Coptic month 4 - KLocale::ShortName" 3312 msgid "Kia" 3313 msgstr "Kha" 3314 3315 #: kdecore/kcalendarsystemcoptic.cpp:227 3316 #, fuzzy, kde-format 3317 msgctxt "Coptic month 5 - KLocale::ShortName" 3318 msgid "Tob" 3319 msgstr "Tugas" 3320 3321 #: kdecore/kcalendarsystemcoptic.cpp:229 3322 #, fuzzy, kde-format 3323 msgctxt "Coptic month 6 - KLocale::ShortName" 3324 msgid "Mes" 3325 msgstr "Ya" 3326 3327 #: kdecore/kcalendarsystemcoptic.cpp:231 3328 #, fuzzy, kde-format 3329 msgctxt "Coptic month 7 - KLocale::ShortName" 3330 msgid "Par" 3331 msgstr "Par" 3332 3333 #: kdecore/kcalendarsystemcoptic.cpp:233 3334 #, fuzzy, kde-format 3335 msgctxt "Coptic month 8 - KLocale::ShortName" 3336 msgid "Pam" 3337 msgstr "am" 3338 3339 #: kdecore/kcalendarsystemcoptic.cpp:235 3340 #, fuzzy, kde-format 3341 msgctxt "Coptic month 9 - KLocale::ShortName" 3342 msgid "Pas" 3343 msgstr "Halaman" 3344 3345 #: kdecore/kcalendarsystemcoptic.cpp:237 3346 #, fuzzy, kde-format 3347 msgctxt "Coptic month 10 - KLocale::ShortName" 3348 msgid "Pan" 3349 msgstr "Pan" 3350 3351 #: kdecore/kcalendarsystemcoptic.cpp:239 3352 #, fuzzy, kde-format 3353 msgctxt "Coptic month 11 - KLocale::ShortName" 3354 msgid "Epe" 3355 msgstr "Elak" 3356 3357 #: kdecore/kcalendarsystemcoptic.cpp:241 3358 #, fuzzy, kde-format 3359 msgctxt "Coptic month 12 - KLocale::ShortName" 3360 msgid "Meo" 3361 msgstr "Isn" 3362 3363 #: kdecore/kcalendarsystemcoptic.cpp:243 3364 #, fuzzy, kde-format 3365 msgctxt "Coptic month 12 - KLocale::ShortName" 3366 msgid "Kou" 3367 msgstr "Kho" 3368 3369 #: kdecore/kcalendarsystemcoptic.cpp:252 3370 #, fuzzy, kde-format 3371 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3372 msgid "of Thoout" 3373 msgstr "bagi Kho" 3374 3375 #: kdecore/kcalendarsystemcoptic.cpp:254 3376 #, fuzzy, kde-format 3377 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3378 msgid "of Paope" 3379 msgstr "bagi Tamuz" 3380 3381 #: kdecore/kcalendarsystemcoptic.cpp:256 3382 #, fuzzy, kde-format 3383 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3384 msgid "of Hathor" 3385 msgstr "Zulhijjah" 3386 3387 #: kdecore/kcalendarsystemcoptic.cpp:258 3388 #, fuzzy, kde-format 3389 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3390 msgid "of Kiahk" 3391 msgstr "bagi Kho" 3392 3393 #: kdecore/kcalendarsystemcoptic.cpp:260 3394 #, fuzzy, kde-format 3395 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3396 msgid "of Tobe" 3397 msgstr "dari Oktober" 3398 3399 #: kdecore/kcalendarsystemcoptic.cpp:262 3400 #, fuzzy, kde-format 3401 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3402 msgid "of Meshir" 3403 msgstr "bagi Mehr" 3404 3405 #: kdecore/kcalendarsystemcoptic.cpp:264 3406 #, fuzzy, kde-format 3407 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3408 msgid "of Paremhotep" 3409 msgstr "Parameter" 3410 3411 #: kdecore/kcalendarsystemcoptic.cpp:266 3412 #, fuzzy, kde-format 3413 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3414 msgid "of Parmoute" 3415 msgstr "bagi Tamuz" 3416 3417 #: kdecore/kcalendarsystemcoptic.cpp:268 3418 #, fuzzy, kde-format 3419 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3420 msgid "of Pashons" 3421 msgstr "bagi Bah" 3422 3423 #: kdecore/kcalendarsystemcoptic.cpp:270 3424 #, fuzzy, kde-format 3425 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3426 msgid "of Paone" 3427 msgstr "Januari" 3428 3429 #: kdecore/kcalendarsystemcoptic.cpp:272 3430 #, fuzzy, kde-format 3431 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3432 msgid "of Epep" 3433 msgstr "September" 3434 3435 #: kdecore/kcalendarsystemcoptic.cpp:274 3436 #, fuzzy, kde-format 3437 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3438 msgid "of Mesore" 3439 msgstr "bagi Mor" 3440 3441 #: kdecore/kcalendarsystemcoptic.cpp:276 3442 #, fuzzy, kde-format 3443 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3444 msgid "of Kouji nabot" 3445 msgstr "Februari" 3446 3447 #: kdecore/kcalendarsystemcoptic.cpp:285 3448 #, fuzzy, kde-format 3449 msgctxt "Coptic month 1 - KLocale::LongName" 3450 msgid "Thoout" 3451 msgstr "Kha" 3452 3453 #: kdecore/kcalendarsystemcoptic.cpp:287 3454 #, fuzzy, kde-format 3455 msgctxt "Coptic month 2 - KLocale::LongName" 3456 msgid "Paope" 3457 msgstr "Ciri-ciri" 3458 3459 #: kdecore/kcalendarsystemcoptic.cpp:289 3460 #, fuzzy, kde-format 3461 msgctxt "Coptic month 3 - KLocale::LongName" 3462 msgid "Hathor" 3463 msgstr "Penulis" 3464 3465 #: kdecore/kcalendarsystemcoptic.cpp:291 3466 #, fuzzy, kde-format 3467 msgctxt "Coptic month 4 - KLocale::LongName" 3468 msgid "Kiahk" 3469 msgstr "bagi Kho" 3470 3471 #: kdecore/kcalendarsystemcoptic.cpp:293 3472 #, fuzzy, kde-format 3473 msgctxt "Coptic month 5 - KLocale::LongName" 3474 msgid "Tobe" 3475 msgstr "Tugas" 3476 3477 #: kdecore/kcalendarsystemcoptic.cpp:295 3478 #, fuzzy, kde-format 3479 msgctxt "Coptic month 6 - KLocale::LongName" 3480 msgid "Meshir" 3481 msgstr "Mehr" 3482 3483 #: kdecore/kcalendarsystemcoptic.cpp:297 3484 #, fuzzy, kde-format 3485 msgctxt "Coptic month 7 - KLocale::LongName" 3486 msgid "Paremhotep" 3487 msgstr "Parameter" 3488 3489 #: kdecore/kcalendarsystemcoptic.cpp:299 3490 #, fuzzy, kde-format 3491 msgctxt "Coptic month 8 - KLocale::LongName" 3492 msgid "Parmoute" 3493 msgstr "Parameter" 3494 3495 #: kdecore/kcalendarsystemcoptic.cpp:301 3496 #, fuzzy, kde-format 3497 msgctxt "Coptic month 9 - KLocale::LongName" 3498 msgid "Pashons" 3499 msgstr "Jeda" 3500 3501 #: kdecore/kcalendarsystemcoptic.cpp:303 3502 #, fuzzy, kde-format 3503 msgctxt "Coptic month 10 - KLocale::LongName" 3504 msgid "Paone" 3505 msgstr "Tiada" 3506 3507 #: kdecore/kcalendarsystemcoptic.cpp:305 3508 #, fuzzy, kde-format 3509 msgctxt "Coptic month 11 - KLocale::LongName" 3510 msgid "Epep" 3511 msgstr "Elak" 3512 3513 #: kdecore/kcalendarsystemcoptic.cpp:307 3514 #, fuzzy, kde-format 3515 msgctxt "Coptic month 12 - KLocale::LongName" 3516 msgid "Mesore" 3517 msgstr "&Pulih" 3518 3519 #: kdecore/kcalendarsystemcoptic.cpp:309 3520 #, fuzzy, kde-format 3521 msgctxt "Coptic month 12 - KLocale::LongName" 3522 msgid "Kouji nabot" 3523 msgstr "Februari" 3524 3525 #: kdecore/kcalendarsystemcoptic.cpp:324 3526 #, kde-format 3527 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3528 msgid "P" 3529 msgstr "" 3530 3531 #: kdecore/kcalendarsystemcoptic.cpp:326 3532 #, kde-format 3533 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3534 msgid "P" 3535 msgstr "" 3536 3537 #: kdecore/kcalendarsystemcoptic.cpp:328 3538 #, kde-format 3539 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3540 msgid "P" 3541 msgstr "" 3542 3543 #: kdecore/kcalendarsystemcoptic.cpp:330 3544 #, kde-format 3545 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3546 msgid "P" 3547 msgstr "" 3548 3549 #: kdecore/kcalendarsystemcoptic.cpp:332 3550 #, kde-format 3551 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3552 msgid "P" 3553 msgstr "" 3554 3555 #: kdecore/kcalendarsystemcoptic.cpp:334 3556 #, kde-format 3557 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3558 msgid "P" 3559 msgstr "" 3560 3561 #: kdecore/kcalendarsystemcoptic.cpp:336 3562 #, kde-format 3563 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3564 msgid "T" 3565 msgstr "" 3566 3567 #: kdecore/kcalendarsystemcoptic.cpp:345 3568 #, fuzzy, kde-format 3569 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3570 msgid "Pes" 3571 msgstr "Halaman" 3572 3573 #: kdecore/kcalendarsystemcoptic.cpp:347 3574 #, fuzzy, kde-format 3575 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3576 msgid "Psh" 3577 msgstr "Jeda" 3578 3579 #: kdecore/kcalendarsystemcoptic.cpp:349 3580 #, fuzzy, kde-format 3581 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3582 msgid "Pef" 3583 msgstr "Halaman" 3584 3585 #: kdecore/kcalendarsystemcoptic.cpp:351 3586 #, kde-format 3587 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3588 msgid "Pti" 3589 msgstr "" 3590 3591 #: kdecore/kcalendarsystemcoptic.cpp:353 3592 #, fuzzy, kde-format 3593 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3594 msgid "Pso" 3595 msgstr "Jeda" 3596 3597 #: kdecore/kcalendarsystemcoptic.cpp:355 3598 #, fuzzy, kde-format 3599 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3600 msgid "Psa" 3601 msgstr "Jeda" 3602 3603 #: kdecore/kcalendarsystemcoptic.cpp:357 3604 #, kde-format 3605 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3606 msgid "Tky" 3607 msgstr "" 3608 3609 #: kdecore/kcalendarsystemcoptic.cpp:365 3610 #, fuzzy, kde-format 3611 msgctxt "Coptic weekday 1 - KLocale::LongName" 3612 msgid "Pesnau" 3613 msgstr "Jeda" 3614 3615 #: kdecore/kcalendarsystemcoptic.cpp:367 3616 #, fuzzy, kde-format 3617 msgctxt "Coptic weekday 2 - KLocale::LongName" 3618 msgid "Pshoment" 3619 msgstr "Komen" 3620 3621 #: kdecore/kcalendarsystemcoptic.cpp:369 3622 #, kde-format 3623 msgctxt "Coptic weekday 3 - KLocale::LongName" 3624 msgid "Peftoou" 3625 msgstr "" 3626 3627 #: kdecore/kcalendarsystemcoptic.cpp:371 3628 #, kde-format 3629 msgctxt "Coptic weekday 4 - KLocale::LongName" 3630 msgid "Ptiou" 3631 msgstr "" 3632 3633 #: kdecore/kcalendarsystemcoptic.cpp:373 3634 #, fuzzy, kde-format 3635 msgctxt "Coptic weekday 5 - KLocale::LongName" 3636 msgid "Psoou" 3637 msgstr "Jeda" 3638 3639 #: kdecore/kcalendarsystemcoptic.cpp:375 3640 #, kde-format 3641 msgctxt "Coptic weekday 6 - KLocale::LongName" 3642 msgid "Psabbaton" 3643 msgstr "" 3644 3645 #: kdecore/kcalendarsystemcoptic.cpp:377 3646 #, kde-format 3647 msgctxt "Coptic weekday 7 - KLocale::LongName" 3648 msgid "Tkyriakē" 3649 msgstr "" 3650 3651 #: kdecore/kcalendarsystemethiopian.cpp:50 3652 #, kde-format 3653 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3654 msgid "Amata Mehrat" 3655 msgstr "" 3656 3657 #: kdecore/kcalendarsystemethiopian.cpp:51 3658 #, kde-format 3659 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3660 msgid "AM" 3661 msgstr "" 3662 3663 #: kdecore/kcalendarsystemethiopian.cpp:52 3664 #, kde-format 3665 msgctxt "" 3666 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3667 msgid "%Ey %EC" 3668 msgstr "" 3669 3670 #: kdecore/kcalendarsystemethiopian.cpp:66 3671 #, kde-format 3672 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3673 msgid "M" 3674 msgstr "" 3675 3676 #: kdecore/kcalendarsystemethiopian.cpp:68 3677 #, kde-format 3678 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3679 msgid "T" 3680 msgstr "" 3681 3682 #: kdecore/kcalendarsystemethiopian.cpp:70 3683 #, kde-format 3684 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3685 msgid "H" 3686 msgstr "" 3687 3688 #: kdecore/kcalendarsystemethiopian.cpp:72 3689 #, kde-format 3690 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3691 msgid "T" 3692 msgstr "" 3693 3694 #: kdecore/kcalendarsystemethiopian.cpp:74 3695 #, kde-format 3696 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3697 msgid "T" 3698 msgstr "" 3699 3700 #: kdecore/kcalendarsystemethiopian.cpp:76 3701 #, kde-format 3702 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3703 msgid "Y" 3704 msgstr "" 3705 3706 #: kdecore/kcalendarsystemethiopian.cpp:78 3707 #, kde-format 3708 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3709 msgid "M" 3710 msgstr "" 3711 3712 #: kdecore/kcalendarsystemethiopian.cpp:80 3713 #, kde-format 3714 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3715 msgid "M" 3716 msgstr "" 3717 3718 #: kdecore/kcalendarsystemethiopian.cpp:82 3719 #, kde-format 3720 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3721 msgid "G" 3722 msgstr "" 3723 3724 #: kdecore/kcalendarsystemethiopian.cpp:84 3725 #, kde-format 3726 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3727 msgid "S" 3728 msgstr "" 3729 3730 #: kdecore/kcalendarsystemethiopian.cpp:86 3731 #, kde-format 3732 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3733 msgid "H" 3734 msgstr "" 3735 3736 #: kdecore/kcalendarsystemethiopian.cpp:88 3737 #, kde-format 3738 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3739 msgid "N" 3740 msgstr "" 3741 3742 #: kdecore/kcalendarsystemethiopian.cpp:90 3743 #, kde-format 3744 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3745 msgid "P" 3746 msgstr "" 3747 3748 #: kdecore/kcalendarsystemethiopian.cpp:99 3749 #, fuzzy, kde-format 3750 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3751 msgid "of Mes" 3752 msgstr "bagi Meh" 3753 3754 #: kdecore/kcalendarsystemethiopian.cpp:101 3755 #, fuzzy, kde-format 3756 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3757 msgid "of Teq" 3758 msgstr "bagi Tevet" 3759 3760 #: kdecore/kcalendarsystemethiopian.cpp:103 3761 #, fuzzy, kde-format 3762 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3763 msgid "of Hed" 3764 msgstr "Februari" 3765 3766 #: kdecore/kcalendarsystemethiopian.cpp:105 3767 #, fuzzy, kde-format 3768 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3769 msgid "of Tah" 3770 msgstr "bagi Bah" 3771 3772 #: kdecore/kcalendarsystemethiopian.cpp:107 3773 #, fuzzy, kde-format 3774 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3775 msgid "of Ter" 3776 msgstr "bagi Tir" 3777 3778 #: kdecore/kcalendarsystemethiopian.cpp:109 3779 #, fuzzy, kde-format 3780 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3781 msgid "of Yak" 3782 msgstr "Januari" 3783 3784 #: kdecore/kcalendarsystemethiopian.cpp:111 3785 #, fuzzy, kde-format 3786 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3787 msgid "of Mag" 3788 msgstr "Mac" 3789 3790 #: kdecore/kcalendarsystemethiopian.cpp:113 3791 #, fuzzy, kde-format 3792 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3793 msgid "of Miy" 3794 msgstr "Mei" 3795 3796 #: kdecore/kcalendarsystemethiopian.cpp:115 3797 #, fuzzy, kde-format 3798 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3799 msgid "of Gen" 3800 msgstr "Januari" 3801 3802 #: kdecore/kcalendarsystemethiopian.cpp:117 3803 #, fuzzy, kde-format 3804 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3805 msgid "of Sen" 3806 msgstr "September" 3807 3808 #: kdecore/kcalendarsystemethiopian.cpp:119 3809 #, fuzzy, kde-format 3810 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3811 msgid "of Ham" 3812 msgstr "bagi Tamuz" 3813 3814 #: kdecore/kcalendarsystemethiopian.cpp:121 3815 #, fuzzy, kde-format 3816 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3817 msgid "of Neh" 3818 msgstr "bagi Meh" 3819 3820 #: kdecore/kcalendarsystemethiopian.cpp:123 3821 #, fuzzy, kde-format 3822 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3823 msgid "of Pag" 3824 msgstr "bagi Tamuz" 3825 3826 #: kdecore/kcalendarsystemethiopian.cpp:132 3827 #, fuzzy, kde-format 3828 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3829 msgid "Mes" 3830 msgstr "Ya" 3831 3832 #: kdecore/kcalendarsystemethiopian.cpp:134 3833 #, fuzzy, kde-format 3834 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3835 msgid "Teq" 3836 msgstr "Sel" 3837 3838 #: kdecore/kcalendarsystemethiopian.cpp:136 3839 #, fuzzy, kde-format 3840 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3841 msgid "Hed" 3842 msgstr "Rab" 3843 3844 #: kdecore/kcalendarsystemethiopian.cpp:138 3845 #, fuzzy, kde-format 3846 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3847 msgid "Tah" 3848 msgstr "Sel" 3849 3850 #: kdecore/kcalendarsystemethiopian.cpp:140 3851 #, fuzzy, kde-format 3852 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3853 msgid "Ter" 3854 msgstr "Sel" 3855 3856 #: kdecore/kcalendarsystemethiopian.cpp:142 3857 #, fuzzy, kde-format 3858 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3859 msgid "Yak" 3860 msgstr "Januari" 3861 3862 #: kdecore/kcalendarsystemethiopian.cpp:144 3863 #, fuzzy, kde-format 3864 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3865 msgid "Mag" 3866 msgstr "Mac" 3867 3868 #: kdecore/kcalendarsystemethiopian.cpp:146 3869 #, fuzzy, kde-format 3870 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3871 msgid "Miy" 3872 msgstr "Mei" 3873 3874 #: kdecore/kcalendarsystemethiopian.cpp:148 3875 #, fuzzy, kde-format 3876 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3877 msgid "Gen" 3878 msgstr "Hijau:" 3879 3880 #: kdecore/kcalendarsystemethiopian.cpp:150 3881 #, fuzzy, kde-format 3882 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3883 msgid "Sen" 3884 msgstr "Hanta&r" 3885 3886 #: kdecore/kcalendarsystemethiopian.cpp:152 3887 #, fuzzy, kde-format 3888 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3889 msgid "Ham" 3890 msgstr "Ham" 3891 3892 #: kdecore/kcalendarsystemethiopian.cpp:154 3893 #, fuzzy, kde-format 3894 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3895 msgid "Neh" 3896 msgstr "Meh" 3897 3898 #: kdecore/kcalendarsystemethiopian.cpp:156 3899 #, fuzzy, kde-format 3900 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3901 msgid "Pag" 3902 msgstr "Halaman" 3903 3904 #: kdecore/kcalendarsystemethiopian.cpp:165 3905 #, fuzzy, kde-format 3906 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3907 msgid "of Meskerem" 3908 msgstr "bagi Mehr" 3909 3910 #: kdecore/kcalendarsystemethiopian.cpp:167 3911 #, fuzzy, kde-format 3912 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3913 msgid "of Tequemt" 3914 msgstr "bagi Tevet" 3915 3916 #: kdecore/kcalendarsystemethiopian.cpp:169 3917 #, fuzzy, kde-format 3918 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3919 msgid "of Hedar" 3920 msgstr "bagi Adar" 3921 3922 #: kdecore/kcalendarsystemethiopian.cpp:171 3923 #, fuzzy, kde-format 3924 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3925 msgid "of Tahsas" 3926 msgstr "bagi Bahman" 3927 3928 #: kdecore/kcalendarsystemethiopian.cpp:173 3929 #, fuzzy, kde-format 3930 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3931 msgid "of Ter" 3932 msgstr "bagi Tir" 3933 3934 #: kdecore/kcalendarsystemethiopian.cpp:175 3935 #, fuzzy, kde-format 3936 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3937 msgid "of Yakatit" 3938 msgstr "bagi Far" 3939 3940 #: kdecore/kcalendarsystemethiopian.cpp:177 3941 #, fuzzy, kde-format 3942 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3943 msgid "of Magabit" 3944 msgstr "Rejab" 3945 3946 #: kdecore/kcalendarsystemethiopian.cpp:179 3947 #, fuzzy, kde-format 3948 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3949 msgid "of Miyazya" 3950 msgstr "Mei" 3951 3952 #: kdecore/kcalendarsystemethiopian.cpp:181 3953 #, fuzzy, kde-format 3954 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3955 msgid "of Genbot" 3956 msgstr "Februari" 3957 3958 #: kdecore/kcalendarsystemethiopian.cpp:183 3959 #, fuzzy, kde-format 3960 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3961 msgid "of Sene" 3962 msgstr "September" 3963 3964 #: kdecore/kcalendarsystemethiopian.cpp:185 3965 #, fuzzy, kde-format 3966 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3967 msgid "of Hamle" 3968 msgstr "bagi Tamuz" 3969 3970 #: kdecore/kcalendarsystemethiopian.cpp:187 3971 #, fuzzy, kde-format 3972 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3973 msgid "of Nehase" 3974 msgstr "bagi Sha" 3975 3976 #: kdecore/kcalendarsystemethiopian.cpp:189 3977 #, fuzzy, kde-format 3978 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3979 msgid "of Pagumen" 3980 msgstr "bagi Tamuz" 3981 3982 #: kdecore/kcalendarsystemethiopian.cpp:198 3983 #, fuzzy, kde-format 3984 msgctxt "Ethiopian month 1 - KLocale::LongName" 3985 msgid "Meskerem" 3986 msgstr "bagi Mehr" 3987 3988 #: kdecore/kcalendarsystemethiopian.cpp:200 3989 #, fuzzy, kde-format 3990 msgctxt "Ethiopian month 2 - KLocale::LongName" 3991 msgid "Tequemt" 3992 msgstr "Tevet" 3993 3994 #: kdecore/kcalendarsystemethiopian.cpp:202 3995 #, fuzzy, kde-format 3996 msgctxt "Ethiopian month 3 - KLocale::LongName" 3997 msgid "Hedar" 3998 msgstr "Adar" 3999 4000 #: kdecore/kcalendarsystemethiopian.cpp:204 4001 #, fuzzy, kde-format 4002 msgctxt "Ethiopian month 4 - KLocale::LongName" 4003 msgid "Tahsas" 4004 msgstr "Tugas" 4005 4006 #: kdecore/kcalendarsystemethiopian.cpp:206 4007 #, fuzzy, kde-format 4008 msgctxt "Ethiopian month 5 - KLocale::LongName" 4009 msgid "Ter" 4010 msgstr "Sel" 4011 4012 #: kdecore/kcalendarsystemethiopian.cpp:208 4013 #, fuzzy, kde-format 4014 msgctxt "Ethiopian month 6 - KLocale::LongName" 4015 msgid "Yakatit" 4016 msgstr "bagi Far" 4017 4018 #: kdecore/kcalendarsystemethiopian.cpp:210 4019 #, fuzzy, kde-format 4020 msgctxt "Ethiopian month 7 - KLocale::LongName" 4021 msgid "Magabit" 4022 msgstr "Rejab" 4023 4024 #: kdecore/kcalendarsystemethiopian.cpp:212 4025 #, fuzzy, kde-format 4026 msgctxt "Ethiopian month 8 - KLocale::LongName" 4027 msgid "Miyazya" 4028 msgstr "Mei" 4029 4030 #: kdecore/kcalendarsystemethiopian.cpp:214 4031 #, fuzzy, kde-format 4032 msgctxt "Ethiopian month 9 - KLocale::LongName" 4033 msgid "Genbot" 4034 msgstr "Februari" 4035 4036 #: kdecore/kcalendarsystemethiopian.cpp:216 4037 #, fuzzy, kde-format 4038 msgctxt "Ethiopian month 10 - KLocale::LongName" 4039 msgid "Sene" 4040 msgstr "Hanta&r" 4041 4042 #: kdecore/kcalendarsystemethiopian.cpp:218 4043 #, fuzzy, kde-format 4044 msgctxt "Ethiopian month 11 - KLocale::LongName" 4045 msgid "Hamle" 4046 msgstr "Nama" 4047 4048 #: kdecore/kcalendarsystemethiopian.cpp:220 4049 #, fuzzy, kde-format 4050 msgctxt "Ethiopian month 12 - KLocale::LongName" 4051 msgid "Nehase" 4052 msgstr "Nama" 4053 4054 #: kdecore/kcalendarsystemethiopian.cpp:222 4055 #, fuzzy, kde-format 4056 msgctxt "Ethiopian month 13 - KLocale::LongName" 4057 msgid "Pagumen" 4058 msgstr "Halaman" 4059 4060 #: kdecore/kcalendarsystemethiopian.cpp:236 4061 #, kde-format 4062 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 4063 msgid "S" 4064 msgstr "" 4065 4066 #: kdecore/kcalendarsystemethiopian.cpp:238 4067 #, kde-format 4068 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 4069 msgid "M" 4070 msgstr "" 4071 4072 #: kdecore/kcalendarsystemethiopian.cpp:240 4073 #, kde-format 4074 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 4075 msgid "R" 4076 msgstr "" 4077 4078 #: kdecore/kcalendarsystemethiopian.cpp:242 4079 #, kde-format 4080 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 4081 msgid "H" 4082 msgstr "" 4083 4084 #: kdecore/kcalendarsystemethiopian.cpp:244 4085 #, fuzzy, kde-format 4086 #| msgid "Av" 4087 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 4088 msgid "A" 4089 msgstr "Av" 4090 4091 #: kdecore/kcalendarsystemethiopian.cpp:246 4092 #, kde-format 4093 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 4094 msgid "Q" 4095 msgstr "" 4096 4097 #: kdecore/kcalendarsystemethiopian.cpp:248 4098 #, kde-format 4099 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 4100 msgid "E" 4101 msgstr "" 4102 4103 #: kdecore/kcalendarsystemethiopian.cpp:257 4104 #, fuzzy, kde-format 4105 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 4106 msgid "Seg" 4107 msgstr "Sep" 4108 4109 #: kdecore/kcalendarsystemethiopian.cpp:259 4110 #, fuzzy, kde-format 4111 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 4112 msgid "Mak" 4113 msgstr "Mac" 4114 4115 #: kdecore/kcalendarsystemethiopian.cpp:261 4116 #, fuzzy, kde-format 4117 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 4118 msgid "Rob" 4119 msgstr "Tugas" 4120 4121 #: kdecore/kcalendarsystemethiopian.cpp:263 4122 #, fuzzy, kde-format 4123 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 4124 msgid "Ham" 4125 msgstr "Ham" 4126 4127 #: kdecore/kcalendarsystemethiopian.cpp:265 4128 #, fuzzy, kde-format 4129 #| msgid "Arb" 4130 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 4131 msgid "Arb" 4132 msgstr "Rab" 4133 4134 #: kdecore/kcalendarsystemethiopian.cpp:267 4135 #, fuzzy, kde-format 4136 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 4137 msgid "Qed" 4138 msgstr "Rab" 4139 4140 #: kdecore/kcalendarsystemethiopian.cpp:269 4141 #, fuzzy, kde-format 4142 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 4143 msgid "Ehu" 4144 msgstr "Kha" 4145 4146 #: kdecore/kcalendarsystemethiopian.cpp:276 4147 #, fuzzy, kde-format 4148 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 4149 msgid "Segno" 4150 msgstr "Hanta&r" 4151 4152 #: kdecore/kcalendarsystemethiopian.cpp:278 4153 #, fuzzy, kde-format 4154 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 4155 msgid "Maksegno" 4156 msgstr "Hanta&r" 4157 4158 #: kdecore/kcalendarsystemethiopian.cpp:280 4159 #, fuzzy, kde-format 4160 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 4161 msgid "Rob" 4162 msgstr "Tugas" 4163 4164 #: kdecore/kcalendarsystemethiopian.cpp:282 4165 #, fuzzy, kde-format 4166 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 4167 msgid "Hamus" 4168 msgstr "Jeda" 4169 4170 #: kdecore/kcalendarsystemethiopian.cpp:284 4171 #, fuzzy, kde-format 4172 #| msgid "Arb" 4173 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 4174 msgid "Arb" 4175 msgstr "Rab" 4176 4177 #: kdecore/kcalendarsystemethiopian.cpp:286 4178 #, fuzzy, kde-format 4179 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 4180 msgid "Qedame" 4181 msgstr "Nama" 4182 4183 #: kdecore/kcalendarsystemethiopian.cpp:288 4184 #, fuzzy, kde-format 4185 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 4186 msgid "Ehud" 4187 msgstr "Kha" 4188 4189 #: kdecore/kcalendarsystemgregorian.cpp:53 4190 #, kde-format 4191 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 4192 msgid "Before Common Era" 4193 msgstr "" 4194 4195 #: kdecore/kcalendarsystemgregorian.cpp:54 4196 #, kde-format 4197 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 4198 msgid "BCE" 4199 msgstr "" 4200 4201 #: kdecore/kcalendarsystemgregorian.cpp:56 4202 #, kde-format 4203 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 4204 msgid "Before Christ" 4205 msgstr "" 4206 4207 #: kdecore/kcalendarsystemgregorian.cpp:57 4208 #, kde-format 4209 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 4210 msgid "BC" 4211 msgstr "" 4212 4213 #: kdecore/kcalendarsystemgregorian.cpp:59 4214 #, kde-format 4215 msgctxt "" 4216 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 4217 msgid "%Ey %EC" 4218 msgstr "" 4219 4220 #: kdecore/kcalendarsystemgregorian.cpp:63 4221 #, kde-format 4222 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 4223 msgid "Common Era" 4224 msgstr "" 4225 4226 #: kdecore/kcalendarsystemgregorian.cpp:64 4227 #, kde-format 4228 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 4229 msgid "CE" 4230 msgstr "" 4231 4232 #: kdecore/kcalendarsystemgregorian.cpp:66 4233 #: kdecore/kcalendarsystemjapanese.cpp:57 4234 #, kde-format 4235 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 4236 msgid "Anno Domini" 4237 msgstr "" 4238 4239 #: kdecore/kcalendarsystemgregorian.cpp:67 4240 #: kdecore/kcalendarsystemjapanese.cpp:58 4241 #, kde-format 4242 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 4243 msgid "AD" 4244 msgstr "" 4245 4246 #: kdecore/kcalendarsystemgregorian.cpp:69 4247 #: kdecore/kcalendarsystemjapanese.cpp:59 4248 #, kde-format 4249 msgctxt "" 4250 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 4251 msgid "%Ey %EC" 4252 msgstr "" 4253 4254 #: kdecore/kcalendarsystemgregorian.cpp:138 4255 #, kde-format 4256 msgctxt "Gregorian month 1 - KLocale::NarrowName" 4257 msgid "J" 4258 msgstr "" 4259 4260 #: kdecore/kcalendarsystemgregorian.cpp:140 4261 #, kde-format 4262 msgctxt "Gregorian month 2 - KLocale::NarrowName" 4263 msgid "F" 4264 msgstr "" 4265 4266 #: kdecore/kcalendarsystemgregorian.cpp:142 4267 #, kde-format 4268 msgctxt "Gregorian month 3 - KLocale::NarrowName" 4269 msgid "M" 4270 msgstr "" 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:144 4273 #, fuzzy, kde-format 4274 #| msgid "Av" 4275 msgctxt "Gregorian month 4 - KLocale::NarrowName" 4276 msgid "A" 4277 msgstr "Av" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:146 4280 #, kde-format 4281 msgctxt "Gregorian month 5 - KLocale::NarrowName" 4282 msgid "M" 4283 msgstr "" 4284 4285 #: kdecore/kcalendarsystemgregorian.cpp:148 4286 #, kde-format 4287 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4288 msgid "J" 4289 msgstr "" 4290 4291 #: kdecore/kcalendarsystemgregorian.cpp:150 4292 #, kde-format 4293 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4294 msgid "J" 4295 msgstr "" 4296 4297 #: kdecore/kcalendarsystemgregorian.cpp:152 4298 #, fuzzy, kde-format 4299 #| msgid "Av" 4300 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4301 msgid "A" 4302 msgstr "Av" 4303 4304 #: kdecore/kcalendarsystemgregorian.cpp:154 4305 #, kde-format 4306 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4307 msgid "S" 4308 msgstr "" 4309 4310 #: kdecore/kcalendarsystemgregorian.cpp:156 4311 #, kde-format 4312 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4313 msgid "O" 4314 msgstr "" 4315 4316 #: kdecore/kcalendarsystemgregorian.cpp:158 4317 #, kde-format 4318 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4319 msgid "N" 4320 msgstr "" 4321 4322 #: kdecore/kcalendarsystemgregorian.cpp:160 4323 #, kde-format 4324 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4325 msgid "D" 4326 msgstr "" 4327 4328 #: kdecore/kcalendarsystemgregorian.cpp:169 4329 #, fuzzy, kde-format 4330 #| msgctxt "of January" 4331 #| msgid "of Jan" 4332 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4333 msgid "of Jan" 4334 msgstr "Januari" 4335 4336 #: kdecore/kcalendarsystemgregorian.cpp:171 4337 #, fuzzy, kde-format 4338 #| msgctxt "of February" 4339 #| msgid "of Feb" 4340 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4341 msgid "of Feb" 4342 msgstr "Februari" 4343 4344 #: kdecore/kcalendarsystemgregorian.cpp:173 4345 #, fuzzy, kde-format 4346 #| msgctxt "of March" 4347 #| msgid "of Mar" 4348 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4349 msgid "of Mar" 4350 msgstr "Mac" 4351 4352 #: kdecore/kcalendarsystemgregorian.cpp:175 4353 #, fuzzy, kde-format 4354 #| msgctxt "of April" 4355 #| msgid "of Apr" 4356 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4357 msgid "of Apr" 4358 msgstr "April" 4359 4360 #: kdecore/kcalendarsystemgregorian.cpp:177 4361 #, fuzzy, kde-format 4362 #| msgctxt "of May short" 4363 #| msgid "of May" 4364 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4365 msgid "of May" 4366 msgstr "Mei" 4367 4368 #: kdecore/kcalendarsystemgregorian.cpp:179 4369 #, fuzzy, kde-format 4370 #| msgctxt "of June" 4371 #| msgid "of Jun" 4372 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4373 msgid "of Jun" 4374 msgstr "Jun" 4375 4376 #: kdecore/kcalendarsystemgregorian.cpp:181 4377 #, fuzzy, kde-format 4378 #| msgctxt "of July" 4379 #| msgid "of Jul" 4380 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4381 msgid "of Jul" 4382 msgstr "Julai" 4383 4384 #: kdecore/kcalendarsystemgregorian.cpp:183 4385 #, fuzzy, kde-format 4386 #| msgctxt "of August" 4387 #| msgid "of Aug" 4388 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4389 msgid "of Aug" 4390 msgstr "Ogos" 4391 4392 #: kdecore/kcalendarsystemgregorian.cpp:185 4393 #, fuzzy, kde-format 4394 #| msgctxt "of September" 4395 #| msgid "of Sep" 4396 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4397 msgid "of Sep" 4398 msgstr "September" 4399 4400 #: kdecore/kcalendarsystemgregorian.cpp:187 4401 #, fuzzy, kde-format 4402 #| msgctxt "of October" 4403 #| msgid "of Oct" 4404 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4405 msgid "of Oct" 4406 msgstr "Oktober" 4407 4408 #: kdecore/kcalendarsystemgregorian.cpp:189 4409 #, fuzzy, kde-format 4410 #| msgctxt "of November" 4411 #| msgid "of Nov" 4412 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4413 msgid "of Nov" 4414 msgstr "November" 4415 4416 #: kdecore/kcalendarsystemgregorian.cpp:191 4417 #, fuzzy, kde-format 4418 #| msgctxt "of December" 4419 #| msgid "of Dec" 4420 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4421 msgid "of Dec" 4422 msgstr "Disember" 4423 4424 #: kdecore/kcalendarsystemgregorian.cpp:200 4425 #, fuzzy, kde-format 4426 #| msgctxt "January" 4427 #| msgid "Jan" 4428 msgctxt "Gregorian month 1 - KLocale::ShortName" 4429 msgid "Jan" 4430 msgstr "Jan" 4431 4432 #: kdecore/kcalendarsystemgregorian.cpp:202 4433 #, fuzzy, kde-format 4434 #| msgctxt "February" 4435 #| msgid "Feb" 4436 msgctxt "Gregorian month 2 - KLocale::ShortName" 4437 msgid "Feb" 4438 msgstr "Feb" 4439 4440 #: kdecore/kcalendarsystemgregorian.cpp:204 4441 #, fuzzy, kde-format 4442 #| msgctxt "March" 4443 #| msgid "Mar" 4444 msgctxt "Gregorian month 3 - KLocale::ShortName" 4445 msgid "Mar" 4446 msgstr "Mac" 4447 4448 #: kdecore/kcalendarsystemgregorian.cpp:206 4449 #, fuzzy, kde-format 4450 #| msgctxt "April" 4451 #| msgid "Apr" 4452 msgctxt "Gregorian month 4 - KLocale::ShortName" 4453 msgid "Apr" 4454 msgstr "Apr" 4455 4456 #: kdecore/kcalendarsystemgregorian.cpp:208 4457 #, fuzzy, kde-format 4458 #| msgctxt "May short" 4459 #| msgid "May" 4460 msgctxt "Gregorian month 5 - KLocale::ShortName" 4461 msgid "May" 4462 msgstr "Mei" 4463 4464 #: kdecore/kcalendarsystemgregorian.cpp:210 4465 #, fuzzy, kde-format 4466 #| msgctxt "June" 4467 #| msgid "Jun" 4468 msgctxt "Gregorian month 6 - KLocale::ShortName" 4469 msgid "Jun" 4470 msgstr "Jun" 4471 4472 #: kdecore/kcalendarsystemgregorian.cpp:212 4473 #, fuzzy, kde-format 4474 #| msgctxt "July" 4475 #| msgid "Jul" 4476 msgctxt "Gregorian month 7 - KLocale::ShortName" 4477 msgid "Jul" 4478 msgstr "Jul" 4479 4480 #: kdecore/kcalendarsystemgregorian.cpp:214 4481 #, fuzzy, kde-format 4482 #| msgctxt "August" 4483 #| msgid "Aug" 4484 msgctxt "Gregorian month 8 - KLocale::ShortName" 4485 msgid "Aug" 4486 msgstr "Ogo" 4487 4488 #: kdecore/kcalendarsystemgregorian.cpp:216 4489 #, fuzzy, kde-format 4490 #| msgctxt "September" 4491 #| msgid "Sep" 4492 msgctxt "Gregorian month 9 - KLocale::ShortName" 4493 msgid "Sep" 4494 msgstr "Sep" 4495 4496 #: kdecore/kcalendarsystemgregorian.cpp:218 4497 #, fuzzy, kde-format 4498 #| msgctxt "October" 4499 #| msgid "Oct" 4500 msgctxt "Gregorian month 10 - KLocale::ShortName" 4501 msgid "Oct" 4502 msgstr "Okt" 4503 4504 #: kdecore/kcalendarsystemgregorian.cpp:220 4505 #, fuzzy, kde-format 4506 #| msgctxt "November" 4507 #| msgid "Nov" 4508 msgctxt "Gregorian month 11 - KLocale::ShortName" 4509 msgid "Nov" 4510 msgstr "Nov" 4511 4512 #: kdecore/kcalendarsystemgregorian.cpp:222 4513 #, fuzzy, kde-format 4514 #| msgctxt "December" 4515 #| msgid "Dec" 4516 msgctxt "Gregorian month 12 - KLocale::ShortName" 4517 msgid "Dec" 4518 msgstr "Dis" 4519 4520 #: kdecore/kcalendarsystemgregorian.cpp:231 4521 #, fuzzy, kde-format 4522 #| msgid "of January" 4523 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4524 msgid "of January" 4525 msgstr "dari Jan" 4526 4527 #: kdecore/kcalendarsystemgregorian.cpp:233 4528 #, fuzzy, kde-format 4529 #| msgid "of February" 4530 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4531 msgid "of February" 4532 msgstr "dari Februari" 4533 4534 #: kdecore/kcalendarsystemgregorian.cpp:235 4535 #, fuzzy, kde-format 4536 #| msgid "of March" 4537 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4538 msgid "of March" 4539 msgstr "dari Mac" 4540 4541 #: kdecore/kcalendarsystemgregorian.cpp:237 4542 #, fuzzy, kde-format 4543 #| msgid "of April" 4544 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4545 msgid "of April" 4546 msgstr "dari April" 4547 4548 #: kdecore/kcalendarsystemgregorian.cpp:239 4549 #, fuzzy, kde-format 4550 #| msgctxt "of May short" 4551 #| msgid "of May" 4552 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4553 msgid "of May" 4554 msgstr "Mei" 4555 4556 #: kdecore/kcalendarsystemgregorian.cpp:241 4557 #, fuzzy, kde-format 4558 #| msgid "of June" 4559 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4560 msgid "of June" 4561 msgstr "dari Jun" 4562 4563 #: kdecore/kcalendarsystemgregorian.cpp:243 4564 #, fuzzy, kde-format 4565 #| msgid "of July" 4566 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4567 msgid "of July" 4568 msgstr "dari Julai" 4569 4570 #: kdecore/kcalendarsystemgregorian.cpp:245 4571 #, fuzzy, kde-format 4572 #| msgid "of August" 4573 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4574 msgid "of August" 4575 msgstr "dari Ogos" 4576 4577 #: kdecore/kcalendarsystemgregorian.cpp:247 4578 #, fuzzy, kde-format 4579 #| msgid "of September" 4580 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4581 msgid "of September" 4582 msgstr "dari September" 4583 4584 #: kdecore/kcalendarsystemgregorian.cpp:249 4585 #, fuzzy, kde-format 4586 #| msgid "of October" 4587 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4588 msgid "of October" 4589 msgstr "dari Oktober" 4590 4591 #: kdecore/kcalendarsystemgregorian.cpp:251 4592 #, fuzzy, kde-format 4593 #| msgid "of November" 4594 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4595 msgid "of November" 4596 msgstr "dari November" 4597 4598 #: kdecore/kcalendarsystemgregorian.cpp:253 4599 #, fuzzy, kde-format 4600 #| msgid "of December" 4601 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4602 msgid "of December" 4603 msgstr "dari Disember" 4604 4605 #: kdecore/kcalendarsystemgregorian.cpp:262 4606 #, fuzzy, kde-format 4607 #| msgid "January" 4608 msgctxt "Gregorian month 1 - KLocale::LongName" 4609 msgid "January" 4610 msgstr "Januari" 4611 4612 #: kdecore/kcalendarsystemgregorian.cpp:264 4613 #, fuzzy, kde-format 4614 #| msgid "February" 4615 msgctxt "Gregorian month 2 - KLocale::LongName" 4616 msgid "February" 4617 msgstr "Februari" 4618 4619 #: kdecore/kcalendarsystemgregorian.cpp:266 4620 #, fuzzy, kde-format 4621 #| msgctxt "March long" 4622 #| msgid "March" 4623 msgctxt "Gregorian month 3 - KLocale::LongName" 4624 msgid "March" 4625 msgstr "Mac" 4626 4627 #: kdecore/kcalendarsystemgregorian.cpp:268 4628 #, fuzzy, kde-format 4629 #| msgid "April" 4630 msgctxt "Gregorian month 4 - KLocale::LongName" 4631 msgid "April" 4632 msgstr "April" 4633 4634 #: kdecore/kcalendarsystemgregorian.cpp:270 4635 #, fuzzy, kde-format 4636 #| msgctxt "May short" 4637 #| msgid "May" 4638 msgctxt "Gregorian month 5 - KLocale::LongName" 4639 msgid "May" 4640 msgstr "Mei" 4641 4642 #: kdecore/kcalendarsystemgregorian.cpp:272 4643 #, fuzzy, kde-format 4644 #| msgid "June" 4645 msgctxt "Gregorian month 6 - KLocale::LongName" 4646 msgid "June" 4647 msgstr "Jun" 4648 4649 #: kdecore/kcalendarsystemgregorian.cpp:274 4650 #, fuzzy, kde-format 4651 #| msgid "July" 4652 msgctxt "Gregorian month 7 - KLocale::LongName" 4653 msgid "July" 4654 msgstr "Julai" 4655 4656 #: kdecore/kcalendarsystemgregorian.cpp:276 4657 #, fuzzy, kde-format 4658 #| msgctxt "August long" 4659 #| msgid "August" 4660 msgctxt "Gregorian month 8 - KLocale::LongName" 4661 msgid "August" 4662 msgstr "Ogos" 4663 4664 #: kdecore/kcalendarsystemgregorian.cpp:278 4665 #, fuzzy, kde-format 4666 #| msgid "September" 4667 msgctxt "Gregorian month 9 - KLocale::LongName" 4668 msgid "September" 4669 msgstr "September" 4670 4671 #: kdecore/kcalendarsystemgregorian.cpp:280 4672 #, fuzzy, kde-format 4673 #| msgid "October" 4674 msgctxt "Gregorian month 10 - KLocale::LongName" 4675 msgid "October" 4676 msgstr "Oktober" 4677 4678 #: kdecore/kcalendarsystemgregorian.cpp:282 4679 #, fuzzy, kde-format 4680 #| msgid "November" 4681 msgctxt "Gregorian month 11 - KLocale::LongName" 4682 msgid "November" 4683 msgstr "November" 4684 4685 #: kdecore/kcalendarsystemgregorian.cpp:284 4686 #, fuzzy, kde-format 4687 #| msgid "December" 4688 msgctxt "Gregorian month 12 - KLocale::LongName" 4689 msgid "December" 4690 msgstr "Disember" 4691 4692 #: kdecore/kcalendarsystemgregorian.cpp:297 4693 #: kdecore/kcalendarsystemhebrew.cpp:807 4694 #, kde-format 4695 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4696 msgid "M" 4697 msgstr "" 4698 4699 #: kdecore/kcalendarsystemgregorian.cpp:299 4700 #: kdecore/kcalendarsystemhebrew.cpp:809 4701 #, kde-format 4702 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4703 msgid "T" 4704 msgstr "" 4705 4706 #: kdecore/kcalendarsystemgregorian.cpp:301 4707 #: kdecore/kcalendarsystemhebrew.cpp:811 4708 #, kde-format 4709 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4710 msgid "W" 4711 msgstr "" 4712 4713 #: kdecore/kcalendarsystemgregorian.cpp:303 4714 #: kdecore/kcalendarsystemhebrew.cpp:813 4715 #, kde-format 4716 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4717 msgid "T" 4718 msgstr "" 4719 4720 #: kdecore/kcalendarsystemgregorian.cpp:305 4721 #: kdecore/kcalendarsystemhebrew.cpp:815 4722 #, kde-format 4723 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4724 msgid "F" 4725 msgstr "" 4726 4727 #: kdecore/kcalendarsystemgregorian.cpp:307 4728 #: kdecore/kcalendarsystemhebrew.cpp:817 4729 #, kde-format 4730 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4731 msgid "S" 4732 msgstr "" 4733 4734 #: kdecore/kcalendarsystemgregorian.cpp:309 4735 #: kdecore/kcalendarsystemhebrew.cpp:819 4736 #, kde-format 4737 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4738 msgid "S" 4739 msgstr "" 4740 4741 #: kdecore/kcalendarsystemgregorian.cpp:318 4742 #: kdecore/kcalendarsystemhebrew.cpp:828 4743 #, fuzzy, kde-format 4744 #| msgctxt "Monday" 4745 #| msgid "Mon" 4746 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4747 msgid "Mon" 4748 msgstr "Isn" 4749 4750 #: kdecore/kcalendarsystemgregorian.cpp:320 4751 #: kdecore/kcalendarsystemhebrew.cpp:830 4752 #, fuzzy, kde-format 4753 #| msgctxt "Tuesday" 4754 #| msgid "Tue" 4755 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4756 msgid "Tue" 4757 msgstr "Sel" 4758 4759 #: kdecore/kcalendarsystemgregorian.cpp:322 4760 #: kdecore/kcalendarsystemhebrew.cpp:832 4761 #, fuzzy, kde-format 4762 #| msgctxt "Wednesday" 4763 #| msgid "Wed" 4764 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4765 msgid "Wed" 4766 msgstr "Rab" 4767 4768 #: kdecore/kcalendarsystemgregorian.cpp:324 4769 #: kdecore/kcalendarsystemhebrew.cpp:834 4770 #, fuzzy, kde-format 4771 #| msgctxt "Thursday" 4772 #| msgid "Thu" 4773 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4774 msgid "Thu" 4775 msgstr "Kha" 4776 4777 #: kdecore/kcalendarsystemgregorian.cpp:326 4778 #: kdecore/kcalendarsystemhebrew.cpp:836 4779 #, fuzzy, kde-format 4780 #| msgctxt "Friday" 4781 #| msgid "Fri" 4782 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4783 msgid "Fri" 4784 msgstr "Jum" 4785 4786 #: kdecore/kcalendarsystemgregorian.cpp:328 4787 #: kdecore/kcalendarsystemhebrew.cpp:838 4788 #, fuzzy, kde-format 4789 #| msgctxt "Saturday" 4790 #| msgid "Sat" 4791 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4792 msgid "Sat" 4793 msgstr "Sab" 4794 4795 #: kdecore/kcalendarsystemgregorian.cpp:330 4796 #: kdecore/kcalendarsystemhebrew.cpp:840 4797 #, fuzzy, kde-format 4798 #| msgctxt "Sunday" 4799 #| msgid "Sun" 4800 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4801 msgid "Sun" 4802 msgstr "Aha" 4803 4804 #: kdecore/kcalendarsystemgregorian.cpp:337 4805 #: kdecore/kcalendarsystemhebrew.cpp:847 4806 #, fuzzy, kde-format 4807 #| msgid "Monday" 4808 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4809 msgid "Monday" 4810 msgstr "Isnin" 4811 4812 #: kdecore/kcalendarsystemgregorian.cpp:339 4813 #: kdecore/kcalendarsystemhebrew.cpp:849 4814 #, fuzzy, kde-format 4815 #| msgid "Tuesday" 4816 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4817 msgid "Tuesday" 4818 msgstr "Selasa" 4819 4820 #: kdecore/kcalendarsystemgregorian.cpp:341 4821 #: kdecore/kcalendarsystemhebrew.cpp:851 4822 #, fuzzy, kde-format 4823 #| msgid "Wednesday" 4824 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4825 msgid "Wednesday" 4826 msgstr "Rabu" 4827 4828 #: kdecore/kcalendarsystemgregorian.cpp:343 4829 #: kdecore/kcalendarsystemhebrew.cpp:853 4830 #, fuzzy, kde-format 4831 #| msgid "Thursday" 4832 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4833 msgid "Thursday" 4834 msgstr "Khamis" 4835 4836 #: kdecore/kcalendarsystemgregorian.cpp:345 4837 #: kdecore/kcalendarsystemhebrew.cpp:855 4838 #, fuzzy, kde-format 4839 #| msgid "Friday" 4840 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4841 msgid "Friday" 4842 msgstr "Jumaat" 4843 4844 #: kdecore/kcalendarsystemgregorian.cpp:347 4845 #: kdecore/kcalendarsystemhebrew.cpp:857 4846 #, fuzzy, kde-format 4847 #| msgid "Saturday" 4848 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4849 msgid "Saturday" 4850 msgstr "Sabtu" 4851 4852 #: kdecore/kcalendarsystemgregorian.cpp:349 4853 #: kdecore/kcalendarsystemhebrew.cpp:859 4854 #, fuzzy, kde-format 4855 #| msgid "Sunday" 4856 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4857 msgid "Sunday" 4858 msgstr "Ahad" 4859 4860 #: kdecore/kcalendarsystemhebrew.cpp:281 4861 #, kde-format 4862 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4863 msgid "Anno Mundi" 4864 msgstr "" 4865 4866 #: kdecore/kcalendarsystemhebrew.cpp:282 4867 #, kde-format 4868 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4869 msgid "AM" 4870 msgstr "" 4871 4872 #: kdecore/kcalendarsystemhebrew.cpp:283 4873 #, kde-format 4874 msgctxt "" 4875 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4876 msgid "%Ey %EC" 4877 msgstr "" 4878 4879 #: kdecore/kcalendarsystemhebrew.cpp:625 4880 #, kde-format 4881 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4882 msgid "T" 4883 msgstr "" 4884 4885 #: kdecore/kcalendarsystemhebrew.cpp:627 4886 #, kde-format 4887 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4888 msgid "H" 4889 msgstr "" 4890 4891 #: kdecore/kcalendarsystemhebrew.cpp:629 4892 #, kde-format 4893 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4894 msgid "K" 4895 msgstr "" 4896 4897 #: kdecore/kcalendarsystemhebrew.cpp:631 4898 #, kde-format 4899 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4900 msgid "T" 4901 msgstr "" 4902 4903 #: kdecore/kcalendarsystemhebrew.cpp:633 4904 #, kde-format 4905 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4906 msgid "S" 4907 msgstr "" 4908 4909 #: kdecore/kcalendarsystemhebrew.cpp:635 4910 #, fuzzy, kde-format 4911 #| msgid "Av" 4912 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4913 msgid "A" 4914 msgstr "Av" 4915 4916 #: kdecore/kcalendarsystemhebrew.cpp:637 4917 #, kde-format 4918 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4919 msgid "N" 4920 msgstr "" 4921 4922 #: kdecore/kcalendarsystemhebrew.cpp:639 4923 #, kde-format 4924 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4925 msgid "I" 4926 msgstr "" 4927 4928 #: kdecore/kcalendarsystemhebrew.cpp:641 4929 #, kde-format 4930 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4931 msgid "S" 4932 msgstr "" 4933 4934 #: kdecore/kcalendarsystemhebrew.cpp:643 4935 #, kde-format 4936 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4937 msgid "T" 4938 msgstr "" 4939 4940 #: kdecore/kcalendarsystemhebrew.cpp:645 4941 #, fuzzy, kde-format 4942 #| msgid "Av" 4943 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4944 msgid "A" 4945 msgstr "Av" 4946 4947 #: kdecore/kcalendarsystemhebrew.cpp:647 4948 #, kde-format 4949 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4950 msgid "E" 4951 msgstr "" 4952 4953 #: kdecore/kcalendarsystemhebrew.cpp:649 4954 #, fuzzy, kde-format 4955 #| msgid "Av" 4956 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4957 msgid "A" 4958 msgstr "Av" 4959 4960 #: kdecore/kcalendarsystemhebrew.cpp:651 4961 #, fuzzy, kde-format 4962 #| msgid "Av" 4963 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4964 msgid "A" 4965 msgstr "Av" 4966 4967 #: kdecore/kcalendarsystemhebrew.cpp:660 4968 #, fuzzy, kde-format 4969 #| msgctxt "of Tir short" 4970 #| msgid "of Tir" 4971 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4972 msgid "of Tis" 4973 msgstr "bagi Tir" 4974 4975 #: kdecore/kcalendarsystemhebrew.cpp:662 4976 #, fuzzy, kde-format 4977 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4978 msgid "of Hes" 4979 msgstr "bagi Meh" 4980 4981 #: kdecore/kcalendarsystemhebrew.cpp:664 4982 #, fuzzy, kde-format 4983 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4984 msgid "of Kis" 4985 msgstr "bagi Nisan" 4986 4987 #: kdecore/kcalendarsystemhebrew.cpp:666 4988 #, fuzzy, kde-format 4989 #| msgid "of Tevet" 4990 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4991 msgid "of Tev" 4992 msgstr "bagi Tevet" 4993 4994 #: kdecore/kcalendarsystemhebrew.cpp:668 4995 #, fuzzy, kde-format 4996 #| msgid "of Shvat" 4997 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4998 msgid "of Shv" 4999 msgstr "bagi Shvat" 5000 5001 #: kdecore/kcalendarsystemhebrew.cpp:670 5002 #, fuzzy, kde-format 5003 #| msgid "of Adar" 5004 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 5005 msgid "of Ada" 5006 msgstr "bagi Adar" 5007 5008 #: kdecore/kcalendarsystemhebrew.cpp:672 5009 #, fuzzy, kde-format 5010 #| msgid "of Nisan" 5011 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 5012 msgid "of Nis" 5013 msgstr "bagi Nisan" 5014 5015 #: kdecore/kcalendarsystemhebrew.cpp:674 5016 #, fuzzy, kde-format 5017 #| msgid "of Iyar" 5018 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 5019 msgid "of Iya" 5020 msgstr "bagi Iyar" 5021 5022 #: kdecore/kcalendarsystemhebrew.cpp:676 5023 #, fuzzy, kde-format 5024 #| msgid "of Sivan" 5025 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 5026 msgid "of Siv" 5027 msgstr "bagi Sivan" 5028 5029 #: kdecore/kcalendarsystemhebrew.cpp:678 5030 #, fuzzy, kde-format 5031 #| msgid "of Tamuz" 5032 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 5033 msgid "of Tam" 5034 msgstr "bagi Tamuz" 5035 5036 #: kdecore/kcalendarsystemhebrew.cpp:680 5037 #, fuzzy, kde-format 5038 #| msgid "of Av" 5039 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 5040 msgid "of Av" 5041 msgstr "bagi Av" 5042 5043 #: kdecore/kcalendarsystemhebrew.cpp:682 5044 #, fuzzy, kde-format 5045 #| msgid "of Elul" 5046 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 5047 msgid "of Elu" 5048 msgstr "bagi Elul" 5049 5050 #: kdecore/kcalendarsystemhebrew.cpp:684 5051 #, fuzzy, kde-format 5052 #| msgid "of Adar" 5053 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 5054 msgid "of Ad1" 5055 msgstr "bagi Adar" 5056 5057 #: kdecore/kcalendarsystemhebrew.cpp:686 5058 #, fuzzy, kde-format 5059 #| msgid "of Adar" 5060 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 5061 msgid "of Ad2" 5062 msgstr "bagi Adar" 5063 5064 #: kdecore/kcalendarsystemhebrew.cpp:695 5065 #, fuzzy, kde-format 5066 #| msgctxt "Tir short" 5067 #| msgid "Tir" 5068 msgctxt "Hebrew month 1 - KLocale::ShortName" 5069 msgid "Tis" 5070 msgstr "Tir" 5071 5072 #: kdecore/kcalendarsystemhebrew.cpp:697 5073 #, fuzzy, kde-format 5074 msgctxt "Hebrew month 2 - KLocale::ShortName" 5075 msgid "Hes" 5076 msgstr "Ya" 5077 5078 #: kdecore/kcalendarsystemhebrew.cpp:699 5079 #, fuzzy, kde-format 5080 #| msgid "Kislev" 5081 msgctxt "Hebrew month 3 - KLocale::ShortName" 5082 msgid "Kis" 5083 msgstr "Kislev" 5084 5085 #: kdecore/kcalendarsystemhebrew.cpp:701 5086 #, fuzzy, kde-format 5087 #| msgid "Tevet" 5088 msgctxt "Hebrew month 4 - KLocale::ShortName" 5089 msgid "Tev" 5090 msgstr "Tevet" 5091 5092 #: kdecore/kcalendarsystemhebrew.cpp:703 5093 #, fuzzy, kde-format 5094 #| msgid "Shvat" 5095 msgctxt "Hebrew month 5 - KLocale::ShortName" 5096 msgid "Shv" 5097 msgstr "Shvat" 5098 5099 #: kdecore/kcalendarsystemhebrew.cpp:705 5100 #, fuzzy, kde-format 5101 #| msgid "Adar" 5102 msgctxt "Hebrew month 6 - KLocale::ShortName" 5103 msgid "Ada" 5104 msgstr "Adar" 5105 5106 #: kdecore/kcalendarsystemhebrew.cpp:707 5107 #, fuzzy, kde-format 5108 #| msgid "Nisan" 5109 msgctxt "Hebrew month 7 - KLocale::ShortName" 5110 msgid "Nis" 5111 msgstr "Nisan" 5112 5113 #: kdecore/kcalendarsystemhebrew.cpp:709 5114 #, fuzzy, kde-format 5115 #| msgid "Iyar" 5116 msgctxt "Hebrew month 8 - KLocale::ShortName" 5117 msgid "Iya" 5118 msgstr "Iyar" 5119 5120 #: kdecore/kcalendarsystemhebrew.cpp:711 5121 #, fuzzy, kde-format 5122 #| msgid "Sivan" 5123 msgctxt "Hebrew month 9 - KLocale::ShortName" 5124 msgid "Siv" 5125 msgstr "Sivan" 5126 5127 #: kdecore/kcalendarsystemhebrew.cpp:713 5128 #, fuzzy, kde-format 5129 #| msgid "Tamuz" 5130 msgctxt "Hebrew month 10 - KLocale::ShortName" 5131 msgid "Tam" 5132 msgstr "Tamuz" 5133 5134 #: kdecore/kcalendarsystemhebrew.cpp:715 5135 #, fuzzy, kde-format 5136 #| msgid "Av" 5137 msgctxt "Hebrew month 11 - KLocale::ShortName" 5138 msgid "Av" 5139 msgstr "Av" 5140 5141 #: kdecore/kcalendarsystemhebrew.cpp:717 5142 #, fuzzy, kde-format 5143 #| msgid "Elul" 5144 msgctxt "Hebrew month 12 - KLocale::ShortName" 5145 msgid "Elu" 5146 msgstr "Elul" 5147 5148 #: kdecore/kcalendarsystemhebrew.cpp:719 5149 #, fuzzy, kde-format 5150 #| msgid "Ahd" 5151 msgctxt "Hebrew month 13 - KLocale::ShortName" 5152 msgid "Ad1" 5153 msgstr "Ahd" 5154 5155 #: kdecore/kcalendarsystemhebrew.cpp:721 5156 #, fuzzy, kde-format 5157 #| msgid "Ahd" 5158 msgctxt "Hebrew month 14 - KLocale::ShortName" 5159 msgid "Ad2" 5160 msgstr "Ahd" 5161 5162 #: kdecore/kcalendarsystemhebrew.cpp:730 5163 #, fuzzy, kde-format 5164 #| msgid "of Tishrey" 5165 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 5166 msgid "of Tishrey" 5167 msgstr "bagi Tishrey" 5168 5169 #: kdecore/kcalendarsystemhebrew.cpp:732 5170 #, fuzzy, kde-format 5171 #| msgid "of Heshvan" 5172 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 5173 msgid "of Heshvan" 5174 msgstr "bagi Heshvan" 5175 5176 #: kdecore/kcalendarsystemhebrew.cpp:734 5177 #, fuzzy, kde-format 5178 #| msgid "of Kislev" 5179 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 5180 msgid "of Kislev" 5181 msgstr "bagi Kislev" 5182 5183 #: kdecore/kcalendarsystemhebrew.cpp:736 5184 #, fuzzy, kde-format 5185 #| msgid "of Tevet" 5186 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 5187 msgid "of Tevet" 5188 msgstr "bagi Tevet" 5189 5190 #: kdecore/kcalendarsystemhebrew.cpp:738 5191 #, fuzzy, kde-format 5192 #| msgid "of Shvat" 5193 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 5194 msgid "of Shvat" 5195 msgstr "bagi Shvat" 5196 5197 #: kdecore/kcalendarsystemhebrew.cpp:740 5198 #, fuzzy, kde-format 5199 #| msgid "of Adar" 5200 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 5201 msgid "of Adar" 5202 msgstr "bagi Adar" 5203 5204 #: kdecore/kcalendarsystemhebrew.cpp:742 5205 #, fuzzy, kde-format 5206 #| msgid "of Nisan" 5207 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 5208 msgid "of Nisan" 5209 msgstr "bagi Nisan" 5210 5211 #: kdecore/kcalendarsystemhebrew.cpp:744 5212 #, fuzzy, kde-format 5213 #| msgid "of Iyar" 5214 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 5215 msgid "of Iyar" 5216 msgstr "bagi Iyar" 5217 5218 #: kdecore/kcalendarsystemhebrew.cpp:746 5219 #, fuzzy, kde-format 5220 #| msgid "of Sivan" 5221 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 5222 msgid "of Sivan" 5223 msgstr "bagi Sivan" 5224 5225 #: kdecore/kcalendarsystemhebrew.cpp:748 5226 #, fuzzy, kde-format 5227 #| msgid "of Tamuz" 5228 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 5229 msgid "of Tamuz" 5230 msgstr "bagi Tamuz" 5231 5232 #: kdecore/kcalendarsystemhebrew.cpp:750 5233 #, fuzzy, kde-format 5234 #| msgid "of Av" 5235 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 5236 msgid "of Av" 5237 msgstr "bagi Av" 5238 5239 #: kdecore/kcalendarsystemhebrew.cpp:752 5240 #, fuzzy, kde-format 5241 #| msgid "of Elul" 5242 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 5243 msgid "of Elul" 5244 msgstr "bagi Elul" 5245 5246 #: kdecore/kcalendarsystemhebrew.cpp:754 5247 #, fuzzy, kde-format 5248 #| msgid "of Adar I" 5249 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 5250 msgid "of Adar I" 5251 msgstr "bagi Adar I" 5252 5253 #: kdecore/kcalendarsystemhebrew.cpp:756 5254 #, fuzzy, kde-format 5255 #| msgid "of Adar II" 5256 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 5257 msgid "of Adar II" 5258 msgstr "bagi Adar II" 5259 5260 #: kdecore/kcalendarsystemhebrew.cpp:765 5261 #, fuzzy, kde-format 5262 #| msgid "Tishrey" 5263 msgctxt "Hebrew month 1 - KLocale::LongName" 5264 msgid "Tishrey" 5265 msgstr "Tishrey" 5266 5267 #: kdecore/kcalendarsystemhebrew.cpp:767 5268 #, fuzzy, kde-format 5269 #| msgid "Heshvan" 5270 msgctxt "Hebrew month 2 - KLocale::LongName" 5271 msgid "Heshvan" 5272 msgstr "Heshvan" 5273 5274 #: kdecore/kcalendarsystemhebrew.cpp:769 5275 #, fuzzy, kde-format 5276 #| msgid "Kislev" 5277 msgctxt "Hebrew month 3 - KLocale::LongName" 5278 msgid "Kislev" 5279 msgstr "Kislev" 5280 5281 #: kdecore/kcalendarsystemhebrew.cpp:771 5282 #, fuzzy, kde-format 5283 #| msgid "Tevet" 5284 msgctxt "Hebrew month 4 - KLocale::LongName" 5285 msgid "Tevet" 5286 msgstr "Tevet" 5287 5288 #: kdecore/kcalendarsystemhebrew.cpp:773 5289 #, fuzzy, kde-format 5290 #| msgid "Shvat" 5291 msgctxt "Hebrew month 5 - KLocale::LongName" 5292 msgid "Shvat" 5293 msgstr "Shvat" 5294 5295 #: kdecore/kcalendarsystemhebrew.cpp:775 5296 #, fuzzy, kde-format 5297 #| msgid "Adar" 5298 msgctxt "Hebrew month 6 - KLocale::LongName" 5299 msgid "Adar" 5300 msgstr "Adar" 5301 5302 #: kdecore/kcalendarsystemhebrew.cpp:777 5303 #, fuzzy, kde-format 5304 #| msgid "Nisan" 5305 msgctxt "Hebrew month 7 - KLocale::LongName" 5306 msgid "Nisan" 5307 msgstr "Nisan" 5308 5309 #: kdecore/kcalendarsystemhebrew.cpp:779 5310 #, fuzzy, kde-format 5311 #| msgid "Iyar" 5312 msgctxt "Hebrew month 8 - KLocale::LongName" 5313 msgid "Iyar" 5314 msgstr "Iyar" 5315 5316 #: kdecore/kcalendarsystemhebrew.cpp:781 5317 #, fuzzy, kde-format 5318 #| msgid "Sivan" 5319 msgctxt "Hebrew month 9 - KLocale::LongName" 5320 msgid "Sivan" 5321 msgstr "Sivan" 5322 5323 #: kdecore/kcalendarsystemhebrew.cpp:783 5324 #, fuzzy, kde-format 5325 #| msgid "Tamuz" 5326 msgctxt "Hebrew month 10 - KLocale::LongName" 5327 msgid "Tamuz" 5328 msgstr "Tamuz" 5329 5330 #: kdecore/kcalendarsystemhebrew.cpp:785 5331 #, fuzzy, kde-format 5332 #| msgid "Av" 5333 msgctxt "Hebrew month 11 - KLocale::LongName" 5334 msgid "Av" 5335 msgstr "Av" 5336 5337 #: kdecore/kcalendarsystemhebrew.cpp:787 5338 #, fuzzy, kde-format 5339 #| msgid "Elul" 5340 msgctxt "Hebrew month 12 - KLocale::LongName" 5341 msgid "Elul" 5342 msgstr "Elul" 5343 5344 #: kdecore/kcalendarsystemhebrew.cpp:789 5345 #, fuzzy, kde-format 5346 #| msgid "Adar I" 5347 msgctxt "Hebrew month 13 - KLocale::LongName" 5348 msgid "Adar I" 5349 msgstr "Adar I" 5350 5351 #: kdecore/kcalendarsystemhebrew.cpp:791 5352 #, fuzzy, kde-format 5353 #| msgid "Adar II" 5354 msgctxt "Hebrew month 14 - KLocale::LongName" 5355 msgid "Adar II" 5356 msgstr "Adar II" 5357 5358 #: kdecore/kcalendarsystemindiannational.cpp:66 5359 #, fuzzy, kde-format 5360 #| msgid "Safar" 5361 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5362 msgid "Saka Era" 5363 msgstr "Safar" 5364 5365 #: kdecore/kcalendarsystemindiannational.cpp:67 5366 #, kde-format 5367 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5368 msgid "SE" 5369 msgstr "" 5370 5371 #: kdecore/kcalendarsystemindiannational.cpp:68 5372 #, kde-format 5373 msgctxt "" 5374 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5375 "2000 SE" 5376 msgid "%Ey %EC" 5377 msgstr "" 5378 5379 #: kdecore/kcalendarsystemindiannational.cpp:158 5380 #, kde-format 5381 msgctxt "Indian National month 1 - KLocale::NarrowName" 5382 msgid "C" 5383 msgstr "" 5384 5385 #: kdecore/kcalendarsystemindiannational.cpp:160 5386 #, kde-format 5387 msgctxt "Indian National month 2 - KLocale::NarrowName" 5388 msgid "V" 5389 msgstr "" 5390 5391 #: kdecore/kcalendarsystemindiannational.cpp:162 5392 #, kde-format 5393 msgctxt "Indian National month 3 - KLocale::NarrowName" 5394 msgid "J" 5395 msgstr "" 5396 5397 #: kdecore/kcalendarsystemindiannational.cpp:164 5398 #, fuzzy, kde-format 5399 msgctxt "Indian National month 4 - KLocale::NarrowName" 5400 msgid "Ā" 5401 msgstr "bagi Āsh" 5402 5403 #: kdecore/kcalendarsystemindiannational.cpp:166 5404 #, kde-format 5405 msgctxt "Indian National month 5 - KLocale::NarrowName" 5406 msgid "S" 5407 msgstr "" 5408 5409 #: kdecore/kcalendarsystemindiannational.cpp:168 5410 #, kde-format 5411 msgctxt "Indian National month 6 - KLocale::NarrowName" 5412 msgid "B" 5413 msgstr "" 5414 5415 #: kdecore/kcalendarsystemindiannational.cpp:170 5416 #, fuzzy, kde-format 5417 msgctxt "Indian National month 7 - KLocale::NarrowName" 5418 msgid "Ā" 5419 msgstr "bagi Āsh" 5420 5421 #: kdecore/kcalendarsystemindiannational.cpp:172 5422 #, kde-format 5423 msgctxt "Indian National month 8 - KLocale::NarrowName" 5424 msgid "K" 5425 msgstr "" 5426 5427 #: kdecore/kcalendarsystemindiannational.cpp:174 5428 #, fuzzy, kde-format 5429 #| msgid "Av" 5430 msgctxt "Indian National month 9 - KLocale::NarrowName" 5431 msgid "A" 5432 msgstr "Av" 5433 5434 #: kdecore/kcalendarsystemindiannational.cpp:176 5435 #, kde-format 5436 msgctxt "Indian National month 10 - KLocale::NarrowName" 5437 msgid "P" 5438 msgstr "" 5439 5440 #: kdecore/kcalendarsystemindiannational.cpp:178 5441 #, kde-format 5442 msgctxt "Indian National month 11 - KLocale::NarrowName" 5443 msgid "M" 5444 msgstr "" 5445 5446 #: kdecore/kcalendarsystemindiannational.cpp:180 5447 #, kde-format 5448 msgctxt "Indian National month 12 - KLocale::NarrowName" 5449 msgid "P" 5450 msgstr "" 5451 5452 #: kdecore/kcalendarsystemindiannational.cpp:189 5453 #, fuzzy, kde-format 5454 #| msgctxt "Indian National month 1 - ShortNamePossessive" 5455 #| msgid "of Cha" 5456 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5457 msgid "of Cha" 5458 msgstr "bagi Cha" 5459 5460 #: kdecore/kcalendarsystemindiannational.cpp:191 5461 #, fuzzy, kde-format 5462 #| msgctxt "Indian National month 2 - ShortNamePossessive" 5463 #| msgid "of Vai" 5464 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5465 msgid "of Vai" 5466 msgstr "bagi Vai" 5467 5468 #: kdecore/kcalendarsystemindiannational.cpp:193 5469 #, fuzzy, kde-format 5470 #| msgctxt "Indian National month 3 - ShortNamePossessive" 5471 #| msgid "of Jya" 5472 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5473 msgid "of Jya" 5474 msgstr "bagi Jya" 5475 5476 #: kdecore/kcalendarsystemindiannational.cpp:195 5477 #, fuzzy, kde-format 5478 #| msgctxt "Indian National month 4 - ShortNamePossessive" 5479 #| msgid "of Āsh" 5480 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5481 msgid "of Āsh" 5482 msgstr "bagi Āsh" 5483 5484 #: kdecore/kcalendarsystemindiannational.cpp:197 5485 #, fuzzy, kde-format 5486 #| msgctxt "Indian National month 5 - ShortNamePossessive" 5487 #| msgid "of Shr" 5488 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5489 msgid "of Shr" 5490 msgstr "bagi Shr" 5491 5492 #: kdecore/kcalendarsystemindiannational.cpp:199 5493 #, fuzzy, kde-format 5494 #| msgctxt "Indian National month 6 - ShortNamePossessive" 5495 #| msgid "of Bhā" 5496 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5497 msgid "of Bhā" 5498 msgstr "bagi Bhā" 5499 5500 #: kdecore/kcalendarsystemindiannational.cpp:201 5501 #, fuzzy, kde-format 5502 #| msgctxt "Indian National month 7 - ShortNamePossessive" 5503 #| msgid "of Āsw" 5504 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5505 msgid "of Āsw" 5506 msgstr "bagi Āsw" 5507 5508 #: kdecore/kcalendarsystemindiannational.cpp:203 5509 #, fuzzy, kde-format 5510 #| msgctxt "Indian National month 8 - ShortNamePossessive" 5511 #| msgid "of Kār" 5512 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5513 msgid "of Kār" 5514 msgstr "bagi Kār" 5515 5516 #: kdecore/kcalendarsystemindiannational.cpp:205 5517 #, fuzzy, kde-format 5518 #| msgctxt "Indian National month 9 - ShortNamePossessive" 5519 #| msgid "of Agr" 5520 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5521 msgid "of Agr" 5522 msgstr "bagi Agr" 5523 5524 #: kdecore/kcalendarsystemindiannational.cpp:207 5525 #, fuzzy, kde-format 5526 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5527 msgid "of Pau" 5528 msgstr "bagi Tamuz" 5529 5530 #: kdecore/kcalendarsystemindiannational.cpp:209 5531 #, fuzzy, kde-format 5532 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5533 msgid "of Māg" 5534 msgstr "bagi Mor" 5535 5536 #: kdecore/kcalendarsystemindiannational.cpp:211 5537 #, fuzzy, kde-format 5538 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5539 msgid "of Phā" 5540 msgstr "bagi Kho" 5541 5542 #: kdecore/kcalendarsystemindiannational.cpp:220 5543 #, fuzzy, kde-format 5544 msgctxt "Indian National month 1 - KLocale::ShortName" 5545 msgid "Cha" 5546 msgstr "Kha" 5547 5548 #: kdecore/kcalendarsystemindiannational.cpp:222 5549 #, fuzzy, kde-format 5550 msgctxt "Indian National month 2 - KLocale::ShortName" 5551 msgid "Vai" 5552 msgstr "bagi Far" 5553 5554 #: kdecore/kcalendarsystemindiannational.cpp:224 5555 #, fuzzy, kde-format 5556 msgctxt "Indian National month 3 - KLocale::ShortName" 5557 msgid "Jya" 5558 msgstr "Jan" 5559 5560 #: kdecore/kcalendarsystemindiannational.cpp:226 5561 #, fuzzy, kde-format 5562 msgctxt "Indian National month 4 - KLocale::ShortName" 5563 msgid "Āsh" 5564 msgstr "bagi Āsh" 5565 5566 #: kdecore/kcalendarsystemindiannational.cpp:228 5567 #, fuzzy, kde-format 5568 msgctxt "Indian National month 5 - KLocale::ShortName" 5569 msgid "Shr" 5570 msgstr "Sha" 5571 5572 #: kdecore/kcalendarsystemindiannational.cpp:230 5573 #, fuzzy, kde-format 5574 msgctxt "Indian National month 6 - KLocale::ShortName" 5575 msgid "Bhā" 5576 msgstr "bagi Bhā" 5577 5578 #: kdecore/kcalendarsystemindiannational.cpp:232 5579 #, fuzzy, kde-format 5580 msgctxt "Indian National month 7 - KLocale::ShortName" 5581 msgid "Āsw" 5582 msgstr "bagi Āsw" 5583 5584 #: kdecore/kcalendarsystemindiannational.cpp:234 5585 #, fuzzy, kde-format 5586 msgctxt "Indian National month 8 - KLocale::ShortName" 5587 msgid "Kār" 5588 msgstr "bagi Kār" 5589 5590 #: kdecore/kcalendarsystemindiannational.cpp:236 5591 #, fuzzy, kde-format 5592 msgctxt "Indian National month 9 - KLocale::ShortName" 5593 msgid "Agr" 5594 msgstr "Rab" 5595 5596 #: kdecore/kcalendarsystemindiannational.cpp:238 5597 #, fuzzy, kde-format 5598 msgctxt "Indian National month 10 - KLocale::ShortName" 5599 msgid "Pau" 5600 msgstr "Jeda" 5601 5602 #: kdecore/kcalendarsystemindiannational.cpp:240 5603 #, fuzzy, kde-format 5604 msgctxt "Indian National month 11 - KLocale::ShortName" 5605 msgid "Māg" 5606 msgstr "bagi Mor" 5607 5608 #: kdecore/kcalendarsystemindiannational.cpp:242 5609 #, fuzzy, kde-format 5610 msgctxt "Indian National month 12 - KLocale::ShortName" 5611 msgid "Phā" 5612 msgstr "bagi Kho" 5613 5614 #: kdecore/kcalendarsystemindiannational.cpp:251 5615 #, fuzzy, kde-format 5616 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5617 msgid "of Chaitra" 5618 msgstr "Muharam" 5619 5620 #: kdecore/kcalendarsystemindiannational.cpp:253 5621 #, fuzzy, kde-format 5622 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5623 msgid "of Vaishākh" 5624 msgstr "bagi Vai" 5625 5626 #: kdecore/kcalendarsystemindiannational.cpp:255 5627 #, fuzzy, kde-format 5628 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5629 msgid "of Jyaishtha" 5630 msgstr "bagi Nisan" 5631 5632 #: kdecore/kcalendarsystemindiannational.cpp:257 5633 #, fuzzy, kde-format 5634 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5635 msgid "of Āshādha" 5636 msgstr "bagi Āsh" 5637 5638 #: kdecore/kcalendarsystemindiannational.cpp:259 5639 #, fuzzy, kde-format 5640 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5641 msgid "of Shrāvana" 5642 msgstr "bagi Shvat" 5643 5644 #: kdecore/kcalendarsystemindiannational.cpp:261 5645 #, fuzzy, kde-format 5646 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5647 msgid "of Bhādrapad" 5648 msgstr "bagi Khordad" 5649 5650 #: kdecore/kcalendarsystemindiannational.cpp:263 5651 #, fuzzy, kde-format 5652 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5653 msgid "of Āshwin" 5654 msgstr "bagi Heshvan" 5655 5656 #: kdecore/kcalendarsystemindiannational.cpp:265 5657 #, fuzzy, kde-format 5658 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5659 msgid "of Kārtik" 5660 msgstr "bagi Kār" 5661 5662 #: kdecore/kcalendarsystemindiannational.cpp:267 5663 #, fuzzy, kde-format 5664 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5665 msgid "of Agrahayana" 5666 msgstr "bagi Bahman" 5667 5668 #: kdecore/kcalendarsystemindiannational.cpp:269 5669 #, fuzzy, kde-format 5670 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5671 msgid "of Paush" 5672 msgstr "bagi Bah" 5673 5674 #: kdecore/kcalendarsystemindiannational.cpp:271 5675 #, fuzzy, kde-format 5676 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5677 msgid "of Māgh" 5678 msgstr "bagi Meh" 5679 5680 #: kdecore/kcalendarsystemindiannational.cpp:273 5681 #, fuzzy, kde-format 5682 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5683 msgid "of Phālgun" 5684 msgstr "bagi Kho" 5685 5686 #: kdecore/kcalendarsystemindiannational.cpp:282 5687 #, fuzzy, kde-format 5688 msgctxt "Indian National month 1 - KLocale::LongName" 5689 msgid "Chaitra" 5690 msgstr "Muharam" 5691 5692 #: kdecore/kcalendarsystemindiannational.cpp:284 5693 #, fuzzy, kde-format 5694 msgctxt "Indian National month 2 - KLocale::LongName" 5695 msgid "Vaishākh" 5696 msgstr "bagi Vai" 5697 5698 #: kdecore/kcalendarsystemindiannational.cpp:286 5699 #, fuzzy, kde-format 5700 msgctxt "Indian National month 3 - KLocale::LongName" 5701 msgid "Jyaishtha" 5702 msgstr "bagi Nisan" 5703 5704 #: kdecore/kcalendarsystemindiannational.cpp:288 5705 #, fuzzy, kde-format 5706 msgctxt "Indian National month 4 - KLocale::LongName" 5707 msgid "Āshādha" 5708 msgstr "bagi Āsh" 5709 5710 #: kdecore/kcalendarsystemindiannational.cpp:290 5711 #, fuzzy, kde-format 5712 msgctxt "Indian National month 5 - KLocale::LongName" 5713 msgid "Shrāvana" 5714 msgstr "bagi Shvat" 5715 5716 #: kdecore/kcalendarsystemindiannational.cpp:292 5717 #, fuzzy, kde-format 5718 msgctxt "Indian National month 6 - KLocale::LongName" 5719 msgid "Bhādrapad" 5720 msgstr "bagi Khordad" 5721 5722 #: kdecore/kcalendarsystemindiannational.cpp:294 5723 #, fuzzy, kde-format 5724 msgctxt "Indian National month 7 - KLocale::LongName" 5725 msgid "Āshwin" 5726 msgstr "bagi Heshvan" 5727 5728 #: kdecore/kcalendarsystemindiannational.cpp:296 5729 #, fuzzy, kde-format 5730 msgctxt "Indian National month 8 - KLocale::LongName" 5731 msgid "Kārtik" 5732 msgstr "bagi Kār" 5733 5734 #: kdecore/kcalendarsystemindiannational.cpp:298 5735 #, fuzzy, kde-format 5736 msgctxt "Indian National month 9 - KLocale::LongName" 5737 msgid "Agrahayana" 5738 msgstr "Thaana" 5739 5740 #: kdecore/kcalendarsystemindiannational.cpp:300 5741 #, fuzzy, kde-format 5742 msgctxt "Indian National month 10 - KLocale::LongName" 5743 msgid "Paush" 5744 msgstr "Jeda" 5745 5746 #: kdecore/kcalendarsystemindiannational.cpp:302 5747 #, fuzzy, kde-format 5748 msgctxt "Indian National month 11 - KLocale::LongName" 5749 msgid "Māgh" 5750 msgstr "bagi Meh" 5751 5752 #: kdecore/kcalendarsystemindiannational.cpp:304 5753 #, fuzzy, kde-format 5754 msgctxt "Indian National month 12 - KLocale::LongName" 5755 msgid "Phālgun" 5756 msgstr "bagi Kho" 5757 5758 #: kdecore/kcalendarsystemindiannational.cpp:317 5759 #, kde-format 5760 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5761 msgid "S" 5762 msgstr "" 5763 5764 #: kdecore/kcalendarsystemindiannational.cpp:319 5765 #, kde-format 5766 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5767 msgid "M" 5768 msgstr "" 5769 5770 #: kdecore/kcalendarsystemindiannational.cpp:321 5771 #, kde-format 5772 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5773 msgid "B" 5774 msgstr "" 5775 5776 #: kdecore/kcalendarsystemindiannational.cpp:323 5777 #, kde-format 5778 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5779 msgid "G" 5780 msgstr "" 5781 5782 #: kdecore/kcalendarsystemindiannational.cpp:325 5783 #, kde-format 5784 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5785 msgid "S" 5786 msgstr "" 5787 5788 #: kdecore/kcalendarsystemindiannational.cpp:327 5789 #, kde-format 5790 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5791 msgid "S" 5792 msgstr "" 5793 5794 #: kdecore/kcalendarsystemindiannational.cpp:329 5795 #, kde-format 5796 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5797 msgid "R" 5798 msgstr "" 5799 5800 #: kdecore/kcalendarsystemindiannational.cpp:338 5801 #, fuzzy, kde-format 5802 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5803 msgid "Som" 5804 msgstr "Som" 5805 5806 #: kdecore/kcalendarsystemindiannational.cpp:340 5807 #, kde-format 5808 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5809 msgid "Mañ" 5810 msgstr "" 5811 5812 #: kdecore/kcalendarsystemindiannational.cpp:342 5813 #, fuzzy, kde-format 5814 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5815 msgid "Bud" 5816 msgstr "Buhid" 5817 5818 #: kdecore/kcalendarsystemindiannational.cpp:344 5819 #, kde-format 5820 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5821 msgid "Gur" 5822 msgstr "" 5823 5824 #: kdecore/kcalendarsystemindiannational.cpp:346 5825 #, fuzzy, kde-format 5826 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5827 msgid "Suk" 5828 msgstr "Aha" 5829 5830 #: kdecore/kcalendarsystemindiannational.cpp:348 5831 #, fuzzy, kde-format 5832 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5833 msgid "San" 5834 msgstr "Sivan" 5835 5836 #: kdecore/kcalendarsystemindiannational.cpp:350 5837 #, kde-format 5838 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5839 msgid "Rav" 5840 msgstr "" 5841 5842 #: kdecore/kcalendarsystemindiannational.cpp:357 5843 #, kde-format 5844 msgctxt "Indian National weekday 1 - KLocale::LongName" 5845 msgid "Somavãra" 5846 msgstr "" 5847 5848 #: kdecore/kcalendarsystemindiannational.cpp:359 5849 #, kde-format 5850 msgctxt "Indian National weekday 2 - KLocale::LongName" 5851 msgid "Mañgalvã" 5852 msgstr "" 5853 5854 #: kdecore/kcalendarsystemindiannational.cpp:361 5855 #, kde-format 5856 msgctxt "Indian National weekday 3 - KLocale::LongName" 5857 msgid "Budhavãra" 5858 msgstr "" 5859 5860 #: kdecore/kcalendarsystemindiannational.cpp:363 5861 #, kde-format 5862 msgctxt "Indian National weekday 4 - KLocale::LongName" 5863 msgid "Guruvãra" 5864 msgstr "" 5865 5866 #: kdecore/kcalendarsystemindiannational.cpp:365 5867 #, kde-format 5868 msgctxt "Indian National weekday 5 - KLocale::LongName" 5869 msgid "Sukravãra" 5870 msgstr "" 5871 5872 #: kdecore/kcalendarsystemindiannational.cpp:367 5873 #, kde-format 5874 msgctxt "Indian National weekday 6 - KLocale::LongName" 5875 msgid "Sanivãra" 5876 msgstr "" 5877 5878 #: kdecore/kcalendarsystemindiannational.cpp:369 5879 #, kde-format 5880 msgctxt "Indian National weekday 7 - KLocale::LongName" 5881 msgid "Raviãra" 5882 msgstr "" 5883 5884 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5885 #, kde-format 5886 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5887 msgid "Anno Hegirae" 5888 msgstr "" 5889 5890 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5891 #, kde-format 5892 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5893 msgid "AH" 5894 msgstr "" 5895 5896 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5897 #, kde-format 5898 msgctxt "" 5899 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5900 msgid "%Ey %EC" 5901 msgstr "" 5902 5903 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5904 #, kde-format 5905 msgctxt "Hijri month 1 - KLocale::NarrowName" 5906 msgid "M" 5907 msgstr "" 5908 5909 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5910 #, kde-format 5911 msgctxt "Hijri month 2 - KLocale::NarrowName" 5912 msgid "S" 5913 msgstr "" 5914 5915 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5916 #, fuzzy, kde-format 5917 #| msgid "Av" 5918 msgctxt "Hijri month 3 - KLocale::NarrowName" 5919 msgid "A" 5920 msgstr "Av" 5921 5922 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5923 #, kde-format 5924 msgctxt "Hijri month 4 - KLocale::NarrowName" 5925 msgid "T" 5926 msgstr "" 5927 5928 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5929 #, fuzzy, kde-format 5930 #| msgid "Av" 5931 msgctxt "Hijri month 5 - KLocale::NarrowName" 5932 msgid "A" 5933 msgstr "Av" 5934 5935 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5936 #, kde-format 5937 msgctxt "Hijri month 6 - KLocale::NarrowName" 5938 msgid "T" 5939 msgstr "" 5940 5941 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5942 #, kde-format 5943 msgctxt "Hijri month 7 - KLocale::NarrowName" 5944 msgid "R" 5945 msgstr "" 5946 5947 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5948 #, kde-format 5949 msgctxt "Hijri month 8 - KLocale::NarrowName" 5950 msgid "S" 5951 msgstr "" 5952 5953 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5954 #, kde-format 5955 msgctxt "Hijri month 9 - KLocale::NarrowName" 5956 msgid "R" 5957 msgstr "" 5958 5959 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5960 #, kde-format 5961 msgctxt "Hijri month 10 - KLocale::NarrowName" 5962 msgid "S" 5963 msgstr "" 5964 5965 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5966 #, kde-format 5967 msgctxt "Hijri month 11 - KLocale::NarrowName" 5968 msgid "Q" 5969 msgstr "" 5970 5971 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5972 #, kde-format 5973 msgctxt "Hijri month 12 - KLocale::NarrowName" 5974 msgid "H" 5975 msgstr "" 5976 5977 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5978 #, fuzzy, kde-format 5979 #| msgctxt "of Mehr short" 5980 #| msgid "of Meh" 5981 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5982 msgid "of Muh" 5983 msgstr "bagi Meh" 5984 5985 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5986 #, fuzzy, kde-format 5987 #| msgid "of Safar" 5988 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5989 msgid "of Saf" 5990 msgstr "Safar" 5991 5992 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5993 #, fuzzy, kde-format 5994 #| msgid "of R. Awal" 5995 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5996 msgid "of R.A" 5997 msgstr "R. Awal" 5998 5999 #: kdecore/kcalendarsystemislamiccivil.cpp:203 6000 #, fuzzy, kde-format 6001 #| msgid "of R. Thaani" 6002 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 6003 msgid "of R.T" 6004 msgstr " R. Akhir" 6005 6006 #: kdecore/kcalendarsystemislamiccivil.cpp:205 6007 #, fuzzy, kde-format 6008 #| msgid "of J. Awal" 6009 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 6010 msgid "of J.A" 6011 msgstr "J. Awal" 6012 6013 #: kdecore/kcalendarsystemislamiccivil.cpp:207 6014 #, fuzzy, kde-format 6015 #| msgid "of J. Thaani" 6016 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 6017 msgid "of J.T" 6018 msgstr "J. Akhir" 6019 6020 #: kdecore/kcalendarsystemislamiccivil.cpp:209 6021 #, fuzzy, kde-format 6022 #| msgid "of Rajab" 6023 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 6024 msgid "of Raj" 6025 msgstr "Rejab" 6026 6027 #: kdecore/kcalendarsystemislamiccivil.cpp:211 6028 #, fuzzy, kde-format 6029 #| msgctxt "of Shahrivar short" 6030 #| msgid "of Sha" 6031 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 6032 msgid "of Sha" 6033 msgstr "bagi Sha" 6034 6035 #: kdecore/kcalendarsystemislamiccivil.cpp:213 6036 #, fuzzy, kde-format 6037 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 6038 msgid "of Ram" 6039 msgstr "bagi Tamuz" 6040 6041 #: kdecore/kcalendarsystemislamiccivil.cpp:215 6042 #, fuzzy, kde-format 6043 #| msgctxt "of Shahrivar short" 6044 #| msgid "of Sha" 6045 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 6046 msgid "of Shw" 6047 msgstr "bagi Sha" 6048 6049 #: kdecore/kcalendarsystemislamiccivil.cpp:217 6050 #, fuzzy, kde-format 6051 #| msgid "of Qi`dah" 6052 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 6053 msgid "of Qid" 6054 msgstr "Zulqa'idah" 6055 6056 #: kdecore/kcalendarsystemislamiccivil.cpp:219 6057 #, fuzzy, kde-format 6058 #| msgid "of Hijjah" 6059 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 6060 msgid "of Hij" 6061 msgstr "Zulhijjah" 6062 6063 #: kdecore/kcalendarsystemislamiccivil.cpp:228 6064 #, fuzzy, kde-format 6065 #| msgctxt "Mehr short" 6066 #| msgid "Meh" 6067 msgctxt "Hijri month 1 - KLocale::ShortName" 6068 msgid "Muh" 6069 msgstr "Meh" 6070 6071 #: kdecore/kcalendarsystemislamiccivil.cpp:230 6072 #, fuzzy, kde-format 6073 #| msgid "Safar" 6074 msgctxt "Hijri month 2 - KLocale::ShortName" 6075 msgid "Saf" 6076 msgstr "Safar" 6077 6078 #: kdecore/kcalendarsystemislamiccivil.cpp:232 6079 #, fuzzy, kde-format 6080 #| msgid "R. Awal" 6081 msgctxt "Hijri month 3 - KLocale::ShortName" 6082 msgid "R.A" 6083 msgstr "R. Awal" 6084 6085 #: kdecore/kcalendarsystemislamiccivil.cpp:234 6086 #, kde-format 6087 msgctxt "Hijri month 4 - KLocale::ShortName" 6088 msgid "R.T" 6089 msgstr "" 6090 6091 #: kdecore/kcalendarsystemislamiccivil.cpp:236 6092 #, fuzzy, kde-format 6093 #| msgid "J. Awal" 6094 msgctxt "Hijri month 5 - KLocale::ShortName" 6095 msgid "J.A" 6096 msgstr "J. Awal" 6097 6098 #: kdecore/kcalendarsystemislamiccivil.cpp:238 6099 #, kde-format 6100 msgctxt "Hijri month 6 - KLocale::ShortName" 6101 msgid "J.T" 6102 msgstr "" 6103 6104 #: kdecore/kcalendarsystemislamiccivil.cpp:240 6105 #, fuzzy, kde-format 6106 #| msgid "Rajab" 6107 msgctxt "Hijri month 7 - KLocale::ShortName" 6108 msgid "Raj" 6109 msgstr "Rejab" 6110 6111 #: kdecore/kcalendarsystemislamiccivil.cpp:242 6112 #, fuzzy, kde-format 6113 #| msgctxt "Shahrivar short" 6114 #| msgid "Sha" 6115 msgctxt "Hijri month 8 - KLocale::ShortName" 6116 msgid "Sha" 6117 msgstr "Sha" 6118 6119 #: kdecore/kcalendarsystemislamiccivil.cpp:244 6120 #, fuzzy, kde-format 6121 msgctxt "Hijri month 9 - KLocale::ShortName" 6122 msgid "Ram" 6123 msgstr "am" 6124 6125 #: kdecore/kcalendarsystemislamiccivil.cpp:246 6126 #, fuzzy, kde-format 6127 #| msgctxt "Shahrivar short" 6128 #| msgid "Sha" 6129 msgctxt "Hijri month 10 - KLocale::ShortName" 6130 msgid "Shw" 6131 msgstr "Sha" 6132 6133 #: kdecore/kcalendarsystemislamiccivil.cpp:248 6134 #, fuzzy, kde-format 6135 #| msgid "Qi`dah" 6136 msgctxt "Hijri month 11 - KLocale::ShortName" 6137 msgid "Qid" 6138 msgstr "Zulqai`dah" 6139 6140 #: kdecore/kcalendarsystemislamiccivil.cpp:250 6141 #, fuzzy, kde-format 6142 #| msgctxt "@item Calendar system" 6143 #| msgid "Hijri" 6144 msgctxt "Hijri month 12 - KLocale::ShortName" 6145 msgid "Hij" 6146 msgstr "Hijri" 6147 6148 #: kdecore/kcalendarsystemislamiccivil.cpp:259 6149 #, fuzzy, kde-format 6150 #| msgid "of Muharram" 6151 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 6152 msgid "of Muharram" 6153 msgstr "Muharam" 6154 6155 #: kdecore/kcalendarsystemislamiccivil.cpp:261 6156 #, fuzzy, kde-format 6157 #| msgid "of Safar" 6158 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 6159 msgid "of Safar" 6160 msgstr "Safar" 6161 6162 #: kdecore/kcalendarsystemislamiccivil.cpp:263 6163 #, fuzzy, kde-format 6164 #| msgid "of Rabi` al-Awal" 6165 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 6166 msgid "of Rabi` al-Awal" 6167 msgstr "Rabi'ul Awal" 6168 6169 #: kdecore/kcalendarsystemislamiccivil.cpp:265 6170 #, fuzzy, kde-format 6171 #| msgid "of Rabi` al-Thaani" 6172 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 6173 msgid "of Rabi` al-Thaani" 6174 msgstr "Rabi'ul Akhir" 6175 6176 #: kdecore/kcalendarsystemislamiccivil.cpp:267 6177 #, fuzzy, kde-format 6178 #| msgid "of Jumaada al-Awal" 6179 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 6180 msgid "of Jumaada al-Awal" 6181 msgstr "Jamadil Awal" 6182 6183 #: kdecore/kcalendarsystemislamiccivil.cpp:269 6184 #, fuzzy, kde-format 6185 #| msgid "of Jumaada al-Thaani" 6186 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 6187 msgid "of Jumaada al-Thaani" 6188 msgstr "Jamadil Akhir" 6189 6190 #: kdecore/kcalendarsystemislamiccivil.cpp:271 6191 #, fuzzy, kde-format 6192 #| msgid "of Rajab" 6193 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 6194 msgid "of Rajab" 6195 msgstr "Rejab" 6196 6197 #: kdecore/kcalendarsystemislamiccivil.cpp:273 6198 #, fuzzy, kde-format 6199 #| msgid "of Sha`ban" 6200 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 6201 msgid "of Sha`ban" 6202 msgstr "Sya'ban" 6203 6204 #: kdecore/kcalendarsystemislamiccivil.cpp:275 6205 #, fuzzy, kde-format 6206 #| msgid "of Ramadan" 6207 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 6208 msgid "of Ramadan" 6209 msgstr "Ramadhan" 6210 6211 #: kdecore/kcalendarsystemislamiccivil.cpp:277 6212 #, fuzzy, kde-format 6213 #| msgid "of Shawwal" 6214 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 6215 msgid "of Shawwal" 6216 msgstr "Syawal" 6217 6218 #: kdecore/kcalendarsystemislamiccivil.cpp:279 6219 #, fuzzy, kde-format 6220 #| msgid "of Thu al-Qi`dah" 6221 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 6222 msgid "of Thu al-Qi`dah" 6223 msgstr "Zulqa'idah" 6224 6225 #: kdecore/kcalendarsystemislamiccivil.cpp:281 6226 #, fuzzy, kde-format 6227 #| msgid "of Thu al-Hijjah" 6228 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 6229 msgid "of Thu al-Hijjah" 6230 msgstr "Zulhijjah" 6231 6232 #: kdecore/kcalendarsystemislamiccivil.cpp:290 6233 #, fuzzy, kde-format 6234 #| msgid "Muharram" 6235 msgctxt "Hijri month 1 - KLocale::LongName" 6236 msgid "Muharram" 6237 msgstr "Muharram" 6238 6239 #: kdecore/kcalendarsystemislamiccivil.cpp:292 6240 #, fuzzy, kde-format 6241 #| msgid "Safar" 6242 msgctxt "Hijri month 2 - KLocale::LongName" 6243 msgid "Safar" 6244 msgstr "Safar" 6245 6246 #: kdecore/kcalendarsystemislamiccivil.cpp:294 6247 #, fuzzy, kde-format 6248 #| msgid "Rabi` al-Awal" 6249 msgctxt "Hijri month 3 - KLocale::LongName" 6250 msgid "Rabi` al-Awal" 6251 msgstr "Rabi` ul-Awal" 6252 6253 #: kdecore/kcalendarsystemislamiccivil.cpp:296 6254 #, fuzzy, kde-format 6255 #| msgid "Rabi` al-Thaani" 6256 msgctxt "Hijri month 4 - KLocale::LongName" 6257 msgid "Rabi` al-Thaani" 6258 msgstr "Rabi`ul Akhir" 6259 6260 #: kdecore/kcalendarsystemislamiccivil.cpp:298 6261 #, fuzzy, kde-format 6262 #| msgid "Jumaada al-Awal" 6263 msgctxt "Hijri month 5 - KLocale::LongName" 6264 msgid "Jumaada al-Awal" 6265 msgstr "Jamadil Awal" 6266 6267 #: kdecore/kcalendarsystemislamiccivil.cpp:300 6268 #, fuzzy, kde-format 6269 #| msgid "Jumaada al-Thaani" 6270 msgctxt "Hijri month 6 - KLocale::LongName" 6271 msgid "Jumaada al-Thaani" 6272 msgstr "Jamadilakhir" 6273 6274 #: kdecore/kcalendarsystemislamiccivil.cpp:302 6275 #, fuzzy, kde-format 6276 #| msgid "Rajab" 6277 msgctxt "Hijri month 7 - KLocale::LongName" 6278 msgid "Rajab" 6279 msgstr "Rejab" 6280 6281 #: kdecore/kcalendarsystemislamiccivil.cpp:304 6282 #, fuzzy, kde-format 6283 #| msgid "Sha`ban" 6284 msgctxt "Hijri month 8 - KLocale::LongName" 6285 msgid "Sha`ban" 6286 msgstr "Sya`ban" 6287 6288 #: kdecore/kcalendarsystemislamiccivil.cpp:306 6289 #, fuzzy, kde-format 6290 #| msgid "Ramadan" 6291 msgctxt "Hijri month 9 - KLocale::LongName" 6292 msgid "Ramadan" 6293 msgstr "Ramadhan" 6294 6295 #: kdecore/kcalendarsystemislamiccivil.cpp:308 6296 #, fuzzy, kde-format 6297 #| msgid "Shawwal" 6298 msgctxt "Hijri month 10 - KLocale::LongName" 6299 msgid "Shawwal" 6300 msgstr "Syawal" 6301 6302 #: kdecore/kcalendarsystemislamiccivil.cpp:310 6303 #, fuzzy, kde-format 6304 #| msgid "Thu al-Qi`dah" 6305 msgctxt "Hijri month 11 - KLocale::LongName" 6306 msgid "Thu al-Qi`dah" 6307 msgstr "Zulqa'idah" 6308 6309 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6310 #, fuzzy, kde-format 6311 #| msgid "Thu al-Hijjah" 6312 msgctxt "Hijri month 12 - KLocale::LongName" 6313 msgid "Thu al-Hijjah" 6314 msgstr "Zulhijjah" 6315 6316 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6317 #, kde-format 6318 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6319 msgid "I" 6320 msgstr "" 6321 6322 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6323 #, kde-format 6324 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6325 msgid "T" 6326 msgstr "" 6327 6328 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6329 #, fuzzy, kde-format 6330 #| msgid "Av" 6331 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6332 msgid "A" 6333 msgstr "Av" 6334 6335 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6336 #, kde-format 6337 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6338 msgid "K" 6339 msgstr "" 6340 6341 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6342 #, kde-format 6343 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6344 msgid "J" 6345 msgstr "" 6346 6347 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6348 #, kde-format 6349 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6350 msgid "S" 6351 msgstr "" 6352 6353 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6354 #, fuzzy, kde-format 6355 #| msgid "Av" 6356 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6357 msgid "A" 6358 msgstr "Av" 6359 6360 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6361 #, fuzzy, kde-format 6362 #| msgid "Ith" 6363 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6364 msgid "Ith" 6365 msgstr "Isn" 6366 6367 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6368 #, fuzzy, kde-format 6369 #| msgid "Thl" 6370 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6371 msgid "Thl" 6372 msgstr "Sel" 6373 6374 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6375 #, fuzzy, kde-format 6376 #| msgid "Arb" 6377 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6378 msgid "Arb" 6379 msgstr "Rab" 6380 6381 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6382 #, fuzzy, kde-format 6383 #| msgid "Kha" 6384 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6385 msgid "Kha" 6386 msgstr "Kha" 6387 6388 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6389 #, fuzzy, kde-format 6390 #| msgid "Jum" 6391 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6392 msgid "Jum" 6393 msgstr "Jum" 6394 6395 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6396 #, fuzzy, kde-format 6397 #| msgid "Sab" 6398 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6399 msgid "Sab" 6400 msgstr "Sab" 6401 6402 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6403 #, fuzzy, kde-format 6404 #| msgid "Ahd" 6405 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6406 msgid "Ahd" 6407 msgstr "Ahd" 6408 6409 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6410 #, fuzzy, kde-format 6411 #| msgid "Yaum al-Ithnain" 6412 msgctxt "Hijri weekday 1 - KLocale::LongName" 6413 msgid "Yaum al-Ithnain" 6414 msgstr "Hari Isnin" 6415 6416 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6417 #, fuzzy, kde-format 6418 #| msgid "Yau al-Thulatha" 6419 msgctxt "Hijri weekday 2 - KLocale::LongName" 6420 msgid "Yau al-Thulatha" 6421 msgstr "Hari Selasa" 6422 6423 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6424 #, fuzzy, kde-format 6425 #| msgid "Yaum al-Arbi'a" 6426 msgctxt "Hijri weekday 3 - KLocale::LongName" 6427 msgid "Yaum al-Arbi'a" 6428 msgstr "Hari Rabu" 6429 6430 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6431 #, fuzzy, kde-format 6432 #| msgid "Yaum al-Khamees" 6433 msgctxt "Hijri weekday 4 - KLocale::LongName" 6434 msgid "Yaum al-Khamees" 6435 msgstr "Hari Khamis" 6436 6437 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6438 #, fuzzy, kde-format 6439 #| msgid "Yaum al-Jumma" 6440 msgctxt "Hijri weekday 5 - KLocale::LongName" 6441 msgid "Yaum al-Jumma" 6442 msgstr "Hari Jumaat" 6443 6444 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6445 #, fuzzy, kde-format 6446 #| msgid "Yaum al-Sabt" 6447 msgctxt "Hijri weekday 6 - KLocale::LongName" 6448 msgid "Yaum al-Sabt" 6449 msgstr "Hari Sabtu" 6450 6451 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6452 #, fuzzy, kde-format 6453 #| msgid "Yaum al-Ahad" 6454 msgctxt "Hijri weekday 7 - KLocale::LongName" 6455 msgid "Yaum al-Ahad" 6456 msgstr "Hari Ahad" 6457 6458 #: kdecore/kcalendarsystemjalali.cpp:74 6459 #, kde-format 6460 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6461 msgid "Anno Persico" 6462 msgstr "" 6463 6464 #: kdecore/kcalendarsystemjalali.cpp:75 6465 #, kde-format 6466 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6467 msgid "AP" 6468 msgstr "" 6469 6470 #: kdecore/kcalendarsystemjalali.cpp:76 6471 #, kde-format 6472 msgctxt "" 6473 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6474 msgid "%Ey %EC" 6475 msgstr "" 6476 6477 #: kdecore/kcalendarsystemjalali.cpp:172 6478 #, kde-format 6479 msgctxt "Jalali month 1 - KLocale::NarrowName" 6480 msgid "F" 6481 msgstr "" 6482 6483 #: kdecore/kcalendarsystemjalali.cpp:174 6484 #, kde-format 6485 msgctxt "Jalali month 2 - KLocale::NarrowName" 6486 msgid "O" 6487 msgstr "" 6488 6489 #: kdecore/kcalendarsystemjalali.cpp:176 6490 #, kde-format 6491 msgctxt "Jalali month 3 - KLocale::NarrowName" 6492 msgid "K" 6493 msgstr "" 6494 6495 #: kdecore/kcalendarsystemjalali.cpp:178 6496 #, kde-format 6497 msgctxt "Jalali month 4 - KLocale::NarrowName" 6498 msgid "T" 6499 msgstr "" 6500 6501 #: kdecore/kcalendarsystemjalali.cpp:180 6502 #, kde-format 6503 msgctxt "Jalali month 5 - KLocale::NarrowName" 6504 msgid "M" 6505 msgstr "" 6506 6507 #: kdecore/kcalendarsystemjalali.cpp:182 6508 #, kde-format 6509 msgctxt "Jalali month 6 - KLocale::NarrowName" 6510 msgid "S" 6511 msgstr "" 6512 6513 #: kdecore/kcalendarsystemjalali.cpp:184 6514 #, kde-format 6515 msgctxt "Jalali month 7 - KLocale::NarrowName" 6516 msgid "M" 6517 msgstr "" 6518 6519 #: kdecore/kcalendarsystemjalali.cpp:186 6520 #, fuzzy, kde-format 6521 #| msgid "Av" 6522 msgctxt "Jalali month 8 - KLocale::NarrowName" 6523 msgid "A" 6524 msgstr "Av" 6525 6526 #: kdecore/kcalendarsystemjalali.cpp:188 6527 #, fuzzy, kde-format 6528 #| msgid "Av" 6529 msgctxt "Jalali month 9 - KLocale::NarrowName" 6530 msgid "A" 6531 msgstr "Av" 6532 6533 #: kdecore/kcalendarsystemjalali.cpp:190 6534 #, kde-format 6535 msgctxt "Jalali month 10 - KLocale::NarrowName" 6536 msgid "D" 6537 msgstr "" 6538 6539 #: kdecore/kcalendarsystemjalali.cpp:192 6540 #, kde-format 6541 msgctxt "Jalali month 11 - KLocale::NarrowName" 6542 msgid "B" 6543 msgstr "" 6544 6545 #: kdecore/kcalendarsystemjalali.cpp:194 6546 #, kde-format 6547 msgctxt "Jalali month 12 - KLocale::NarrowName" 6548 msgid "E" 6549 msgstr "" 6550 6551 #: kdecore/kcalendarsystemjalali.cpp:203 6552 #, fuzzy, kde-format 6553 #| msgctxt "of Farvardin short" 6554 #| msgid "of Far" 6555 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6556 msgid "of Far" 6557 msgstr "bagi Far" 6558 6559 #: kdecore/kcalendarsystemjalali.cpp:205 6560 #, fuzzy, kde-format 6561 #| msgctxt "of Ordibehesht short" 6562 #| msgid "of Ord" 6563 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6564 msgid "of Ord" 6565 msgstr "bagi Ord" 6566 6567 #: kdecore/kcalendarsystemjalali.cpp:207 6568 #, fuzzy, kde-format 6569 #| msgctxt "of Khordad short" 6570 #| msgid "of Kho" 6571 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6572 msgid "of Kho" 6573 msgstr "bagi Kho" 6574 6575 #: kdecore/kcalendarsystemjalali.cpp:209 6576 #, fuzzy, kde-format 6577 #| msgctxt "of Tir short" 6578 #| msgid "of Tir" 6579 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6580 msgid "of Tir" 6581 msgstr "bagi Tir" 6582 6583 #: kdecore/kcalendarsystemjalali.cpp:211 6584 #, fuzzy, kde-format 6585 #| msgctxt "of Mordad short" 6586 #| msgid "of Mor" 6587 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6588 msgid "of Mor" 6589 msgstr "bagi Mor" 6590 6591 #: kdecore/kcalendarsystemjalali.cpp:213 6592 #, fuzzy, kde-format 6593 #| msgctxt "of Shahrivar short" 6594 #| msgid "of Sha" 6595 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6596 msgid "of Sha" 6597 msgstr "bagi Sha" 6598 6599 #: kdecore/kcalendarsystemjalali.cpp:215 6600 #, fuzzy, kde-format 6601 #| msgctxt "of Mehr short" 6602 #| msgid "of Meh" 6603 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6604 msgid "of Meh" 6605 msgstr "bagi Meh" 6606 6607 #: kdecore/kcalendarsystemjalali.cpp:217 6608 #, fuzzy, kde-format 6609 #| msgctxt "of Aban short" 6610 #| msgid "of Aba" 6611 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6612 msgid "of Aba" 6613 msgstr "bagi Aba" 6614 6615 #: kdecore/kcalendarsystemjalali.cpp:219 6616 #, fuzzy, kde-format 6617 #| msgctxt "of Azar short" 6618 #| msgid "of Aza" 6619 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6620 msgid "of Aza" 6621 msgstr "bagi Aza" 6622 6623 #: kdecore/kcalendarsystemjalali.cpp:221 6624 #, fuzzy, kde-format 6625 #| msgctxt "of Dei short" 6626 #| msgid "of Dei" 6627 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6628 msgid "of Dei" 6629 msgstr "bagi Dei" 6630 6631 #: kdecore/kcalendarsystemjalali.cpp:223 6632 #, fuzzy, kde-format 6633 #| msgctxt "of Bahman short" 6634 #| msgid "of Bah" 6635 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6636 msgid "of Bah" 6637 msgstr "bagi Bah" 6638 6639 #: kdecore/kcalendarsystemjalali.cpp:225 6640 #, fuzzy, kde-format 6641 #| msgctxt "of Esfand short" 6642 #| msgid "of Esf" 6643 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6644 msgid "of Esf" 6645 msgstr "bagi Esf" 6646 6647 #: kdecore/kcalendarsystemjalali.cpp:234 6648 #, fuzzy, kde-format 6649 #| msgctxt "Farvardin short" 6650 #| msgid "Far" 6651 msgctxt "Jalali month 1 - KLocale::ShortName" 6652 msgid "Far" 6653 msgstr "Far" 6654 6655 #: kdecore/kcalendarsystemjalali.cpp:236 6656 #, fuzzy, kde-format 6657 #| msgctxt "Ordibehesht short" 6658 #| msgid "Ord" 6659 msgctxt "Jalali month 2 - KLocale::ShortName" 6660 msgid "Ord" 6661 msgstr "Ord" 6662 6663 #: kdecore/kcalendarsystemjalali.cpp:238 6664 #, fuzzy, kde-format 6665 #| msgctxt "Khordad short" 6666 #| msgid "Kho" 6667 msgctxt "Jalali month 3 - KLocale::ShortName" 6668 msgid "Kho" 6669 msgstr "Kho" 6670 6671 #: kdecore/kcalendarsystemjalali.cpp:240 6672 #, fuzzy, kde-format 6673 #| msgctxt "Tir short" 6674 #| msgid "Tir" 6675 msgctxt "Jalali month 4 - KLocale::ShortName" 6676 msgid "Tir" 6677 msgstr "Tir" 6678 6679 #: kdecore/kcalendarsystemjalali.cpp:242 6680 #, fuzzy, kde-format 6681 #| msgctxt "Mordad short" 6682 #| msgid "Mor" 6683 msgctxt "Jalali month 5 - KLocale::ShortName" 6684 msgid "Mor" 6685 msgstr "Mor" 6686 6687 #: kdecore/kcalendarsystemjalali.cpp:244 6688 #, fuzzy, kde-format 6689 #| msgctxt "Shahrivar short" 6690 #| msgid "Sha" 6691 msgctxt "Jalali month 6 - KLocale::ShortName" 6692 msgid "Sha" 6693 msgstr "Sha" 6694 6695 #: kdecore/kcalendarsystemjalali.cpp:246 6696 #, fuzzy, kde-format 6697 #| msgctxt "Mehr short" 6698 #| msgid "Meh" 6699 msgctxt "Jalali month 7 - KLocale::ShortName" 6700 msgid "Meh" 6701 msgstr "Meh" 6702 6703 #: kdecore/kcalendarsystemjalali.cpp:248 6704 #, fuzzy, kde-format 6705 #| msgctxt "Aban short" 6706 #| msgid "Aba" 6707 msgctxt "Jalali month 8 - KLocale::ShortName" 6708 msgid "Aba" 6709 msgstr "Aba" 6710 6711 #: kdecore/kcalendarsystemjalali.cpp:250 6712 #, fuzzy, kde-format 6713 #| msgctxt "Azar short" 6714 #| msgid "Aza" 6715 msgctxt "Jalali month 9 - KLocale::ShortName" 6716 msgid "Aza" 6717 msgstr "Aza" 6718 6719 #: kdecore/kcalendarsystemjalali.cpp:252 6720 #, fuzzy, kde-format 6721 #| msgctxt "Dei short" 6722 #| msgid "Dei" 6723 msgctxt "Jalali month 10 - KLocale::ShortName" 6724 msgid "Dei" 6725 msgstr "Dei" 6726 6727 #: kdecore/kcalendarsystemjalali.cpp:254 6728 #, fuzzy, kde-format 6729 #| msgctxt "Bahman short" 6730 #| msgid "Bah" 6731 msgctxt "Jalali month 11 - KLocale::ShortName" 6732 msgid "Bah" 6733 msgstr "Bah" 6734 6735 #: kdecore/kcalendarsystemjalali.cpp:256 6736 #, fuzzy, kde-format 6737 #| msgctxt "Esfand" 6738 #| msgid "Esf" 6739 msgctxt "Jalali month 12 - KLocale::ShortName" 6740 msgid "Esf" 6741 msgstr "Esf" 6742 6743 #: kdecore/kcalendarsystemjalali.cpp:265 6744 #, fuzzy, kde-format 6745 #| msgid "of Farvardin" 6746 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6747 msgid "of Farvardin" 6748 msgstr "bagi Farvardin" 6749 6750 #: kdecore/kcalendarsystemjalali.cpp:267 6751 #, fuzzy, kde-format 6752 #| msgid "of Ordibehesht" 6753 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6754 msgid "of Ordibehesht" 6755 msgstr "bagi Ordibehesht" 6756 6757 #: kdecore/kcalendarsystemjalali.cpp:269 6758 #, fuzzy, kde-format 6759 #| msgid "of Khordad" 6760 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6761 msgid "of Khordad" 6762 msgstr "bagi Khordad" 6763 6764 #: kdecore/kcalendarsystemjalali.cpp:271 6765 #, fuzzy, kde-format 6766 #| msgctxt "of Tir short" 6767 #| msgid "of Tir" 6768 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6769 msgid "of Tir" 6770 msgstr "bagi Tir" 6771 6772 #: kdecore/kcalendarsystemjalali.cpp:273 6773 #, fuzzy, kde-format 6774 #| msgid "of Mordad" 6775 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6776 msgid "of Mordad" 6777 msgstr "bagi Mordad" 6778 6779 #: kdecore/kcalendarsystemjalali.cpp:275 6780 #, fuzzy, kde-format 6781 #| msgid "of Shahrivar" 6782 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6783 msgid "of Shahrivar" 6784 msgstr "bagi Shahrivar" 6785 6786 #: kdecore/kcalendarsystemjalali.cpp:277 6787 #, fuzzy, kde-format 6788 #| msgid "of Mehr" 6789 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6790 msgid "of Mehr" 6791 msgstr "bagi Mehr" 6792 6793 #: kdecore/kcalendarsystemjalali.cpp:279 6794 #, fuzzy, kde-format 6795 #| msgid "of Aban" 6796 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6797 msgid "of Aban" 6798 msgstr "bagi Aban" 6799 6800 #: kdecore/kcalendarsystemjalali.cpp:281 6801 #, fuzzy, kde-format 6802 #| msgid "of Azar" 6803 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6804 msgid "of Azar" 6805 msgstr "bagi Azar" 6806 6807 #: kdecore/kcalendarsystemjalali.cpp:283 6808 #, fuzzy, kde-format 6809 #| msgctxt "of Dei short" 6810 #| msgid "of Dei" 6811 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6812 msgid "of Dei" 6813 msgstr "bagi Dei" 6814 6815 #: kdecore/kcalendarsystemjalali.cpp:285 6816 #, fuzzy, kde-format 6817 #| msgid "of Bahman" 6818 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6819 msgid "of Bahman" 6820 msgstr "bagi Bahman" 6821 6822 #: kdecore/kcalendarsystemjalali.cpp:287 6823 #, fuzzy, kde-format 6824 #| msgid "of Esfand" 6825 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6826 msgid "of Esfand" 6827 msgstr "bagi Esfand" 6828 6829 #: kdecore/kcalendarsystemjalali.cpp:296 6830 #, fuzzy, kde-format 6831 #| msgid "Farvardin" 6832 msgctxt "Jalali month 1 - KLocale::LongName" 6833 msgid "Farvardin" 6834 msgstr "Farvardin" 6835 6836 #: kdecore/kcalendarsystemjalali.cpp:298 6837 #, fuzzy, kde-format 6838 #| msgid "Ordibehesht" 6839 msgctxt "Jalali month 2 - KLocale::LongName" 6840 msgid "Ordibehesht" 6841 msgstr "Ordibehesht" 6842 6843 #: kdecore/kcalendarsystemjalali.cpp:300 6844 #, fuzzy, kde-format 6845 #| msgid "Khordad" 6846 msgctxt "Jalali month 3 - KLocale::LongName" 6847 msgid "Khordad" 6848 msgstr "Khordad" 6849 6850 #: kdecore/kcalendarsystemjalali.cpp:302 6851 #, fuzzy, kde-format 6852 #| msgctxt "Tir short" 6853 #| msgid "Tir" 6854 msgctxt "Jalali month 4 - KLocale::LongName" 6855 msgid "Tir" 6856 msgstr "Tir" 6857 6858 #: kdecore/kcalendarsystemjalali.cpp:304 6859 #, fuzzy, kde-format 6860 #| msgid "Mordad" 6861 msgctxt "Jalali month 5 - KLocale::LongName" 6862 msgid "Mordad" 6863 msgstr "Mordad" 6864 6865 #: kdecore/kcalendarsystemjalali.cpp:306 6866 #, fuzzy, kde-format 6867 #| msgid "Shahrivar" 6868 msgctxt "Jalali month 6 - KLocale::LongName" 6869 msgid "Shahrivar" 6870 msgstr "Shahrivar" 6871 6872 #: kdecore/kcalendarsystemjalali.cpp:308 6873 #, fuzzy, kde-format 6874 #| msgid "Mehr" 6875 msgctxt "Jalali month 7 - KLocale::LongName" 6876 msgid "Mehr" 6877 msgstr "Mehr" 6878 6879 #: kdecore/kcalendarsystemjalali.cpp:310 6880 #, fuzzy, kde-format 6881 #| msgid "Aban" 6882 msgctxt "Jalali month 8 - KLocale::LongName" 6883 msgid "Aban" 6884 msgstr "Aban" 6885 6886 #: kdecore/kcalendarsystemjalali.cpp:312 6887 #, fuzzy, kde-format 6888 #| msgid "Azar" 6889 msgctxt "Jalali month 9 - KLocale::LongName" 6890 msgid "Azar" 6891 msgstr "Azar" 6892 6893 #: kdecore/kcalendarsystemjalali.cpp:314 6894 #, fuzzy, kde-format 6895 #| msgctxt "Dei short" 6896 #| msgid "Dei" 6897 msgctxt "Jalali month 10 - KLocale::LongName" 6898 msgid "Dei" 6899 msgstr "Dei" 6900 6901 #: kdecore/kcalendarsystemjalali.cpp:316 6902 #, fuzzy, kde-format 6903 #| msgid "Bahman" 6904 msgctxt "Jalali month 11 - KLocale::LongName" 6905 msgid "Bahman" 6906 msgstr "Bahman" 6907 6908 #: kdecore/kcalendarsystemjalali.cpp:318 6909 #, fuzzy, kde-format 6910 #| msgid "Esfand" 6911 msgctxt "Jalali month 12 - KLocale::LongName" 6912 msgid "Esfand" 6913 msgstr "Esfand" 6914 6915 #: kdecore/kcalendarsystemjalali.cpp:331 6916 #, kde-format 6917 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6918 msgid "2" 6919 msgstr "" 6920 6921 #: kdecore/kcalendarsystemjalali.cpp:333 6922 #, kde-format 6923 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6924 msgid "3" 6925 msgstr "" 6926 6927 #: kdecore/kcalendarsystemjalali.cpp:335 6928 #, kde-format 6929 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6930 msgid "4" 6931 msgstr "" 6932 6933 #: kdecore/kcalendarsystemjalali.cpp:337 6934 #, kde-format 6935 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6936 msgid "5" 6937 msgstr "" 6938 6939 #: kdecore/kcalendarsystemjalali.cpp:339 6940 #, kde-format 6941 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6942 msgid "J" 6943 msgstr "" 6944 6945 #: kdecore/kcalendarsystemjalali.cpp:341 6946 #, kde-format 6947 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6948 msgid "S" 6949 msgstr "" 6950 6951 #: kdecore/kcalendarsystemjalali.cpp:343 6952 #, kde-format 6953 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6954 msgid "1" 6955 msgstr "" 6956 6957 #: kdecore/kcalendarsystemjalali.cpp:352 6958 #, fuzzy, kde-format 6959 #| msgctxt "Do shanbe short" 6960 #| msgid "2sh" 6961 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6962 msgid "2sh" 6963 msgstr "2sh" 6964 6965 #: kdecore/kcalendarsystemjalali.cpp:354 6966 #, fuzzy, kde-format 6967 #| msgctxt "Se shanbe short" 6968 #| msgid "3sh" 6969 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6970 msgid "3sh" 6971 msgstr "3sh" 6972 6973 #: kdecore/kcalendarsystemjalali.cpp:356 6974 #, fuzzy, kde-format 6975 #| msgctxt "Chahar shanbe short" 6976 #| msgid "4sh" 6977 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6978 msgid "4sh" 6979 msgstr "4sh" 6980 6981 #: kdecore/kcalendarsystemjalali.cpp:358 6982 #, fuzzy, kde-format 6983 #| msgctxt "Panj shanbe short" 6984 #| msgid "5sh" 6985 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6986 msgid "5sh" 6987 msgstr "5sh" 6988 6989 #: kdecore/kcalendarsystemjalali.cpp:360 6990 #, fuzzy, kde-format 6991 #| msgctxt "Jumee short" 6992 #| msgid "Jom" 6993 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6994 msgid "Jom" 6995 msgstr "Jom" 6996 6997 #: kdecore/kcalendarsystemjalali.cpp:362 6998 #, fuzzy, kde-format 6999 #| msgid "Shanbe" 7000 msgctxt "Jalali weekday 6 - KLocale::ShortName" 7001 msgid "Shn" 7002 msgstr "Shanbe" 7003 7004 #: kdecore/kcalendarsystemjalali.cpp:364 7005 #, fuzzy, kde-format 7006 #| msgctxt "Yek-shanbe short" 7007 #| msgid "1sh" 7008 msgctxt "Jalali weekday 7 - KLocale::ShortName" 7009 msgid "1sh" 7010 msgstr "1sh" 7011 7012 #: kdecore/kcalendarsystemjalali.cpp:371 7013 #, fuzzy, kde-format 7014 #| msgid "Do shanbe" 7015 msgctxt "Jalali weekday 1 - KLocale::LongName" 7016 msgid "Do shanbe" 7017 msgstr "Do shanbe" 7018 7019 #: kdecore/kcalendarsystemjalali.cpp:373 7020 #, fuzzy, kde-format 7021 #| msgid "Se shanbe" 7022 msgctxt "Jalali weekday 2 - KLocale::LongName" 7023 msgid "Se shanbe" 7024 msgstr "Se shanbe" 7025 7026 #: kdecore/kcalendarsystemjalali.cpp:375 7027 #, fuzzy, kde-format 7028 #| msgid "Chahar shanbe" 7029 msgctxt "Jalali weekday 3 - KLocale::LongName" 7030 msgid "Chahar shanbe" 7031 msgstr "Chahar shanbe" 7032 7033 #: kdecore/kcalendarsystemjalali.cpp:377 7034 #, fuzzy, kde-format 7035 #| msgid "Panj shanbe" 7036 msgctxt "Jalali weekday 4 - KLocale::LongName" 7037 msgid "Panj shanbe" 7038 msgstr "Panj shanbe" 7039 7040 #: kdecore/kcalendarsystemjalali.cpp:379 7041 #, fuzzy, kde-format 7042 #| msgid "Jumee" 7043 msgctxt "Jalali weekday 5 - KLocale::LongName" 7044 msgid "Jumee" 7045 msgstr "Jumee" 7046 7047 #: kdecore/kcalendarsystemjalali.cpp:381 7048 #, fuzzy, kde-format 7049 #| msgid "Shanbe" 7050 msgctxt "Jalali weekday 6 - KLocale::LongName" 7051 msgid "Shanbe" 7052 msgstr "Shanbe" 7053 7054 #: kdecore/kcalendarsystemjalali.cpp:383 7055 #, fuzzy, kde-format 7056 #| msgid "Yek-shanbe" 7057 msgctxt "Jalali weekday 7 - KLocale::LongName" 7058 msgid "Yek-shanbe" 7059 msgstr "Yek-shanbe" 7060 7061 #: kdecore/kcalendarsystemjapanese.cpp:62 7062 #, kde-format 7063 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 7064 msgid "Meiji" 7065 msgstr "" 7066 7067 #: kdecore/kcalendarsystemjapanese.cpp:64 7068 #, kde-format 7069 msgctxt "" 7070 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 7071 "e.g. Meiji 1" 7072 msgid "%EC Gannen" 7073 msgstr "" 7074 7075 #: kdecore/kcalendarsystemjapanese.cpp:66 7076 #, kde-format 7077 msgctxt "" 7078 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 7079 "e.g. Meiji 22" 7080 msgid "%EC %Ey" 7081 msgstr "" 7082 7083 #: kdecore/kcalendarsystemjapanese.cpp:69 7084 #, kde-format 7085 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 7086 msgid "Taishō" 7087 msgstr "" 7088 7089 #: kdecore/kcalendarsystemjapanese.cpp:71 7090 #, kde-format 7091 msgctxt "" 7092 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 7093 "1, e.g. Taishō 1" 7094 msgid "%EC Gannen" 7095 msgstr "" 7096 7097 #: kdecore/kcalendarsystemjapanese.cpp:73 7098 #, kde-format 7099 msgctxt "" 7100 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 7101 "1, e.g. Taishō 22" 7102 msgid "%EC %Ey" 7103 msgstr "" 7104 7105 #: kdecore/kcalendarsystemjapanese.cpp:76 7106 #, fuzzy, kde-format 7107 #| msgctxt "Shahrivar short" 7108 #| msgid "Sha" 7109 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 7110 msgid "Shōwa" 7111 msgstr "Sha" 7112 7113 #: kdecore/kcalendarsystemjapanese.cpp:78 7114 #, kde-format 7115 msgctxt "" 7116 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 7117 "e.g. Shōwa 1" 7118 msgid "%EC Gannen" 7119 msgstr "" 7120 7121 #: kdecore/kcalendarsystemjapanese.cpp:80 7122 #, kde-format 7123 msgctxt "" 7124 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 7125 "e.g. Shōwa 22" 7126 msgid "%EC %Ey" 7127 msgstr "" 7128 7129 #: kdecore/kcalendarsystemjapanese.cpp:83 7130 #, kde-format 7131 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 7132 msgid "Heisei" 7133 msgstr "" 7134 7135 #: kdecore/kcalendarsystemjapanese.cpp:85 7136 #, kde-format 7137 msgctxt "" 7138 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 7139 "1, e.g. Heisei 1" 7140 msgid "%EC Gannen" 7141 msgstr "" 7142 7143 #: kdecore/kcalendarsystemjapanese.cpp:87 7144 #, kde-format 7145 msgctxt "" 7146 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 7147 "1, e.g. Heisei 22" 7148 msgid "%EC %Ey" 7149 msgstr "" 7150 7151 #: kdecore/kcalendarsystemjapanese.cpp:164 7152 #, fuzzy, kde-format 7153 msgctxt "Japanese year 1 of era" 7154 msgid "Gannen" 7155 msgstr "Hijau:" 7156 7157 #: kdecore/kcalendarsystemjulian.cpp:73 7158 #, kde-format 7159 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 7160 msgid "Before Common Era" 7161 msgstr "" 7162 7163 #: kdecore/kcalendarsystemjulian.cpp:74 7164 #, kde-format 7165 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 7166 msgid "BCE" 7167 msgstr "" 7168 7169 #: kdecore/kcalendarsystemjulian.cpp:76 7170 #, kde-format 7171 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 7172 msgid "Before Christ" 7173 msgstr "" 7174 7175 #: kdecore/kcalendarsystemjulian.cpp:77 7176 #, kde-format 7177 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 7178 msgid "BC" 7179 msgstr "" 7180 7181 #: kdecore/kcalendarsystemjulian.cpp:79 7182 #, kde-format 7183 msgctxt "" 7184 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 7185 msgid "%Ey %EC" 7186 msgstr "" 7187 7188 #: kdecore/kcalendarsystemjulian.cpp:83 7189 #, kde-format 7190 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 7191 msgid "Common Era" 7192 msgstr "" 7193 7194 #: kdecore/kcalendarsystemjulian.cpp:84 7195 #, kde-format 7196 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 7197 msgid "CE" 7198 msgstr "" 7199 7200 #: kdecore/kcalendarsystemjulian.cpp:86 7201 #, kde-format 7202 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 7203 msgid "Anno Domini" 7204 msgstr "" 7205 7206 #: kdecore/kcalendarsystemjulian.cpp:87 7207 #, kde-format 7208 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 7209 msgid "AD" 7210 msgstr "" 7211 7212 #: kdecore/kcalendarsystemjulian.cpp:89 7213 #, kde-format 7214 msgctxt "" 7215 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 7216 msgid "%Ey %EC" 7217 msgstr "" 7218 7219 #: kdecore/kcalendarsystemjulian.cpp:172 7220 #, kde-format 7221 msgctxt "Julian month 1 - KLocale::NarrowName" 7222 msgid "J" 7223 msgstr "" 7224 7225 #: kdecore/kcalendarsystemjulian.cpp:174 7226 #, kde-format 7227 msgctxt "Julian month 2 - KLocale::NarrowName" 7228 msgid "F" 7229 msgstr "" 7230 7231 #: kdecore/kcalendarsystemjulian.cpp:176 7232 #, kde-format 7233 msgctxt "Julian month 3 - KLocale::NarrowName" 7234 msgid "M" 7235 msgstr "" 7236 7237 #: kdecore/kcalendarsystemjulian.cpp:178 7238 #, fuzzy, kde-format 7239 #| msgid "Av" 7240 msgctxt "Julian month 4 - KLocale::NarrowName" 7241 msgid "A" 7242 msgstr "Av" 7243 7244 #: kdecore/kcalendarsystemjulian.cpp:180 7245 #, kde-format 7246 msgctxt "Julian month 5 - KLocale::NarrowName" 7247 msgid "M" 7248 msgstr "" 7249 7250 #: kdecore/kcalendarsystemjulian.cpp:182 7251 #, kde-format 7252 msgctxt "Julian month 6 - KLocale::NarrowName" 7253 msgid "J" 7254 msgstr "" 7255 7256 #: kdecore/kcalendarsystemjulian.cpp:184 7257 #, kde-format 7258 msgctxt "Julian month 7 - KLocale::NarrowName" 7259 msgid "J" 7260 msgstr "" 7261 7262 #: kdecore/kcalendarsystemjulian.cpp:186 7263 #, fuzzy, kde-format 7264 #| msgid "Av" 7265 msgctxt "Julian month 8 - KLocale::NarrowName" 7266 msgid "A" 7267 msgstr "Av" 7268 7269 #: kdecore/kcalendarsystemjulian.cpp:188 7270 #, kde-format 7271 msgctxt "Julian month 9 - KLocale::NarrowName" 7272 msgid "S" 7273 msgstr "" 7274 7275 #: kdecore/kcalendarsystemjulian.cpp:190 7276 #, kde-format 7277 msgctxt "Julian month 10 - KLocale::NarrowName" 7278 msgid "O" 7279 msgstr "" 7280 7281 #: kdecore/kcalendarsystemjulian.cpp:192 7282 #, kde-format 7283 msgctxt "Julian month 11 - KLocale::NarrowName" 7284 msgid "N" 7285 msgstr "" 7286 7287 #: kdecore/kcalendarsystemjulian.cpp:194 7288 #, kde-format 7289 msgctxt "Julian month 12 - KLocale::NarrowName" 7290 msgid "D" 7291 msgstr "" 7292 7293 #: kdecore/kcalendarsystemjulian.cpp:203 7294 #, fuzzy, kde-format 7295 #| msgctxt "of January" 7296 #| msgid "of Jan" 7297 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 7298 msgid "of Jan" 7299 msgstr "Januari" 7300 7301 #: kdecore/kcalendarsystemjulian.cpp:205 7302 #, fuzzy, kde-format 7303 #| msgctxt "of February" 7304 #| msgid "of Feb" 7305 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 7306 msgid "of Feb" 7307 msgstr "Februari" 7308 7309 #: kdecore/kcalendarsystemjulian.cpp:207 7310 #, fuzzy, kde-format 7311 #| msgctxt "of March" 7312 #| msgid "of Mar" 7313 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 7314 msgid "of Mar" 7315 msgstr "Mac" 7316 7317 #: kdecore/kcalendarsystemjulian.cpp:209 7318 #, fuzzy, kde-format 7319 #| msgctxt "of April" 7320 #| msgid "of Apr" 7321 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7322 msgid "of Apr" 7323 msgstr "April" 7324 7325 #: kdecore/kcalendarsystemjulian.cpp:211 7326 #, fuzzy, kde-format 7327 #| msgctxt "of May short" 7328 #| msgid "of May" 7329 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7330 msgid "of May" 7331 msgstr "Mei" 7332 7333 #: kdecore/kcalendarsystemjulian.cpp:213 7334 #, fuzzy, kde-format 7335 #| msgctxt "of June" 7336 #| msgid "of Jun" 7337 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7338 msgid "of Jun" 7339 msgstr "Jun" 7340 7341 #: kdecore/kcalendarsystemjulian.cpp:215 7342 #, fuzzy, kde-format 7343 #| msgctxt "of July" 7344 #| msgid "of Jul" 7345 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7346 msgid "of Jul" 7347 msgstr "Julai" 7348 7349 #: kdecore/kcalendarsystemjulian.cpp:217 7350 #, fuzzy, kde-format 7351 #| msgctxt "of August" 7352 #| msgid "of Aug" 7353 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7354 msgid "of Aug" 7355 msgstr "Ogos" 7356 7357 #: kdecore/kcalendarsystemjulian.cpp:219 7358 #, fuzzy, kde-format 7359 #| msgctxt "of September" 7360 #| msgid "of Sep" 7361 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7362 msgid "of Sep" 7363 msgstr "September" 7364 7365 #: kdecore/kcalendarsystemjulian.cpp:221 7366 #, fuzzy, kde-format 7367 #| msgctxt "of October" 7368 #| msgid "of Oct" 7369 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7370 msgid "of Oct" 7371 msgstr "Oktober" 7372 7373 #: kdecore/kcalendarsystemjulian.cpp:223 7374 #, fuzzy, kde-format 7375 #| msgctxt "of November" 7376 #| msgid "of Nov" 7377 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7378 msgid "of Nov" 7379 msgstr "November" 7380 7381 #: kdecore/kcalendarsystemjulian.cpp:225 7382 #, fuzzy, kde-format 7383 #| msgctxt "of December" 7384 #| msgid "of Dec" 7385 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7386 msgid "of Dec" 7387 msgstr "Disember" 7388 7389 #: kdecore/kcalendarsystemjulian.cpp:234 7390 #, fuzzy, kde-format 7391 #| msgctxt "January" 7392 #| msgid "Jan" 7393 msgctxt "Julian month 1 - KLocale::ShortName" 7394 msgid "Jan" 7395 msgstr "Jan" 7396 7397 #: kdecore/kcalendarsystemjulian.cpp:236 7398 #, fuzzy, kde-format 7399 #| msgctxt "February" 7400 #| msgid "Feb" 7401 msgctxt "Julian month 2 - KLocale::ShortName" 7402 msgid "Feb" 7403 msgstr "Feb" 7404 7405 #: kdecore/kcalendarsystemjulian.cpp:238 7406 #, fuzzy, kde-format 7407 #| msgctxt "March" 7408 #| msgid "Mar" 7409 msgctxt "Julian month 3 - KLocale::ShortName" 7410 msgid "Mar" 7411 msgstr "Mac" 7412 7413 #: kdecore/kcalendarsystemjulian.cpp:240 7414 #, fuzzy, kde-format 7415 #| msgctxt "April" 7416 #| msgid "Apr" 7417 msgctxt "Julian month 4 - KLocale::ShortName" 7418 msgid "Apr" 7419 msgstr "Apr" 7420 7421 #: kdecore/kcalendarsystemjulian.cpp:242 7422 #, fuzzy, kde-format 7423 #| msgctxt "May short" 7424 #| msgid "May" 7425 msgctxt "Julian month 5 - KLocale::ShortName" 7426 msgid "May" 7427 msgstr "Mei" 7428 7429 #: kdecore/kcalendarsystemjulian.cpp:244 7430 #, fuzzy, kde-format 7431 #| msgctxt "June" 7432 #| msgid "Jun" 7433 msgctxt "Julian month 6 - KLocale::ShortName" 7434 msgid "Jun" 7435 msgstr "Jun" 7436 7437 #: kdecore/kcalendarsystemjulian.cpp:246 7438 #, fuzzy, kde-format 7439 #| msgctxt "July" 7440 #| msgid "Jul" 7441 msgctxt "Julian month 7 - KLocale::ShortName" 7442 msgid "Jul" 7443 msgstr "Jul" 7444 7445 #: kdecore/kcalendarsystemjulian.cpp:248 7446 #, fuzzy, kde-format 7447 #| msgctxt "August" 7448 #| msgid "Aug" 7449 msgctxt "Julian month 8 - KLocale::ShortName" 7450 msgid "Aug" 7451 msgstr "Ogo" 7452 7453 #: kdecore/kcalendarsystemjulian.cpp:250 7454 #, fuzzy, kde-format 7455 #| msgctxt "September" 7456 #| msgid "Sep" 7457 msgctxt "Julian month 9 - KLocale::ShortName" 7458 msgid "Sep" 7459 msgstr "Sep" 7460 7461 #: kdecore/kcalendarsystemjulian.cpp:252 7462 #, fuzzy, kde-format 7463 #| msgctxt "October" 7464 #| msgid "Oct" 7465 msgctxt "Julian month 10 - KLocale::ShortName" 7466 msgid "Oct" 7467 msgstr "Okt" 7468 7469 #: kdecore/kcalendarsystemjulian.cpp:254 7470 #, fuzzy, kde-format 7471 #| msgctxt "November" 7472 #| msgid "Nov" 7473 msgctxt "Julian month 11 - KLocale::ShortName" 7474 msgid "Nov" 7475 msgstr "Nov" 7476 7477 #: kdecore/kcalendarsystemjulian.cpp:256 7478 #, fuzzy, kde-format 7479 #| msgctxt "December" 7480 #| msgid "Dec" 7481 msgctxt "Julian month 12 - KLocale::ShortName" 7482 msgid "Dec" 7483 msgstr "Dis" 7484 7485 #: kdecore/kcalendarsystemjulian.cpp:265 7486 #, fuzzy, kde-format 7487 #| msgid "of January" 7488 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7489 msgid "of January" 7490 msgstr "dari Jan" 7491 7492 #: kdecore/kcalendarsystemjulian.cpp:267 7493 #, fuzzy, kde-format 7494 #| msgid "of February" 7495 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7496 msgid "of February" 7497 msgstr "dari Februari" 7498 7499 #: kdecore/kcalendarsystemjulian.cpp:269 7500 #, fuzzy, kde-format 7501 #| msgid "of March" 7502 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7503 msgid "of March" 7504 msgstr "dari Mac" 7505 7506 #: kdecore/kcalendarsystemjulian.cpp:271 7507 #, fuzzy, kde-format 7508 #| msgid "of April" 7509 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7510 msgid "of April" 7511 msgstr "dari April" 7512 7513 #: kdecore/kcalendarsystemjulian.cpp:273 7514 #, fuzzy, kde-format 7515 #| msgctxt "of May short" 7516 #| msgid "of May" 7517 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7518 msgid "of May" 7519 msgstr "Mei" 7520 7521 #: kdecore/kcalendarsystemjulian.cpp:275 7522 #, fuzzy, kde-format 7523 #| msgid "of June" 7524 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7525 msgid "of June" 7526 msgstr "dari Jun" 7527 7528 #: kdecore/kcalendarsystemjulian.cpp:277 7529 #, fuzzy, kde-format 7530 #| msgid "of July" 7531 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7532 msgid "of July" 7533 msgstr "dari Julai" 7534 7535 #: kdecore/kcalendarsystemjulian.cpp:279 7536 #, fuzzy, kde-format 7537 #| msgid "of August" 7538 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7539 msgid "of August" 7540 msgstr "dari Ogos" 7541 7542 #: kdecore/kcalendarsystemjulian.cpp:281 7543 #, fuzzy, kde-format 7544 #| msgid "of September" 7545 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7546 msgid "of September" 7547 msgstr "dari September" 7548 7549 #: kdecore/kcalendarsystemjulian.cpp:283 7550 #, fuzzy, kde-format 7551 #| msgid "of October" 7552 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7553 msgid "of October" 7554 msgstr "dari Oktober" 7555 7556 #: kdecore/kcalendarsystemjulian.cpp:285 7557 #, fuzzy, kde-format 7558 #| msgid "of November" 7559 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7560 msgid "of November" 7561 msgstr "dari November" 7562 7563 #: kdecore/kcalendarsystemjulian.cpp:287 7564 #, fuzzy, kde-format 7565 #| msgid "of December" 7566 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7567 msgid "of December" 7568 msgstr "dari Disember" 7569 7570 #: kdecore/kcalendarsystemjulian.cpp:296 7571 #, fuzzy, kde-format 7572 #| msgid "January" 7573 msgctxt "Julian month 1 - KLocale::LongName" 7574 msgid "January" 7575 msgstr "Januari" 7576 7577 #: kdecore/kcalendarsystemjulian.cpp:298 7578 #, fuzzy, kde-format 7579 #| msgid "February" 7580 msgctxt "Julian month 2 - KLocale::LongName" 7581 msgid "February" 7582 msgstr "Februari" 7583 7584 #: kdecore/kcalendarsystemjulian.cpp:300 7585 #, fuzzy, kde-format 7586 #| msgctxt "March long" 7587 #| msgid "March" 7588 msgctxt "Julian month 3 - KLocale::LongName" 7589 msgid "March" 7590 msgstr "Mac" 7591 7592 #: kdecore/kcalendarsystemjulian.cpp:302 7593 #, fuzzy, kde-format 7594 #| msgid "April" 7595 msgctxt "Julian month 4 - KLocale::LongName" 7596 msgid "April" 7597 msgstr "April" 7598 7599 #: kdecore/kcalendarsystemjulian.cpp:304 7600 #, fuzzy, kde-format 7601 #| msgctxt "May short" 7602 #| msgid "May" 7603 msgctxt "Julian month 5 - KLocale::LongName" 7604 msgid "May" 7605 msgstr "Mei" 7606 7607 #: kdecore/kcalendarsystemjulian.cpp:306 7608 #, fuzzy, kde-format 7609 #| msgid "June" 7610 msgctxt "Julian month 6 - KLocale::LongName" 7611 msgid "June" 7612 msgstr "Jun" 7613 7614 #: kdecore/kcalendarsystemjulian.cpp:308 7615 #, fuzzy, kde-format 7616 #| msgid "July" 7617 msgctxt "Julian month 7 - KLocale::LongName" 7618 msgid "July" 7619 msgstr "Julai" 7620 7621 #: kdecore/kcalendarsystemjulian.cpp:310 7622 #, fuzzy, kde-format 7623 #| msgctxt "August long" 7624 #| msgid "August" 7625 msgctxt "Julian month 8 - KLocale::LongName" 7626 msgid "August" 7627 msgstr "Ogos" 7628 7629 #: kdecore/kcalendarsystemjulian.cpp:312 7630 #, fuzzy, kde-format 7631 #| msgid "September" 7632 msgctxt "Julian month 9 - KLocale::LongName" 7633 msgid "September" 7634 msgstr "September" 7635 7636 #: kdecore/kcalendarsystemjulian.cpp:314 7637 #, fuzzy, kde-format 7638 #| msgid "October" 7639 msgctxt "Julian month 10 - KLocale::LongName" 7640 msgid "October" 7641 msgstr "Oktober" 7642 7643 #: kdecore/kcalendarsystemjulian.cpp:316 7644 #, fuzzy, kde-format 7645 #| msgid "November" 7646 msgctxt "Julian month 11 - KLocale::LongName" 7647 msgid "November" 7648 msgstr "November" 7649 7650 #: kdecore/kcalendarsystemjulian.cpp:318 7651 #, fuzzy, kde-format 7652 #| msgid "December" 7653 msgctxt "Julian month 12 - KLocale::LongName" 7654 msgid "December" 7655 msgstr "Disember" 7656 7657 #: kdecore/kcalendarsystemjulian.cpp:331 7658 #, kde-format 7659 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7660 msgid "M" 7661 msgstr "" 7662 7663 #: kdecore/kcalendarsystemjulian.cpp:333 7664 #, kde-format 7665 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7666 msgid "T" 7667 msgstr "" 7668 7669 #: kdecore/kcalendarsystemjulian.cpp:335 7670 #, kde-format 7671 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7672 msgid "W" 7673 msgstr "" 7674 7675 #: kdecore/kcalendarsystemjulian.cpp:337 7676 #, kde-format 7677 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7678 msgid "T" 7679 msgstr "" 7680 7681 #: kdecore/kcalendarsystemjulian.cpp:339 7682 #, kde-format 7683 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7684 msgid "F" 7685 msgstr "" 7686 7687 #: kdecore/kcalendarsystemjulian.cpp:341 7688 #, kde-format 7689 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7690 msgid "S" 7691 msgstr "" 7692 7693 #: kdecore/kcalendarsystemjulian.cpp:343 7694 #, kde-format 7695 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7696 msgid "S" 7697 msgstr "" 7698 7699 #: kdecore/kcalendarsystemjulian.cpp:352 7700 #, fuzzy, kde-format 7701 #| msgctxt "Monday" 7702 #| msgid "Mon" 7703 msgctxt "Julian weekday 1 - KLocale::ShortName" 7704 msgid "Mon" 7705 msgstr "Isn" 7706 7707 #: kdecore/kcalendarsystemjulian.cpp:354 7708 #, fuzzy, kde-format 7709 #| msgctxt "Tuesday" 7710 #| msgid "Tue" 7711 msgctxt "Julian weekday 2 - KLocale::ShortName" 7712 msgid "Tue" 7713 msgstr "Sel" 7714 7715 #: kdecore/kcalendarsystemjulian.cpp:356 7716 #, fuzzy, kde-format 7717 #| msgctxt "Wednesday" 7718 #| msgid "Wed" 7719 msgctxt "Julian weekday 3 - KLocale::ShortName" 7720 msgid "Wed" 7721 msgstr "Rab" 7722 7723 #: kdecore/kcalendarsystemjulian.cpp:358 7724 #, fuzzy, kde-format 7725 #| msgctxt "Thursday" 7726 #| msgid "Thu" 7727 msgctxt "Julian weekday 4 - KLocale::ShortName" 7728 msgid "Thu" 7729 msgstr "Kha" 7730 7731 #: kdecore/kcalendarsystemjulian.cpp:360 7732 #, fuzzy, kde-format 7733 #| msgctxt "Friday" 7734 #| msgid "Fri" 7735 msgctxt "Julian weekday 5 - KLocale::ShortName" 7736 msgid "Fri" 7737 msgstr "Jum" 7738 7739 #: kdecore/kcalendarsystemjulian.cpp:362 7740 #, fuzzy, kde-format 7741 #| msgctxt "Saturday" 7742 #| msgid "Sat" 7743 msgctxt "Julian weekday 6 - KLocale::ShortName" 7744 msgid "Sat" 7745 msgstr "Sab" 7746 7747 #: kdecore/kcalendarsystemjulian.cpp:364 7748 #, fuzzy, kde-format 7749 #| msgctxt "Sunday" 7750 #| msgid "Sun" 7751 msgctxt "Julian weekday 7 - KLocale::ShortName" 7752 msgid "Sun" 7753 msgstr "Aha" 7754 7755 #: kdecore/kcalendarsystemjulian.cpp:371 7756 #, fuzzy, kde-format 7757 #| msgid "Monday" 7758 msgctxt "Julian weekday 1 - KLocale::LongName" 7759 msgid "Monday" 7760 msgstr "Isnin" 7761 7762 #: kdecore/kcalendarsystemjulian.cpp:373 7763 #, fuzzy, kde-format 7764 #| msgid "Tuesday" 7765 msgctxt "Julian weekday 2 - KLocale::LongName" 7766 msgid "Tuesday" 7767 msgstr "Selasa" 7768 7769 #: kdecore/kcalendarsystemjulian.cpp:375 7770 #, fuzzy, kde-format 7771 #| msgid "Wednesday" 7772 msgctxt "Julian weekday 3 - KLocale::LongName" 7773 msgid "Wednesday" 7774 msgstr "Rabu" 7775 7776 #: kdecore/kcalendarsystemjulian.cpp:377 7777 #, fuzzy, kde-format 7778 #| msgid "Thursday" 7779 msgctxt "Julian weekday 4 - KLocale::LongName" 7780 msgid "Thursday" 7781 msgstr "Khamis" 7782 7783 #: kdecore/kcalendarsystemjulian.cpp:379 7784 #, fuzzy, kde-format 7785 #| msgid "Friday" 7786 msgctxt "Julian weekday 5 - KLocale::LongName" 7787 msgid "Friday" 7788 msgstr "Jumaat" 7789 7790 #: kdecore/kcalendarsystemjulian.cpp:381 7791 #, fuzzy, kde-format 7792 #| msgid "Saturday" 7793 msgctxt "Julian weekday 6 - KLocale::LongName" 7794 msgid "Saturday" 7795 msgstr "Sabtu" 7796 7797 #: kdecore/kcalendarsystemjulian.cpp:383 7798 #, fuzzy, kde-format 7799 #| msgid "Sunday" 7800 msgctxt "Julian weekday 7 - KLocale::LongName" 7801 msgid "Sunday" 7802 msgstr "Ahad" 7803 7804 #: kdecore/kcalendarsystemminguo.cpp:57 7805 #, kde-format 7806 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7807 msgid "Republic of China Era" 7808 msgstr "" 7809 7810 #: kdecore/kcalendarsystemminguo.cpp:58 7811 #, kde-format 7812 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7813 msgid "ROC" 7814 msgstr "" 7815 7816 #: kdecore/kcalendarsystemminguo.cpp:59 7817 #, kde-format 7818 msgctxt "" 7819 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7820 msgid "%EC %Ey" 7821 msgstr "" 7822 7823 #: kdecore/kcalendarsystemthai.cpp:58 7824 #, kde-format 7825 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7826 msgid "Buddhist Era" 7827 msgstr "" 7828 7829 #: kdecore/kcalendarsystemthai.cpp:59 7830 #, kde-format 7831 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7832 msgid "BE" 7833 msgstr "" 7834 7835 #: kdecore/kcalendarsystemthai.cpp:60 7836 #, kde-format 7837 msgctxt "" 7838 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7839 msgid "%Ey %EC" 7840 msgstr "" 7841 7842 #: kdecore/kcmdlineargs.cpp:278 7843 #, kde-format 7844 msgid "Use the X-server display 'displayname'" 7845 msgstr "Guna paparan pelayan-X 'displayname'" 7846 7847 #: kdecore/kcmdlineargs.cpp:281 7848 #, kde-format 7849 msgid "Restore the application for the given 'sessionId'" 7850 msgstr "Simpan semula aplikasi untuk 'sessionld'" 7851 7852 #: kdecore/kcmdlineargs.cpp:282 7853 #, kde-format 7854 msgid "" 7855 "Causes the application to install a private color\n" 7856 "map on an 8-bit display" 7857 msgstr "" 7858 "Menyebabkan aplikasi memasang peta warna persendirian\n" 7859 "pada paparan 8 bit" 7860 7861 #: kdecore/kcmdlineargs.cpp:283 7862 #, kde-format 7863 msgid "" 7864 "Limits the number of colors allocated in the color\n" 7865 "cube on an 8-bit display, if the application is\n" 7866 "using the QApplication::ManyColor color\n" 7867 "specification" 7868 msgstr "" 7869 "Hadkan bilangan warna yang diuntukkan dalam kiub\n" 7870 "warna dalam paparan 8 bit, jika aplikasi\n" 7871 "menggunakan spesifikasi warna\n" 7872 "QApplication::ManyColor" 7873 7874 #: kdecore/kcmdlineargs.cpp:284 7875 #, kde-format 7876 msgid "tells Qt to never grab the mouse or the keyboard" 7877 msgstr "" 7878 "memberitahu Qt agar jangan sesekali mencakup tetikus atau papan kekunci" 7879 7880 #: kdecore/kcmdlineargs.cpp:285 7881 #, kde-format 7882 msgid "" 7883 "running under a debugger can cause an implicit\n" 7884 "-nograb, use -dograb to override" 7885 msgstr "" 7886 "berjalan di bawah penyahpepijat boleh menyebabkan \n" 7887 "-nograb yang tidak jelas, guna -dograb untuk menulis tindih" 7888 7889 #: kdecore/kcmdlineargs.cpp:286 7890 #, kde-format 7891 msgid "switches to synchronous mode for debugging" 7892 msgstr "tukar ke mod segerak untuk nyahpepijat" 7893 7894 #: kdecore/kcmdlineargs.cpp:288 7895 #, kde-format 7896 msgid "defines the application font" 7897 msgstr "mentakrifkan font aplikasi" 7898 7899 #: kdecore/kcmdlineargs.cpp:290 7900 #, kde-format 7901 msgid "" 7902 "sets the default background color and an\n" 7903 "application palette (light and dark shades are\n" 7904 "calculated)" 7905 msgstr "" 7906 "mengeset warna latar belakang piawai dan\n" 7907 "palet aplikasi (warna cerah dan gelap adalah\n" 7908 "dikira)" 7909 7910 #: kdecore/kcmdlineargs.cpp:292 7911 #, kde-format 7912 msgid "sets the default foreground color" 7913 msgstr "menetapkan warna latarbelakang default" 7914 7915 #: kdecore/kcmdlineargs.cpp:294 7916 #, kde-format 7917 msgid "sets the default button color" 7918 msgstr "tetap warna butang default" 7919 7920 #: kdecore/kcmdlineargs.cpp:295 7921 #, kde-format 7922 msgid "sets the application name" 7923 msgstr "tetap nama aplikasi" 7924 7925 #: kdecore/kcmdlineargs.cpp:296 7926 #, kde-format 7927 msgid "sets the application title (caption)" 7928 msgstr "tetap tajuk aplikasi (keterangan)" 7929 7930 #: kdecore/kcmdlineargs.cpp:297 7931 #, kde-format 7932 msgid "load the testability framework" 7933 msgstr "" 7934 7935 #: kdecore/kcmdlineargs.cpp:299 7936 #, kde-format 7937 msgid "" 7938 "forces the application to use a TrueColor visual on\n" 7939 "an 8-bit display" 7940 msgstr "" 7941 "memaksa aplikasi menggunakan visual Warna Sebenar dalam\n" 7942 "paparan 8 bit" 7943 7944 #: kdecore/kcmdlineargs.cpp:300 7945 #, kde-format 7946 msgid "" 7947 "sets XIM (X Input Method) input style. Possible\n" 7948 "values are onthespot, overthespot, offthespot and\n" 7949 "root" 7950 msgstr "" 7951 "mengeset gaya input XIM (Kaedah Input X). Nilai\n" 7952 "mungkin adalah onthespot, overthespot, offthespot dan\n" 7953 "root" 7954 7955 #: kdecore/kcmdlineargs.cpp:301 7956 #, kde-format 7957 msgid "set XIM server" 7958 msgstr "tetap pelayan XIM" 7959 7960 #: kdecore/kcmdlineargs.cpp:302 7961 #, kde-format 7962 msgid "disable XIM" 7963 msgstr "matikan XIM" 7964 7965 #: kdecore/kcmdlineargs.cpp:304 7966 #, kde-format 7967 msgid "mirrors the whole layout of widgets" 7968 msgstr "cerminkan keseluruhan susunatur widget" 7969 7970 #: kdecore/kcmdlineargs.cpp:305 7971 #, kde-format 7972 msgid "applies the Qt stylesheet to the application widgets" 7973 msgstr "menerapkan helaian gaya Qt kepada widget aplikasi" 7974 7975 #: kdecore/kcmdlineargs.cpp:306 7976 #, kde-format 7977 msgid "" 7978 "use a different graphics system instead of the default one, options are " 7979 "raster and opengl (experimental)" 7980 msgstr "" 7981 "guna sistem grafik berlainan berbanding yang default, pilihan adalah raster " 7982 "dan opengl (eksperimental)" 7983 7984 #: kdecore/kcmdlineargs.cpp:307 7985 #, kde-format 7986 msgid "" 7987 "QML JS debugger information. Application must be\n" 7988 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7989 "enabled" 7990 msgstr "" 7991 7992 #: kdecore/kcmdlineargs.cpp:308 7993 #, kde-format 7994 msgid "The windowing system platform (e.g. xcb or wayland)" 7995 msgstr "" 7996 7997 #: kdecore/kcmdlineargs.cpp:310 7998 #, kde-format 7999 msgid "Use 'caption' as name in the titlebar" 8000 msgstr "Gunakan 'caption' sebagai nama di bar tajuk" 8001 8002 #: kdecore/kcmdlineargs.cpp:311 8003 #, kde-format 8004 msgid "Use 'icon' as the application icon" 8005 msgstr "Guna 'icon' sebagai ikon aplikasi" 8006 8007 #: kdecore/kcmdlineargs.cpp:312 8008 #, kde-format 8009 msgid "Use alternative configuration file" 8010 msgstr "Guna fail tetapan alternatif" 8011 8012 #: kdecore/kcmdlineargs.cpp:313 8013 #, kde-format 8014 msgid "Disable crash handler, to get core dumps" 8015 msgstr "Matikan pengendali kerosakan, untuk mendapatkan longgokan teras" 8016 8017 #: kdecore/kcmdlineargs.cpp:315 8018 #, kde-format 8019 msgid "Waits for a WM_NET compatible windowmanager" 8020 msgstr "Menunggu untuk pengurus tetingkap serasi WM_NET" 8021 8022 #: kdecore/kcmdlineargs.cpp:317 8023 #, kde-format 8024 msgid "sets the application GUI style" 8025 msgstr "tetap gaya GUI aplikasi" 8026 8027 #: kdecore/kcmdlineargs.cpp:318 8028 #, kde-format 8029 msgid "" 8030 "sets the client geometry of the main widget - see man X for the argument " 8031 "format (usually WidthxHeight+XPos+YPos)" 8032 msgstr "" 8033 "tetap geometri klien bagi widget utama - lihat manual X bagi format hujah " 8034 "(biasanya WidthxHeight+XPos+YPos)" 8035 8036 #: kdecore/kcmdlineargs.cpp:436 8037 #, kde-format 8038 msgid "KDE Application" 8039 msgstr "Aplikasi KDE" 8040 8041 #: kdecore/kcmdlineargs.cpp:497 8042 #, kde-format 8043 msgid "Qt" 8044 msgstr "Qt" 8045 8046 #: kdecore/kcmdlineargs.cpp:500 8047 #, kde-format 8048 msgid "KDE" 8049 msgstr "KDE" 8050 8051 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 8052 #, fuzzy, kde-format 8053 msgid "Unknown option '%1'." 8054 msgstr "Kod ralat tak dikenal %d\n" 8055 8056 #: kdecore/kcmdlineargs.cpp:841 8057 #, kde-format 8058 msgctxt "@info:shell %1 is cmdoption name" 8059 msgid "'%1' missing." 8060 msgstr "'%1' hilang." 8061 8062 #: kdecore/kcmdlineargs.cpp:895 8063 #, fuzzy, kde-format 8064 #| msgctxt "" 8065 #| "@info:shell message on appcmd --version; do not translate 'Development " 8066 #| "Platform'%3 application name, other %n version strings" 8067 #| msgid "" 8068 #| "Qt: %1\n" 8069 #| "KDE Development Platform: %2\n" 8070 #| "%3: %4\n" 8071 msgctxt "" 8072 "@info:shell message on appcmd --version; do not translate 'Development " 8073 "Platform'%3 application name, other %n version strings" 8074 msgid "" 8075 "Qt: %1\n" 8076 "KDE Frameworks: %2\n" 8077 "%3: %4\n" 8078 msgstr "" 8079 "Qt: %1\n" 8080 "Platform Pembangunan KDE: %2\n" 8081 "%3: %4\n" 8082 8083 #: kdecore/kcmdlineargs.cpp:921 8084 #, kde-format 8085 msgctxt "the 2nd argument is a list of name+address, one on each line" 8086 msgid "" 8087 "%1 was written by\n" 8088 "%2" 8089 msgstr "" 8090 "%1 ditulis oleh\n" 8091 "%2" 8092 8093 #: kdecore/kcmdlineargs.cpp:924 8094 #, kde-format 8095 msgid "This application was written by somebody who wants to remain anonymous." 8096 msgstr "" 8097 8098 #: kdecore/kcmdlineargs.cpp:929 8099 #, kde-format 8100 msgid "Please use http://bugs.kde.org to report bugs.\n" 8101 msgstr "" 8102 8103 #: kdecore/kcmdlineargs.cpp:931 8104 #, kde-format 8105 msgid "Please report bugs to %1.\n" 8106 msgstr "" 8107 8108 #: kdecore/kcmdlineargs.cpp:961 8109 #, kde-format 8110 msgid "Unexpected argument '%1'." 8111 msgstr "" 8112 8113 #: kdecore/kcmdlineargs.cpp:1074 8114 #, kde-format 8115 msgid "Use --help to get a list of available command line options." 8116 msgstr "" 8117 8118 #: kdecore/kcmdlineargs.cpp:1096 8119 #, kde-format 8120 msgid "[options] " 8121 msgstr "" 8122 8123 #: kdecore/kcmdlineargs.cpp:1101 8124 #, kde-format 8125 msgid "[%1-options]" 8126 msgstr "" 8127 8128 #: kdecore/kcmdlineargs.cpp:1122 8129 #, kde-format 8130 msgid "Usage: %1 %2\n" 8131 msgstr "" 8132 8133 #: kdecore/kcmdlineargs.cpp:1125 8134 #, kde-format 8135 msgid "" 8136 "\n" 8137 "Generic options:\n" 8138 msgstr "" 8139 8140 #: kdecore/kcmdlineargs.cpp:1127 8141 #, kde-format 8142 msgid "Show help about options" 8143 msgstr "" 8144 8145 #: kdecore/kcmdlineargs.cpp:1133 8146 #, kde-format 8147 msgid "Show %1 specific options" 8148 msgstr "" 8149 8150 #: kdecore/kcmdlineargs.cpp:1140 8151 #, kde-format 8152 msgid "Show all options" 8153 msgstr "" 8154 8155 #: kdecore/kcmdlineargs.cpp:1141 8156 #, kde-format 8157 msgid "Show author information" 8158 msgstr "" 8159 8160 #: kdecore/kcmdlineargs.cpp:1142 8161 #, kde-format 8162 msgid "Show version information" 8163 msgstr "" 8164 8165 #: kdecore/kcmdlineargs.cpp:1143 8166 #, kde-format 8167 msgid "Show license information" 8168 msgstr "" 8169 8170 #: kdecore/kcmdlineargs.cpp:1144 8171 #, kde-format 8172 msgid "End of options" 8173 msgstr "" 8174 8175 #: kdecore/kcmdlineargs.cpp:1164 8176 #, kde-format 8177 msgid "" 8178 "\n" 8179 "%1 options:\n" 8180 msgstr "" 8181 8182 #: kdecore/kcmdlineargs.cpp:1166 8183 #, kde-format 8184 msgid "" 8185 "\n" 8186 "Options:\n" 8187 msgstr "" 8188 8189 #: kdecore/kcmdlineargs.cpp:1219 8190 #, kde-format 8191 msgid "" 8192 "\n" 8193 "Arguments:\n" 8194 msgstr "" 8195 8196 #: kdecore/kcmdlineargs.cpp:1580 8197 #, kde-format 8198 msgid "The files/URLs opened by the application will be deleted after use" 8199 msgstr "Fail/URL yang dibuka oleh aplikasi akan dihapuskan selepas diguna" 8200 8201 #: kdecore/kcmdlineargs.cpp:1581 8202 #, kde-format 8203 msgid "KDE-tempfile" 8204 msgstr "KDE fail sementara" 8205 8206 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8207 #: kdecore/kdatetime.cpp:2985 8208 #, fuzzy, kde-format 8209 msgid "am" 8210 msgstr "am" 8211 8212 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8213 #: kdecore/kdatetime.cpp:2990 8214 #, kde-format 8215 msgid "pm" 8216 msgstr "pm" 8217 8218 #: kdecore/klibloader.cpp:100 8219 #, kde-format 8220 msgid "Library \"%1\" not found" 8221 msgstr "Pustaka \"%1\" tidak dijumpai" 8222 8223 #: kdecore/klocale_kde.cpp:785 8224 #, kde-format 8225 msgctxt "digit set" 8226 msgid "Arabic-Indic" 8227 msgstr "Arab-Indic" 8228 8229 #: kdecore/klocale_kde.cpp:788 8230 #, kde-format 8231 msgctxt "digit set" 8232 msgid "Bengali" 8233 msgstr "Bengali" 8234 8235 #: kdecore/klocale_kde.cpp:791 8236 #, kde-format 8237 msgctxt "digit set" 8238 msgid "Devanagari" 8239 msgstr "Devanagari" 8240 8241 #: kdecore/klocale_kde.cpp:794 8242 #, kde-format 8243 msgctxt "digit set" 8244 msgid "Eastern Arabic-Indic" 8245 msgstr "Arab-Indic Timur" 8246 8247 #: kdecore/klocale_kde.cpp:797 8248 #, kde-format 8249 msgctxt "digit set" 8250 msgid "Gujarati" 8251 msgstr "Gujarati" 8252 8253 #: kdecore/klocale_kde.cpp:800 8254 #, kde-format 8255 msgctxt "digit set" 8256 msgid "Gurmukhi" 8257 msgstr "Gurmukhi" 8258 8259 #: kdecore/klocale_kde.cpp:803 8260 #, kde-format 8261 msgctxt "digit set" 8262 msgid "Kannada" 8263 msgstr "Kannada" 8264 8265 #: kdecore/klocale_kde.cpp:806 8266 #, kde-format 8267 msgctxt "digit set" 8268 msgid "Khmer" 8269 msgstr "Khmer" 8270 8271 #: kdecore/klocale_kde.cpp:809 8272 #, kde-format 8273 msgctxt "digit set" 8274 msgid "Malayalam" 8275 msgstr "Malayalam" 8276 8277 #: kdecore/klocale_kde.cpp:812 8278 #, kde-format 8279 msgctxt "digit set" 8280 msgid "Oriya" 8281 msgstr "Oriya" 8282 8283 #: kdecore/klocale_kde.cpp:815 8284 #, kde-format 8285 msgctxt "digit set" 8286 msgid "Tamil" 8287 msgstr "Tamil" 8288 8289 #: kdecore/klocale_kde.cpp:818 8290 #, kde-format 8291 msgctxt "digit set" 8292 msgid "Telugu" 8293 msgstr "Telugu" 8294 8295 #: kdecore/klocale_kde.cpp:821 8296 #, fuzzy, kde-format 8297 #| msgid "R. Thaani" 8298 msgctxt "digit set" 8299 msgid "Thai" 8300 msgstr "R. Thaani" 8301 8302 #: kdecore/klocale_kde.cpp:824 8303 #, kde-format 8304 msgctxt "digit set" 8305 msgid "Arabic" 8306 msgstr "Arab" 8307 8308 #: kdecore/klocale_kde.cpp:829 8309 #, kde-format 8310 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8311 msgid "%1 (%2)" 8312 msgstr "%1 (%2)" 8313 8314 #. i18n: comments below, they are used by the 8315 #. translators. 8316 #. This prefix is shared by all current dialects. 8317 #. i18n: Dumb message, avoid any markup or scripting. 8318 #: kdecore/klocale_kde.cpp:1327 8319 #, kde-format 8320 msgctxt "size in bytes" 8321 msgid "%1 B" 8322 msgstr "%1 B" 8323 8324 #. i18n: Dumb message, avoid any markup or scripting. 8325 #: kdecore/klocale_kde.cpp:1332 8326 #, kde-format 8327 msgctxt "size in 1000 bytes" 8328 msgid "%1 kB" 8329 msgstr "%1 kB" 8330 8331 #. i18n: Dumb message, avoid any markup or scripting. 8332 #: kdecore/klocale_kde.cpp:1334 8333 #, kde-format 8334 msgctxt "size in 10^6 bytes" 8335 msgid "%1 MB" 8336 msgstr "%1 MB" 8337 8338 #. i18n: Dumb message, avoid any markup or scripting. 8339 #: kdecore/klocale_kde.cpp:1336 8340 #, kde-format 8341 msgctxt "size in 10^9 bytes" 8342 msgid "%1 GB" 8343 msgstr "%1 GB" 8344 8345 #. i18n: Dumb message, avoid any markup or scripting. 8346 #: kdecore/klocale_kde.cpp:1338 8347 #, kde-format 8348 msgctxt "size in 10^12 bytes" 8349 msgid "%1 TB" 8350 msgstr "%1 TB" 8351 8352 #. i18n: Dumb message, avoid any markup or scripting. 8353 #: kdecore/klocale_kde.cpp:1340 8354 #, kde-format 8355 msgctxt "size in 10^15 bytes" 8356 msgid "%1 PB" 8357 msgstr "%1 PB" 8358 8359 #. i18n: Dumb message, avoid any markup or scripting. 8360 #: kdecore/klocale_kde.cpp:1342 8361 #, kde-format 8362 msgctxt "size in 10^18 bytes" 8363 msgid "%1 EB" 8364 msgstr "%1 EB" 8365 8366 #. i18n: Dumb message, avoid any markup or scripting. 8367 #: kdecore/klocale_kde.cpp:1344 8368 #, kde-format 8369 msgctxt "size in 10^21 bytes" 8370 msgid "%1 ZB" 8371 msgstr "%1 ZB" 8372 8373 #. i18n: Dumb message, avoid any markup or scripting. 8374 #: kdecore/klocale_kde.cpp:1346 8375 #, kde-format 8376 msgctxt "size in 10^24 bytes" 8377 msgid "%1 YB" 8378 msgstr "%1 YB" 8379 8380 #. i18n: Dumb message, avoid any markup or scripting. 8381 #: kdecore/klocale_kde.cpp:1351 8382 #, kde-format 8383 msgctxt "memory size in 1024 bytes" 8384 msgid "%1 KB" 8385 msgstr "%1 KB" 8386 8387 #. i18n: Dumb message, avoid any markup or scripting. 8388 #: kdecore/klocale_kde.cpp:1353 8389 #, kde-format 8390 msgctxt "memory size in 2^20 bytes" 8391 msgid "%1 MB" 8392 msgstr "%1 MB" 8393 8394 #. i18n: Dumb message, avoid any markup or scripting. 8395 #: kdecore/klocale_kde.cpp:1355 8396 #, kde-format 8397 msgctxt "memory size in 2^30 bytes" 8398 msgid "%1 GB" 8399 msgstr "%1 GB" 8400 8401 #. i18n: Dumb message, avoid any markup or scripting. 8402 #: kdecore/klocale_kde.cpp:1357 8403 #, kde-format 8404 msgctxt "memory size in 2^40 bytes" 8405 msgid "%1 TB" 8406 msgstr "%1 TB" 8407 8408 #. i18n: Dumb message, avoid any markup or scripting. 8409 #: kdecore/klocale_kde.cpp:1359 8410 #, kde-format 8411 msgctxt "memory size in 2^50 bytes" 8412 msgid "%1 PB" 8413 msgstr "%1 PB" 8414 8415 #. i18n: Dumb message, avoid any markup or scripting. 8416 #: kdecore/klocale_kde.cpp:1361 8417 #, kde-format 8418 msgctxt "memory size in 2^60 bytes" 8419 msgid "%1 EB" 8420 msgstr "%1 EB" 8421 8422 #. i18n: Dumb message, avoid any markup or scripting. 8423 #: kdecore/klocale_kde.cpp:1363 8424 #, kde-format 8425 msgctxt "memory size in 2^70 bytes" 8426 msgid "%1 ZB" 8427 msgstr "%1 ZB" 8428 8429 #. i18n: Dumb message, avoid any markup or scripting. 8430 #: kdecore/klocale_kde.cpp:1365 8431 #, kde-format 8432 msgctxt "memory size in 2^80 bytes" 8433 msgid "%1 YB" 8434 msgstr "%1 YB" 8435 8436 #. i18n: Dumb message, avoid any markup or scripting. 8437 #: kdecore/klocale_kde.cpp:1371 8438 #, kde-format 8439 msgctxt "size in 1024 bytes" 8440 msgid "%1 KiB" 8441 msgstr "%1 KiB" 8442 8443 #. i18n: Dumb message, avoid any markup or scripting. 8444 #: kdecore/klocale_kde.cpp:1373 8445 #, kde-format 8446 msgctxt "size in 2^20 bytes" 8447 msgid "%1 MiB" 8448 msgstr "%1 MiB" 8449 8450 #. i18n: Dumb message, avoid any markup or scripting. 8451 #: kdecore/klocale_kde.cpp:1375 8452 #, kde-format 8453 msgctxt "size in 2^30 bytes" 8454 msgid "%1 GiB" 8455 msgstr "%1 GiB" 8456 8457 #. i18n: Dumb message, avoid any markup or scripting. 8458 #: kdecore/klocale_kde.cpp:1377 8459 #, kde-format 8460 msgctxt "size in 2^40 bytes" 8461 msgid "%1 TiB" 8462 msgstr "%1 TiB" 8463 8464 #. i18n: Dumb message, avoid any markup or scripting. 8465 #: kdecore/klocale_kde.cpp:1379 8466 #, kde-format 8467 msgctxt "size in 2^50 bytes" 8468 msgid "%1 PiB" 8469 msgstr "%1 PiB" 8470 8471 #. i18n: Dumb message, avoid any markup or scripting. 8472 #: kdecore/klocale_kde.cpp:1381 8473 #, kde-format 8474 msgctxt "size in 2^60 bytes" 8475 msgid "%1 EiB" 8476 msgstr "%1 EiB" 8477 8478 #. i18n: Dumb message, avoid any markup or scripting. 8479 #: kdecore/klocale_kde.cpp:1383 8480 #, kde-format 8481 msgctxt "size in 2^70 bytes" 8482 msgid "%1 ZiB" 8483 msgstr "%1 ZiB" 8484 8485 #. i18n: Dumb message, avoid any markup or scripting. 8486 #: kdecore/klocale_kde.cpp:1385 8487 #, kde-format 8488 msgctxt "size in 2^80 bytes" 8489 msgid "%1 YiB" 8490 msgstr "%1 YiB" 8491 8492 #: kdecore/klocale_kde.cpp:1472 8493 #, kde-format 8494 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8495 msgid "%1 days" 8496 msgstr "%1 hari" 8497 8498 #: kdecore/klocale_kde.cpp:1475 8499 #, kde-format 8500 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8501 msgid "%1 hours" 8502 msgstr "%1 jam" 8503 8504 #: kdecore/klocale_kde.cpp:1478 8505 #, kde-format 8506 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8507 msgid "%1 minutes" 8508 msgstr "%1 minit" 8509 8510 #: kdecore/klocale_kde.cpp:1481 8511 #, kde-format 8512 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8513 msgid "%1 seconds" 8514 msgstr "%1 saat" 8515 8516 #: kdecore/klocale_kde.cpp:1484 8517 #, kde-format 8518 msgctxt "@item:intext" 8519 msgid "%1 millisecond" 8520 msgid_plural "%1 milliseconds" 8521 msgstr[0] "" 8522 msgstr[1] "" 8523 8524 #: kdecore/klocale_kde.cpp:1491 8525 #, kde-format 8526 msgctxt "@item:intext" 8527 msgid "1 day" 8528 msgid_plural "%1 days" 8529 msgstr[0] "" 8530 msgstr[1] "" 8531 8532 #: kdecore/klocale_kde.cpp:1493 8533 #, kde-format 8534 msgctxt "@item:intext" 8535 msgid "1 hour" 8536 msgid_plural "%1 hours" 8537 msgstr[0] "" 8538 msgstr[1] "" 8539 8540 #: kdecore/klocale_kde.cpp:1495 8541 #, kde-format 8542 msgctxt "@item:intext" 8543 msgid "1 minute" 8544 msgid_plural "%1 minutes" 8545 msgstr[0] "" 8546 msgstr[1] "" 8547 8548 #: kdecore/klocale_kde.cpp:1497 8549 #, kde-format 8550 msgctxt "@item:intext" 8551 msgid "1 second" 8552 msgid_plural "%1 seconds" 8553 msgstr[0] "" 8554 msgstr[1] "" 8555 8556 #: kdecore/klocale_kde.cpp:1521 8557 #, kde-format 8558 msgctxt "" 8559 "@item:intext days and hours. This uses the previous item:intext messages. If " 8560 "this does not fit the grammar of your language please contact the i18n team " 8561 "to solve the problem" 8562 msgid "%1 and %2" 8563 msgstr "%1 dan %2" 8564 8565 #: kdecore/klocale_kde.cpp:1527 8566 #, kde-format 8567 msgctxt "" 8568 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8569 "If this does not fit the grammar of your language please contact the i18n " 8570 "team to solve the problem" 8571 msgid "%1 and %2" 8572 msgstr "%1 dan %2" 8573 8574 #: kdecore/klocale_kde.cpp:1534 8575 #, kde-format 8576 msgctxt "" 8577 "@item:intext minutes and seconds. This uses the previous item:intext " 8578 "messages. If this does not fit the grammar of your language please contact " 8579 "the i18n team to solve the problem" 8580 msgid "%1 and %2" 8581 msgstr "%1 dan %2" 8582 8583 #: kdecore/klocale_kde.cpp:2153 8584 #, kde-format 8585 msgctxt "Before Noon KLocale::LongName" 8586 msgid "Ante Meridiem" 8587 msgstr "Ante Meridiem" 8588 8589 #: kdecore/klocale_kde.cpp:2154 8590 #, fuzzy, kde-format 8591 #| msgid "Av" 8592 msgctxt "Before Noon KLocale::ShortName" 8593 msgid "AM" 8594 msgstr "Av" 8595 8596 #: kdecore/klocale_kde.cpp:2155 8597 #, fuzzy, kde-format 8598 #| msgid "Av" 8599 msgctxt "Before Noon KLocale::NarrowName" 8600 msgid "A" 8601 msgstr "Av" 8602 8603 #: kdecore/klocale_kde.cpp:2158 8604 #, kde-format 8605 msgctxt "After Noon KLocale::LongName" 8606 msgid "Post Meridiem" 8607 msgstr "Post Meridiem" 8608 8609 #: kdecore/klocale_kde.cpp:2159 8610 #, kde-format 8611 msgctxt "After Noon KLocale::ShortName" 8612 msgid "PM" 8613 msgstr "PM" 8614 8615 #: kdecore/klocale_kde.cpp:2160 8616 #, kde-format 8617 msgctxt "After Noon KLocale::NarrowName" 8618 msgid "P" 8619 msgstr "P" 8620 8621 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8622 #, kde-format 8623 msgctxt "concatenation of dates and time" 8624 msgid "%1 %2" 8625 msgstr "%1 %2" 8626 8627 #: kdecore/klocale_kde.cpp:2267 8628 #, kde-format 8629 msgctxt "concatenation of date/time and time zone" 8630 msgid "%1 %2" 8631 msgstr "%1 %2" 8632 8633 #: kdecore/ksavefile.cpp:99 8634 #, kde-format 8635 msgid "No target filename has been given." 8636 msgstr "" 8637 8638 #: kdecore/ksavefile.cpp:106 8639 #, kde-format 8640 msgid "Already opened." 8641 msgstr "" 8642 8643 #: kdecore/ksavefile.cpp:135 8644 #, kde-format 8645 msgid "Insufficient permissions in target directory." 8646 msgstr "" 8647 8648 #: kdecore/ksavefile.cpp:139 8649 #, kde-format 8650 msgid "Unable to open temporary file." 8651 msgstr "" 8652 8653 #: kdecore/ksavefile.cpp:249 8654 #, kde-format 8655 msgid "Synchronization to disk failed" 8656 msgstr "" 8657 8658 #: kdecore/ksavefile.cpp:280 8659 #, kde-format 8660 msgid "Error during rename." 8661 msgstr "" 8662 8663 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8664 #, kde-format 8665 msgid "Timed out trying to connect to remote host" 8666 msgstr "Masa tamat mencuba menyambung ke hos jauh" 8667 8668 #: kdecore/netsupp.cpp:866 8669 #, kde-format 8670 msgid "address family for nodename not supported" 8671 msgstr "alamat keluarga untuk nama nod tidak disokong" 8672 8673 #: kdecore/netsupp.cpp:868 8674 #, kde-format 8675 msgid "invalid value for 'ai_flags'" 8676 msgstr "nilai tidak sah untuk 'ai_flags'" 8677 8678 #: kdecore/netsupp.cpp:870 8679 #, kde-format 8680 msgid "'ai_family' not supported" 8681 msgstr "'ai_family' tidak disokong" 8682 8683 #: kdecore/netsupp.cpp:872 8684 #, kde-format 8685 msgid "no address associated with nodename" 8686 msgstr "tiada alamat dikaitkan dengan nama nod" 8687 8688 #: kdecore/netsupp.cpp:874 8689 #, kde-format 8690 msgid "servname not supported for ai_socktype" 8691 msgstr "nama pelayan tidak disokong untuk ai_socktype" 8692 8693 #: kdecore/netsupp.cpp:875 8694 #, kde-format 8695 msgid "'ai_socktype' not supported" 8696 msgstr "'ai_socktype' tidak disokong" 8697 8698 #: kdecore/netsupp.cpp:876 8699 #, kde-format 8700 msgid "system error" 8701 msgstr "Ralat sistem" 8702 8703 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8704 #, kde-format 8705 msgid "KDE Test Program" 8706 msgstr "Program Ujian KDE" 8707 8708 #: kdecore/TIMEZONES:1 8709 #, kde-format 8710 msgid "Africa/Abidjan" 8711 msgstr "Afrika/Abidjan" 8712 8713 #: kdecore/TIMEZONES:2 8714 #, kde-format 8715 msgid "Africa/Accra" 8716 msgstr "Afrika/Accra" 8717 8718 #: kdecore/TIMEZONES:3 8719 #, kde-format 8720 msgid "Africa/Addis_Ababa" 8721 msgstr "Afrika/Addis_Ababa" 8722 8723 #: kdecore/TIMEZONES:4 8724 #, kde-format 8725 msgid "Africa/Algiers" 8726 msgstr "Afrika/Algiers" 8727 8728 #: kdecore/TIMEZONES:5 8729 #, kde-format 8730 msgid "Africa/Asmara" 8731 msgstr "Afrika/Asmara" 8732 8733 #: kdecore/TIMEZONES:6 8734 #, kde-format 8735 msgid "Africa/Asmera" 8736 msgstr "Afrika/Asmera" 8737 8738 #: kdecore/TIMEZONES:7 8739 #, kde-format 8740 msgid "Africa/Bamako" 8741 msgstr "Afrika/Bamako" 8742 8743 #: kdecore/TIMEZONES:8 8744 #, kde-format 8745 msgid "Africa/Bangui" 8746 msgstr "Afrika/Bangui" 8747 8748 #: kdecore/TIMEZONES:9 8749 #, kde-format 8750 msgid "Africa/Banjul" 8751 msgstr "Afrika/Banjul" 8752 8753 #: kdecore/TIMEZONES:10 8754 #, kde-format 8755 msgid "Africa/Bissau" 8756 msgstr "Afrika/Bissau" 8757 8758 #: kdecore/TIMEZONES:11 8759 #, kde-format 8760 msgid "Africa/Blantyre" 8761 msgstr "Afrika/Blantyre" 8762 8763 #: kdecore/TIMEZONES:12 8764 #, kde-format 8765 msgid "Africa/Brazzaville" 8766 msgstr "Afrika/Brazzaville" 8767 8768 #: kdecore/TIMEZONES:13 8769 #, kde-format 8770 msgid "Africa/Bujumbura" 8771 msgstr "Afrika/Bujumbura" 8772 8773 #: kdecore/TIMEZONES:14 8774 #, kde-format 8775 msgid "Africa/Cairo" 8776 msgstr "Afrika/Kaherah" 8777 8778 #: kdecore/TIMEZONES:15 8779 #, kde-format 8780 msgid "Africa/Casablanca" 8781 msgstr "Afrika/Casablanca" 8782 8783 #: kdecore/TIMEZONES:16 8784 #, kde-format 8785 msgid "Africa/Ceuta" 8786 msgstr "Afrika/Ceuta" 8787 8788 #. i18n: comment to the previous timezone 8789 #: kdecore/TIMEZONES:18 8790 #, kde-format 8791 msgid "Ceuta & Melilla" 8792 msgstr "Ceuta & Melilla" 8793 8794 #. i18n: comment to the previous timezone 8795 #: kdecore/TIMEZONES:20 8796 #, fuzzy, kde-format 8797 #| msgid "Ceuta & Melilla" 8798 msgid "Ceuta, Melilla" 8799 msgstr "Ceuta & Melilla" 8800 8801 #: kdecore/TIMEZONES:21 8802 #, kde-format 8803 msgid "Africa/Conakry" 8804 msgstr "Afrika/Conakry" 8805 8806 #: kdecore/TIMEZONES:22 8807 #, kde-format 8808 msgid "Africa/Dakar" 8809 msgstr "Afrika/Dakar" 8810 8811 #: kdecore/TIMEZONES:23 8812 #, kde-format 8813 msgid "Africa/Dar_es_Salaam" 8814 msgstr "Afrika/Dar_es_Salaam" 8815 8816 #: kdecore/TIMEZONES:24 8817 #, kde-format 8818 msgid "Africa/Djibouti" 8819 msgstr "Afrika/Djibouti" 8820 8821 #: kdecore/TIMEZONES:25 8822 #, kde-format 8823 msgid "Africa/Douala" 8824 msgstr "Afrika/Douala" 8825 8826 #: kdecore/TIMEZONES:26 8827 #, kde-format 8828 msgid "Africa/El_Aaiun" 8829 msgstr "Afrika/El_Aaiun" 8830 8831 #: kdecore/TIMEZONES:27 8832 #, kde-format 8833 msgid "Africa/Freetown" 8834 msgstr "Afrika/Freetown" 8835 8836 #: kdecore/TIMEZONES:28 8837 #, kde-format 8838 msgid "Africa/Gaborone" 8839 msgstr "Afrika/Gaborone" 8840 8841 #: kdecore/TIMEZONES:29 8842 #, kde-format 8843 msgid "Africa/Harare" 8844 msgstr "Afrika/Harare" 8845 8846 #: kdecore/TIMEZONES:30 8847 #, kde-format 8848 msgid "Africa/Johannesburg" 8849 msgstr "Afrika/Johannesburg" 8850 8851 #: kdecore/TIMEZONES:31 8852 #, fuzzy, kde-format 8853 #| msgid "Africa/Ceuta" 8854 msgid "Africa/Juba" 8855 msgstr "Afrika/Ceuta" 8856 8857 #: kdecore/TIMEZONES:32 8858 #, kde-format 8859 msgid "Africa/Kampala" 8860 msgstr "Afrika/Kampala" 8861 8862 #: kdecore/TIMEZONES:33 8863 #, kde-format 8864 msgid "Africa/Khartoum" 8865 msgstr "Afrika/Khartoum" 8866 8867 #: kdecore/TIMEZONES:34 8868 #, kde-format 8869 msgid "Africa/Kigali" 8870 msgstr "Afrika/Kigali" 8871 8872 #: kdecore/TIMEZONES:35 8873 #, kde-format 8874 msgid "Africa/Kinshasa" 8875 msgstr "Afrika/Kinshasa" 8876 8877 #. i18n: comment to the previous timezone 8878 #: kdecore/TIMEZONES:37 8879 #, kde-format 8880 msgid "west Dem. Rep. of Congo" 8881 msgstr "barat Republik Demokratik Congo" 8882 8883 #. i18n: comment to the previous timezone 8884 #: kdecore/TIMEZONES:39 8885 #, fuzzy, kde-format 8886 #| msgid "west Dem. Rep. of Congo" 8887 msgid "Dem. Rep. of Congo (west)" 8888 msgstr "barat Republik Demokratik Congo" 8889 8890 #: kdecore/TIMEZONES:40 8891 #, kde-format 8892 msgid "Africa/Lagos" 8893 msgstr "Afrika/Lagos" 8894 8895 #: kdecore/TIMEZONES:41 8896 #, kde-format 8897 msgid "Africa/Libreville" 8898 msgstr "Afrika/Libreville" 8899 8900 #: kdecore/TIMEZONES:42 8901 #, kde-format 8902 msgid "Africa/Lome" 8903 msgstr "Afrika/Lome" 8904 8905 #: kdecore/TIMEZONES:43 8906 #, kde-format 8907 msgid "Africa/Luanda" 8908 msgstr "Afrika/Luanda" 8909 8910 #: kdecore/TIMEZONES:44 8911 #, kde-format 8912 msgid "Africa/Lubumbashi" 8913 msgstr "Afrika/Lubumbashi" 8914 8915 #. i18n: comment to the previous timezone 8916 #: kdecore/TIMEZONES:46 8917 #, kde-format 8918 msgid "east Dem. Rep. of Congo" 8919 msgstr "timur Republik Demokratik Congo" 8920 8921 #. i18n: comment to the previous timezone 8922 #: kdecore/TIMEZONES:48 8923 #, fuzzy, kde-format 8924 #| msgid "east Dem. Rep. of Congo" 8925 msgid "Dem. Rep. of Congo (east)" 8926 msgstr "timur Republik Demokratik Congo" 8927 8928 #: kdecore/TIMEZONES:49 8929 #, kde-format 8930 msgid "Africa/Lusaka" 8931 msgstr "Afrika/Lusaka" 8932 8933 #: kdecore/TIMEZONES:50 8934 #, kde-format 8935 msgid "Africa/Malabo" 8936 msgstr "Afrika/Malabo" 8937 8938 #: kdecore/TIMEZONES:51 8939 #, kde-format 8940 msgid "Africa/Maputo" 8941 msgstr "Afrika/Maputo" 8942 8943 #: kdecore/TIMEZONES:52 8944 #, kde-format 8945 msgid "Africa/Maseru" 8946 msgstr "Afrika/Maseru" 8947 8948 #: kdecore/TIMEZONES:53 8949 #, kde-format 8950 msgid "Africa/Mbabane" 8951 msgstr "Afrika/Mbabane" 8952 8953 #: kdecore/TIMEZONES:54 8954 #, kde-format 8955 msgid "Africa/Mogadishu" 8956 msgstr "Afrika/Mogadishu" 8957 8958 #: kdecore/TIMEZONES:55 8959 #, kde-format 8960 msgid "Africa/Monrovia" 8961 msgstr "Afrika/Monrovia" 8962 8963 #: kdecore/TIMEZONES:56 8964 #, kde-format 8965 msgid "Africa/Nairobi" 8966 msgstr "Afrika/Nairobi" 8967 8968 #: kdecore/TIMEZONES:57 8969 #, kde-format 8970 msgid "Africa/Ndjamena" 8971 msgstr "Afrika/Ndjamena" 8972 8973 #: kdecore/TIMEZONES:58 8974 #, kde-format 8975 msgid "Africa/Niamey" 8976 msgstr "Afrika/Niamey" 8977 8978 #: kdecore/TIMEZONES:59 8979 #, kde-format 8980 msgid "Africa/Nouakchott" 8981 msgstr "Afrika/Nouakchott" 8982 8983 #: kdecore/TIMEZONES:60 8984 #, kde-format 8985 msgid "Africa/Ouagadougou" 8986 msgstr "Afrika/Ouagadougou" 8987 8988 #: kdecore/TIMEZONES:61 8989 #, kde-format 8990 msgid "Africa/Porto-Novo" 8991 msgstr "Afrika/Porto-Novo" 8992 8993 #: kdecore/TIMEZONES:62 8994 #, kde-format 8995 msgid "Africa/Pretoria" 8996 msgstr "Africa/Pretoria" 8997 8998 #: kdecore/TIMEZONES:63 8999 #, kde-format 9000 msgid "Africa/Sao_Tome" 9001 msgstr "Afrika/Sao_Tome" 9002 9003 #: kdecore/TIMEZONES:64 9004 #, kde-format 9005 msgid "Africa/Timbuktu" 9006 msgstr "Afrika/Timbuktu" 9007 9008 #: kdecore/TIMEZONES:65 9009 #, kde-format 9010 msgid "Africa/Tripoli" 9011 msgstr "Afrika/Tripoli" 9012 9013 #: kdecore/TIMEZONES:66 9014 #, kde-format 9015 msgid "Africa/Tunis" 9016 msgstr "Afrika/Tunis" 9017 9018 #: kdecore/TIMEZONES:67 9019 #, kde-format 9020 msgid "Africa/Windhoek" 9021 msgstr "Afrika/Windhoek" 9022 9023 #: kdecore/TIMEZONES:68 9024 #, kde-format 9025 msgid "America/Adak" 9026 msgstr "Amerika/Adak" 9027 9028 #. i18n: comment to the previous timezone 9029 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 9030 #, kde-format 9031 msgid "Aleutian Islands" 9032 msgstr "" 9033 9034 #: kdecore/TIMEZONES:71 9035 #, kde-format 9036 msgid "America/Anchorage" 9037 msgstr "Amerika/Anchorage" 9038 9039 #. i18n: comment to the previous timezone 9040 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 9041 #, kde-format 9042 msgid "Alaska Time" 9043 msgstr "" 9044 9045 #. i18n: comment to the previous timezone 9046 #: kdecore/TIMEZONES:75 9047 #, kde-format 9048 msgid "Alaska (most areas)" 9049 msgstr "" 9050 9051 #: kdecore/TIMEZONES:76 9052 #, kde-format 9053 msgid "America/Anguilla" 9054 msgstr "Amerika/Anguilla" 9055 9056 #: kdecore/TIMEZONES:77 9057 #, kde-format 9058 msgid "America/Antigua" 9059 msgstr "Amerika/Antigua" 9060 9061 #: kdecore/TIMEZONES:78 9062 #, kde-format 9063 msgid "America/Araguaina" 9064 msgstr "Amerika/Araguaina" 9065 9066 #. i18n: comment to the previous timezone 9067 #: kdecore/TIMEZONES:80 9068 #, kde-format 9069 msgid "Tocantins" 9070 msgstr "" 9071 9072 #: kdecore/TIMEZONES:81 9073 #, fuzzy, kde-format 9074 msgid "America/Argentina/Buenos_Aires" 9075 msgstr "Amerika/Argentina/Buenos_Aires" 9076 9077 #. i18n: comment to the previous timezone 9078 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 9079 #, kde-format 9080 msgid "Buenos Aires (BA, CF)" 9081 msgstr "" 9082 9083 #: kdecore/TIMEZONES:84 9084 #, fuzzy, kde-format 9085 msgid "America/Argentina/Catamarca" 9086 msgstr "Amerika/Argentina/Catamarca" 9087 9088 #. i18n: comment to the previous timezone 9089 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 9090 #, kde-format 9091 msgid "Catamarca (CT), Chubut (CH)" 9092 msgstr "" 9093 9094 #. i18n: comment to the previous timezone 9095 #: kdecore/TIMEZONES:88 9096 #, kde-format 9097 msgid "Catamarca (CT); Chubut (CH)" 9098 msgstr "" 9099 9100 #: kdecore/TIMEZONES:89 9101 #, fuzzy, kde-format 9102 msgid "America/Argentina/ComodRivadavia" 9103 msgstr "Amerika/Argentina/ComodRivadavia" 9104 9105 #: kdecore/TIMEZONES:92 9106 #, fuzzy, kde-format 9107 msgid "America/Argentina/Cordoba" 9108 msgstr "Amerika/Argentina/Cordoba" 9109 9110 #. i18n: comment to the previous timezone 9111 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 9112 #, kde-format 9113 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 9114 msgstr "" 9115 9116 #. i18n: comment to the previous timezone 9117 #: kdecore/TIMEZONES:96 9118 #, kde-format 9119 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 9120 msgstr "" 9121 9122 #. i18n: comment to the previous timezone 9123 #: kdecore/TIMEZONES:98 9124 #, kde-format 9125 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 9126 msgstr "" 9127 9128 #: kdecore/TIMEZONES:99 9129 #, fuzzy, kde-format 9130 msgid "America/Argentina/Jujuy" 9131 msgstr "Amerika/Argentina/Jujuy" 9132 9133 #. i18n: comment to the previous timezone 9134 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 9135 #, kde-format 9136 msgid "Jujuy (JY)" 9137 msgstr "" 9138 9139 #: kdecore/TIMEZONES:102 9140 #, fuzzy, kde-format 9141 msgid "America/Argentina/La_Rioja" 9142 msgstr "Amerika/Argentina/La_Rioja" 9143 9144 #. i18n: comment to the previous timezone 9145 #: kdecore/TIMEZONES:104 9146 #, kde-format 9147 msgid "La Rioja (LR)" 9148 msgstr "" 9149 9150 #: kdecore/TIMEZONES:105 9151 #, fuzzy, kde-format 9152 msgid "America/Argentina/Mendoza" 9153 msgstr "Amerika/Argentina/Mendoza" 9154 9155 #. i18n: comment to the previous timezone 9156 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 9157 #, kde-format 9158 msgid "Mendoza (MZ)" 9159 msgstr "" 9160 9161 #: kdecore/TIMEZONES:108 9162 #, fuzzy, kde-format 9163 msgid "America/Argentina/Rio_Gallegos" 9164 msgstr "Amerika/Argentina/Rio_Gallegos" 9165 9166 #. i18n: comment to the previous timezone 9167 #: kdecore/TIMEZONES:110 9168 #, kde-format 9169 msgid "Santa Cruz (SC)" 9170 msgstr "" 9171 9172 #: kdecore/TIMEZONES:111 9173 #, fuzzy, kde-format 9174 msgid "America/Argentina/Salta" 9175 msgstr "Amerika/Argentina/San_Juan" 9176 9177 #. i18n: comment to the previous timezone 9178 #: kdecore/TIMEZONES:113 9179 #, kde-format 9180 msgid "(SA, LP, NQ, RN)" 9181 msgstr "" 9182 9183 #. i18n: comment to the previous timezone 9184 #: kdecore/TIMEZONES:115 9185 #, kde-format 9186 msgid "Salta (SA, LP, NQ, RN)" 9187 msgstr "" 9188 9189 #: kdecore/TIMEZONES:116 9190 #, fuzzy, kde-format 9191 msgid "America/Argentina/San_Juan" 9192 msgstr "Amerika/Argentina/San_Juan" 9193 9194 #. i18n: comment to the previous timezone 9195 #: kdecore/TIMEZONES:118 9196 #, kde-format 9197 msgid "San Juan (SJ)" 9198 msgstr "" 9199 9200 #: kdecore/TIMEZONES:119 9201 #, fuzzy, kde-format 9202 msgid "America/Argentina/San_Luis" 9203 msgstr "Amerika/Argentina/San_Juan" 9204 9205 #. i18n: comment to the previous timezone 9206 #: kdecore/TIMEZONES:121 9207 #, kde-format 9208 msgid "San Luis (SL)" 9209 msgstr "" 9210 9211 #: kdecore/TIMEZONES:122 9212 #, fuzzy, kde-format 9213 msgid "America/Argentina/Tucuman" 9214 msgstr "Amerika/Argentina/Tucuman" 9215 9216 #. i18n: comment to the previous timezone 9217 #: kdecore/TIMEZONES:124 9218 #, kde-format 9219 msgid "Tucuman (TM)" 9220 msgstr "" 9221 9222 #: kdecore/TIMEZONES:125 9223 #, fuzzy, kde-format 9224 msgid "America/Argentina/Ushuaia" 9225 msgstr "Amerika/Argentina/Ushuaia" 9226 9227 #. i18n: comment to the previous timezone 9228 #: kdecore/TIMEZONES:127 9229 #, kde-format 9230 msgid "Tierra del Fuego (TF)" 9231 msgstr "" 9232 9233 #: kdecore/TIMEZONES:128 9234 #, kde-format 9235 msgid "America/Aruba" 9236 msgstr "Amerika/Aruba" 9237 9238 #: kdecore/TIMEZONES:129 9239 #, kde-format 9240 msgid "America/Asuncion" 9241 msgstr "Amerika/Asuncion" 9242 9243 #: kdecore/TIMEZONES:130 9244 #, fuzzy, kde-format 9245 #| msgid "America/Antigua" 9246 msgid "America/Atikokan" 9247 msgstr "Amerika/Antigua" 9248 9249 #. i18n: comment to the previous timezone 9250 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 9251 #, kde-format 9252 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 9253 msgstr "" 9254 9255 #. i18n: comment to the previous timezone 9256 #: kdecore/TIMEZONES:134 9257 #, kde-format 9258 msgid "EST - ON (Atikokan); NU (Coral H)" 9259 msgstr "" 9260 9261 #: kdecore/TIMEZONES:135 9262 #, fuzzy, kde-format 9263 #| msgid "America/Antigua" 9264 msgid "America/Atka" 9265 msgstr "Amerika/Antigua" 9266 9267 #: kdecore/TIMEZONES:138 9268 #, fuzzy, kde-format 9269 msgid "America/Bahia" 9270 msgstr "Amerika/Bahia" 9271 9272 #. i18n: comment to the previous timezone 9273 #: kdecore/TIMEZONES:140 9274 #, kde-format 9275 msgid "Bahia" 9276 msgstr "" 9277 9278 #: kdecore/TIMEZONES:141 9279 #, fuzzy, kde-format 9280 msgid "America/Bahia_Banderas" 9281 msgstr "Amerika/Bahia" 9282 9283 #. i18n: comment to the previous timezone 9284 #: kdecore/TIMEZONES:143 9285 #, kde-format 9286 msgid "Mexican Central Time - Bahia de Banderas" 9287 msgstr "" 9288 9289 #. i18n: comment to the previous timezone 9290 #: kdecore/TIMEZONES:145 9291 #, kde-format 9292 msgid "Central Time - Bahia de Banderas" 9293 msgstr "" 9294 9295 #: kdecore/TIMEZONES:146 9296 #, kde-format 9297 msgid "America/Barbados" 9298 msgstr "Amerika/Barbados" 9299 9300 #: kdecore/TIMEZONES:147 9301 #, kde-format 9302 msgid "America/Belem" 9303 msgstr "Amerika/Belem" 9304 9305 #. i18n: comment to the previous timezone 9306 #: kdecore/TIMEZONES:149 9307 #, kde-format 9308 msgid "Amapa, E Para" 9309 msgstr "" 9310 9311 #. i18n: comment to the previous timezone 9312 #: kdecore/TIMEZONES:151 9313 #, kde-format 9314 msgid "Para (east); Amapa" 9315 msgstr "" 9316 9317 #: kdecore/TIMEZONES:152 9318 #, kde-format 9319 msgid "America/Belize" 9320 msgstr "Amerika/Belize" 9321 9322 #: kdecore/TIMEZONES:153 9323 #, fuzzy, kde-format 9324 #| msgid "America/Cancun" 9325 msgid "America/Blanc-Sablon" 9326 msgstr "Amerika/Cancun" 9327 9328 #. i18n: comment to the previous timezone 9329 #: kdecore/TIMEZONES:155 9330 #, kde-format 9331 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9332 msgstr "" 9333 9334 #. i18n: comment to the previous timezone 9335 #: kdecore/TIMEZONES:157 9336 #, kde-format 9337 msgid "AST - QC (Lower North Shore)" 9338 msgstr "" 9339 9340 #: kdecore/TIMEZONES:158 9341 #, kde-format 9342 msgid "America/Boa_Vista" 9343 msgstr "Amerika/Boa_Vista" 9344 9345 #. i18n: comment to the previous timezone 9346 #: kdecore/TIMEZONES:160 9347 #, kde-format 9348 msgid "Roraima" 9349 msgstr "" 9350 9351 #: kdecore/TIMEZONES:161 9352 #, kde-format 9353 msgid "America/Bogota" 9354 msgstr "Amerika/Bogota" 9355 9356 #: kdecore/TIMEZONES:162 9357 #, kde-format 9358 msgid "America/Boise" 9359 msgstr "Amerika/Boise" 9360 9361 #. i18n: comment to the previous timezone 9362 #: kdecore/TIMEZONES:164 9363 #, kde-format 9364 msgid "Mountain Time - south Idaho & east Oregon" 9365 msgstr "" 9366 9367 #. i18n: comment to the previous timezone 9368 #: kdecore/TIMEZONES:166 9369 #, kde-format 9370 msgid "Mountain - ID (south); OR (east)" 9371 msgstr "" 9372 9373 #: kdecore/TIMEZONES:167 9374 #, kde-format 9375 msgid "America/Buenos_Aires" 9376 msgstr "Amerika/Buenos_Aires" 9377 9378 #: kdecore/TIMEZONES:170 9379 #, fuzzy, kde-format 9380 #| msgid "America/Cayman" 9381 msgid "America/Calgary" 9382 msgstr "Amerika/Cayman" 9383 9384 #. i18n: comment to the previous timezone 9385 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9386 #, kde-format 9387 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9388 msgstr "" 9389 9390 #: kdecore/TIMEZONES:173 9391 #, kde-format 9392 msgid "America/Cambridge_Bay" 9393 msgstr "Amerika/Cambridge_Bay" 9394 9395 #. i18n: comment to the previous timezone 9396 #: kdecore/TIMEZONES:175 9397 #, kde-format 9398 msgid "Mountain Time - west Nunavut" 9399 msgstr "" 9400 9401 #. i18n: comment to the previous timezone 9402 #: kdecore/TIMEZONES:177 9403 #, kde-format 9404 msgid "Mountain - NU (west)" 9405 msgstr "" 9406 9407 #: kdecore/TIMEZONES:178 9408 #, fuzzy, kde-format 9409 msgid "America/Campo_Grande" 9410 msgstr "Amerika/Campo_Grande" 9411 9412 #. i18n: comment to the previous timezone 9413 #: kdecore/TIMEZONES:180 9414 #, kde-format 9415 msgid "Mato Grosso do Sul" 9416 msgstr "" 9417 9418 #: kdecore/TIMEZONES:181 9419 #, kde-format 9420 msgid "America/Cancun" 9421 msgstr "Amerika/Cancun" 9422 9423 #. i18n: comment to the previous timezone 9424 #: kdecore/TIMEZONES:183 9425 #, kde-format 9426 msgid "Central Time - Quintana Roo" 9427 msgstr "" 9428 9429 #. i18n: comment to the previous timezone 9430 #: kdecore/TIMEZONES:185 9431 #, kde-format 9432 msgid "Eastern Standard Time - Quintana Roo" 9433 msgstr "" 9434 9435 #: kdecore/TIMEZONES:186 9436 #, kde-format 9437 msgid "America/Caracas" 9438 msgstr "Amerika/Caracas" 9439 9440 #: kdecore/TIMEZONES:187 9441 #, kde-format 9442 msgid "America/Catamarca" 9443 msgstr "Amerika/Catamarca" 9444 9445 #: kdecore/TIMEZONES:190 9446 #, kde-format 9447 msgid "America/Cayenne" 9448 msgstr "Amerika/Cayenne" 9449 9450 #: kdecore/TIMEZONES:191 9451 #, kde-format 9452 msgid "America/Cayman" 9453 msgstr "Amerika/Cayman" 9454 9455 #: kdecore/TIMEZONES:192 9456 #, kde-format 9457 msgid "America/Chicago" 9458 msgstr "Amerika/Chicago" 9459 9460 #. i18n: comment to the previous timezone 9461 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9462 #, kde-format 9463 msgid "Central Time" 9464 msgstr "" 9465 9466 #. i18n: comment to the previous timezone 9467 #: kdecore/TIMEZONES:196 9468 #, kde-format 9469 msgid "Central (most areas)" 9470 msgstr "" 9471 9472 #: kdecore/TIMEZONES:197 9473 #, kde-format 9474 msgid "America/Chihuahua" 9475 msgstr "Amerika/Chihuahua" 9476 9477 #. i18n: comment to the previous timezone 9478 #: kdecore/TIMEZONES:199 9479 #, kde-format 9480 msgid "Mountain Time - Chihuahua" 9481 msgstr "" 9482 9483 #. i18n: comment to the previous timezone 9484 #: kdecore/TIMEZONES:201 9485 #, kde-format 9486 msgid "Mexican Mountain Time - Chihuahua away from US border" 9487 msgstr "" 9488 9489 #. i18n: comment to the previous timezone 9490 #: kdecore/TIMEZONES:203 9491 #, kde-format 9492 msgid "Mountain Time - Chihuahua (most areas)" 9493 msgstr "" 9494 9495 #: kdecore/TIMEZONES:204 9496 #, fuzzy, kde-format 9497 #| msgid "America/Curacao" 9498 msgid "America/Coral_Harbour" 9499 msgstr "Amerika/Curacao" 9500 9501 #: kdecore/TIMEZONES:207 9502 #, kde-format 9503 msgid "America/Cordoba" 9504 msgstr "Amerika/Cordoba" 9505 9506 #: kdecore/TIMEZONES:210 9507 #, kde-format 9508 msgid "America/Costa_Rica" 9509 msgstr "Amerika/Costa_Rica" 9510 9511 #: kdecore/TIMEZONES:211 9512 #, fuzzy, kde-format 9513 #| msgid "Africa/Freetown" 9514 msgid "America/Creston" 9515 msgstr "Afrika/Freetown" 9516 9517 #. i18n: comment to the previous timezone 9518 #: kdecore/TIMEZONES:213 9519 #, kde-format 9520 msgid "Mountain Standard Time - Creston, British Columbia" 9521 msgstr "" 9522 9523 #. i18n: comment to the previous timezone 9524 #: kdecore/TIMEZONES:215 9525 #, kde-format 9526 msgid "MST - BC (Creston)" 9527 msgstr "" 9528 9529 #: kdecore/TIMEZONES:216 9530 #, kde-format 9531 msgid "America/Cuiaba" 9532 msgstr "Amerika/Cuiaba" 9533 9534 #. i18n: comment to the previous timezone 9535 #: kdecore/TIMEZONES:218 9536 #, kde-format 9537 msgid "Mato Grosso" 9538 msgstr "" 9539 9540 #: kdecore/TIMEZONES:219 9541 #, kde-format 9542 msgid "America/Curacao" 9543 msgstr "Amerika/Curacao" 9544 9545 #: kdecore/TIMEZONES:220 9546 #, kde-format 9547 msgid "America/Danmarkshavn" 9548 msgstr "Amerika/Danmarkshavn" 9549 9550 #. i18n: comment to the previous timezone 9551 #: kdecore/TIMEZONES:222 9552 #, kde-format 9553 msgid "east coast, north of Scoresbysund" 9554 msgstr "" 9555 9556 #. i18n: comment to the previous timezone 9557 #: kdecore/TIMEZONES:224 9558 #, kde-format 9559 msgid "National Park (east coast)" 9560 msgstr "" 9561 9562 #: kdecore/TIMEZONES:225 9563 #, kde-format 9564 msgid "America/Dawson" 9565 msgstr "Amerika/Dawson" 9566 9567 #. i18n: comment to the previous timezone 9568 #: kdecore/TIMEZONES:227 9569 #, kde-format 9570 msgid "Pacific Time - north Yukon" 9571 msgstr "" 9572 9573 #. i18n: comment to the previous timezone 9574 #: kdecore/TIMEZONES:229 9575 #, kde-format 9576 msgid "MST - Yukon (west)" 9577 msgstr "" 9578 9579 #: kdecore/TIMEZONES:230 9580 #, kde-format 9581 msgid "America/Dawson_Creek" 9582 msgstr "Amerika/Dawson_Creek" 9583 9584 #. i18n: comment to the previous timezone 9585 #: kdecore/TIMEZONES:232 9586 #, kde-format 9587 msgid "" 9588 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9589 msgstr "" 9590 9591 #. i18n: comment to the previous timezone 9592 #: kdecore/TIMEZONES:234 9593 #, kde-format 9594 msgid "MST - BC (Dawson Cr, Ft St John)" 9595 msgstr "" 9596 9597 #: kdecore/TIMEZONES:235 9598 #, kde-format 9599 msgid "America/Denver" 9600 msgstr "Amerika/Denver" 9601 9602 #. i18n: comment to the previous timezone 9603 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9604 #, kde-format 9605 msgid "Mountain Time" 9606 msgstr "" 9607 9608 #. i18n: comment to the previous timezone 9609 #: kdecore/TIMEZONES:239 9610 #, kde-format 9611 msgid "Mountain (most areas)" 9612 msgstr "" 9613 9614 #: kdecore/TIMEZONES:240 9615 #, kde-format 9616 msgid "America/Detroit" 9617 msgstr "Amerika/Detroit" 9618 9619 #. i18n: comment to the previous timezone 9620 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9621 #, kde-format 9622 msgid "Eastern Time - Michigan - most locations" 9623 msgstr "" 9624 9625 #. i18n: comment to the previous timezone 9626 #: kdecore/TIMEZONES:244 9627 #, kde-format 9628 msgid "Eastern - MI (most areas)" 9629 msgstr "" 9630 9631 #: kdecore/TIMEZONES:245 9632 #, kde-format 9633 msgid "America/Dominica" 9634 msgstr "Amerika/Dominica" 9635 9636 #: kdecore/TIMEZONES:246 9637 #, kde-format 9638 msgid "America/Edmonton" 9639 msgstr "Amerika/Edmonton" 9640 9641 #. i18n: comment to the previous timezone 9642 #: kdecore/TIMEZONES:250 9643 #, kde-format 9644 msgid "Mountain - AB; BC (E); SK (W)" 9645 msgstr "" 9646 9647 #: kdecore/TIMEZONES:251 9648 #, kde-format 9649 msgid "America/Eirunepe" 9650 msgstr "Amerika/Eirunepe" 9651 9652 #. i18n: comment to the previous timezone 9653 #: kdecore/TIMEZONES:253 9654 #, kde-format 9655 msgid "W Amazonas" 9656 msgstr "" 9657 9658 #. i18n: comment to the previous timezone 9659 #: kdecore/TIMEZONES:255 9660 #, kde-format 9661 msgid "Amazonas (west)" 9662 msgstr "" 9663 9664 #: kdecore/TIMEZONES:256 9665 #, kde-format 9666 msgid "America/El_Salvador" 9667 msgstr "Amerika/El_Salvador" 9668 9669 #: kdecore/TIMEZONES:257 9670 #, fuzzy, kde-format 9671 #| msgid "America/Grenada" 9672 msgid "America/Ensenada" 9673 msgstr "Amerika/Grenada" 9674 9675 #. i18n: comment to the previous timezone 9676 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9677 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9678 #, fuzzy, kde-format 9679 #| msgid "Pacific/Niue" 9680 msgid "Pacific Time" 9681 msgstr "Pasifik/Niue" 9682 9683 #: kdecore/TIMEZONES:260 9684 #, fuzzy, kde-format 9685 #| msgid "America/Porto_Velho" 9686 msgid "America/Fort_Nelson" 9687 msgstr "Amerika/Porto_Velho" 9688 9689 #. i18n: comment to the previous timezone 9690 #: kdecore/TIMEZONES:262 9691 #, kde-format 9692 msgid "MST - BC (Ft Nelson)" 9693 msgstr "" 9694 9695 #: kdecore/TIMEZONES:263 9696 #, fuzzy, kde-format 9697 #| msgid "America/Fortaleza" 9698 msgid "America/Fort_Wayne" 9699 msgstr "Amerika/Fortaleza" 9700 9701 #. i18n: comment to the previous timezone 9702 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9703 #: kdecore/TIMEZONES:1419 9704 #, kde-format 9705 msgid "Eastern Time - Indiana - most locations" 9706 msgstr "" 9707 9708 #: kdecore/TIMEZONES:266 9709 #, kde-format 9710 msgid "America/Fortaleza" 9711 msgstr "Amerika/Fortaleza" 9712 9713 #. i18n: comment to the previous timezone 9714 #: kdecore/TIMEZONES:268 9715 #, kde-format 9716 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9717 msgstr "" 9718 9719 #. i18n: comment to the previous timezone 9720 #: kdecore/TIMEZONES:270 9721 #, kde-format 9722 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9723 msgstr "" 9724 9725 #: kdecore/TIMEZONES:271 9726 #, fuzzy, kde-format 9727 #| msgid "Africa/Freetown" 9728 msgid "America/Fredericton" 9729 msgstr "Afrika/Freetown" 9730 9731 #. i18n: comment to the previous timezone 9732 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9733 #, kde-format 9734 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9735 msgstr "" 9736 9737 #: kdecore/TIMEZONES:274 9738 #, kde-format 9739 msgid "America/Glace_Bay" 9740 msgstr "Amerika/Glace_Bay" 9741 9742 #. i18n: comment to the previous timezone 9743 #: kdecore/TIMEZONES:276 9744 #, kde-format 9745 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9746 msgstr "" 9747 9748 #. i18n: comment to the previous timezone 9749 #: kdecore/TIMEZONES:278 9750 #, fuzzy, kde-format 9751 #| msgid "Atlantic/Cape_Verde" 9752 msgid "Atlantic - NS (Cape Breton)" 9753 msgstr "Atlantik/Cape_Verde" 9754 9755 #: kdecore/TIMEZONES:279 9756 #, kde-format 9757 msgid "America/Godthab" 9758 msgstr "Amerika/Godthab" 9759 9760 #. i18n: comment to the previous timezone 9761 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9762 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9763 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9764 #: kdecore/TIMEZONES:1350 9765 #, kde-format 9766 msgid "most locations" 9767 msgstr "" 9768 9769 #: kdecore/TIMEZONES:282 9770 #, kde-format 9771 msgid "America/Goose_Bay" 9772 msgstr "Amerika/Goose_Bay" 9773 9774 #. i18n: comment to the previous timezone 9775 #: kdecore/TIMEZONES:284 9776 #, kde-format 9777 msgid "Atlantic Time - Labrador - most locations" 9778 msgstr "" 9779 9780 #. i18n: comment to the previous timezone 9781 #: kdecore/TIMEZONES:286 9782 #, kde-format 9783 msgid "Atlantic - Labrador (most areas)" 9784 msgstr "" 9785 9786 #: kdecore/TIMEZONES:287 9787 #, kde-format 9788 msgid "America/Grand_Turk" 9789 msgstr "Amerika/Grand_Turk" 9790 9791 #: kdecore/TIMEZONES:288 9792 #, kde-format 9793 msgid "America/Grenada" 9794 msgstr "Amerika/Grenada" 9795 9796 #: kdecore/TIMEZONES:289 9797 #, kde-format 9798 msgid "America/Guadeloupe" 9799 msgstr "Amerika/Guadeloupe" 9800 9801 #: kdecore/TIMEZONES:290 9802 #, kde-format 9803 msgid "America/Guatemala" 9804 msgstr "Amerika/Guatemala" 9805 9806 #: kdecore/TIMEZONES:291 9807 #, kde-format 9808 msgid "America/Guayaquil" 9809 msgstr "Amerika/Guayaquil" 9810 9811 #. i18n: comment to the previous timezone 9812 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9813 #: kdecore/TIMEZONES:1400 9814 #, kde-format 9815 msgid "mainland" 9816 msgstr "" 9817 9818 #. i18n: comment to the previous timezone 9819 #: kdecore/TIMEZONES:295 9820 #, kde-format 9821 msgid "Ecuador (mainland)" 9822 msgstr "" 9823 9824 #: kdecore/TIMEZONES:296 9825 #, kde-format 9826 msgid "America/Guyana" 9827 msgstr "Amerika/Guyana" 9828 9829 #: kdecore/TIMEZONES:297 9830 #, kde-format 9831 msgid "America/Halifax" 9832 msgstr "Amerika/Halifax" 9833 9834 #. i18n: comment to the previous timezone 9835 #: kdecore/TIMEZONES:301 9836 #, kde-format 9837 msgid "Atlantic - NS (most areas); PE" 9838 msgstr "" 9839 9840 #: kdecore/TIMEZONES:302 9841 #, kde-format 9842 msgid "America/Havana" 9843 msgstr "Amerika/Havana" 9844 9845 #: kdecore/TIMEZONES:303 9846 #, kde-format 9847 msgid "America/Hermosillo" 9848 msgstr "Amerika/Hermosillo" 9849 9850 #. i18n: comment to the previous timezone 9851 #: kdecore/TIMEZONES:305 9852 #, kde-format 9853 msgid "Mountain Standard Time - Sonora" 9854 msgstr "" 9855 9856 #: kdecore/TIMEZONES:306 9857 #, fuzzy, kde-format 9858 #| msgid "America/Indianapolis" 9859 msgid "America/Indiana/Indianapolis" 9860 msgstr "Amerika/Indianapolis" 9861 9862 #. i18n: comment to the previous timezone 9863 #: kdecore/TIMEZONES:310 9864 #, kde-format 9865 msgid "Eastern - IN (most areas)" 9866 msgstr "" 9867 9868 #: kdecore/TIMEZONES:311 9869 #, kde-format 9870 msgid "America/Indiana/Knox" 9871 msgstr "Amerika/Indiana/Knox" 9872 9873 #. i18n: comment to the previous timezone 9874 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9875 #, kde-format 9876 msgid "Eastern Time - Indiana - Starke County" 9877 msgstr "" 9878 9879 #. i18n: comment to the previous timezone 9880 #: kdecore/TIMEZONES:315 9881 #, kde-format 9882 msgid "Central Time - Indiana - Starke County" 9883 msgstr "" 9884 9885 #. i18n: comment to the previous timezone 9886 #: kdecore/TIMEZONES:317 9887 #, kde-format 9888 msgid "Central - IN (Starke)" 9889 msgstr "" 9890 9891 #: kdecore/TIMEZONES:318 9892 #, kde-format 9893 msgid "America/Indiana/Marengo" 9894 msgstr "Amerika/Indiana/Marengo" 9895 9896 #. i18n: comment to the previous timezone 9897 #: kdecore/TIMEZONES:320 9898 #, kde-format 9899 msgid "Eastern Time - Indiana - Crawford County" 9900 msgstr "" 9901 9902 #. i18n: comment to the previous timezone 9903 #: kdecore/TIMEZONES:322 9904 #, kde-format 9905 msgid "Eastern - IN (Crawford)" 9906 msgstr "" 9907 9908 #: kdecore/TIMEZONES:323 9909 #, fuzzy, kde-format 9910 #| msgid "America/Indiana/Marengo" 9911 msgid "America/Indiana/Petersburg" 9912 msgstr "Amerika/Indiana/Marengo" 9913 9914 #. i18n: comment to the previous timezone 9915 #: kdecore/TIMEZONES:325 9916 #, kde-format 9917 msgid "Central Time - Indiana - Pike County" 9918 msgstr "" 9919 9920 #. i18n: comment to the previous timezone 9921 #: kdecore/TIMEZONES:327 9922 #, kde-format 9923 msgid "Eastern Time - Indiana - Pike County" 9924 msgstr "" 9925 9926 #. i18n: comment to the previous timezone 9927 #: kdecore/TIMEZONES:329 9928 #, kde-format 9929 msgid "Eastern - IN (Pike)" 9930 msgstr "" 9931 9932 #: kdecore/TIMEZONES:330 9933 #, fuzzy, kde-format 9934 #| msgid "America/Indiana/Vevay" 9935 msgid "America/Indiana/Tell_City" 9936 msgstr "Amerika/Indiana/Vevay" 9937 9938 #. i18n: comment to the previous timezone 9939 #: kdecore/TIMEZONES:332 9940 #, kde-format 9941 msgid "Central Time - Indiana - Perry County" 9942 msgstr "" 9943 9944 #. i18n: comment to the previous timezone 9945 #: kdecore/TIMEZONES:334 9946 #, kde-format 9947 msgid "Central - IN (Perry)" 9948 msgstr "" 9949 9950 #: kdecore/TIMEZONES:335 9951 #, kde-format 9952 msgid "America/Indiana/Vevay" 9953 msgstr "Amerika/Indiana/Vevay" 9954 9955 #. i18n: comment to the previous timezone 9956 #: kdecore/TIMEZONES:337 9957 #, kde-format 9958 msgid "Eastern Time - Indiana - Switzerland County" 9959 msgstr "" 9960 9961 #. i18n: comment to the previous timezone 9962 #: kdecore/TIMEZONES:339 9963 #, kde-format 9964 msgid "Eastern - IN (Switzerland)" 9965 msgstr "" 9966 9967 #: kdecore/TIMEZONES:340 9968 #, fuzzy, kde-format 9969 #| msgid "America/Indiana/Vevay" 9970 msgid "America/Indiana/Vincennes" 9971 msgstr "Amerika/Indiana/Vevay" 9972 9973 #. i18n: comment to the previous timezone 9974 #: kdecore/TIMEZONES:342 9975 #, kde-format 9976 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9977 msgstr "" 9978 9979 #. i18n: comment to the previous timezone 9980 #: kdecore/TIMEZONES:344 9981 #, kde-format 9982 msgid "Eastern - IN (Da, Du, K, Mn)" 9983 msgstr "" 9984 9985 #: kdecore/TIMEZONES:345 9986 #, fuzzy, kde-format 9987 #| msgid "America/Indiana/Knox" 9988 msgid "America/Indiana/Winamac" 9989 msgstr "Amerika/Indiana/Knox" 9990 9991 #. i18n: comment to the previous timezone 9992 #: kdecore/TIMEZONES:347 9993 #, kde-format 9994 msgid "Eastern Time - Indiana - Pulaski County" 9995 msgstr "" 9996 9997 #. i18n: comment to the previous timezone 9998 #: kdecore/TIMEZONES:349 9999 #, kde-format 10000 msgid "Eastern - IN (Pulaski)" 10001 msgstr "" 10002 10003 #: kdecore/TIMEZONES:350 10004 #, kde-format 10005 msgid "America/Indianapolis" 10006 msgstr "Amerika/Indianapolis" 10007 10008 #: kdecore/TIMEZONES:353 10009 #, kde-format 10010 msgid "America/Inuvik" 10011 msgstr "Amerika/Inuvik" 10012 10013 #. i18n: comment to the previous timezone 10014 #: kdecore/TIMEZONES:355 10015 #, kde-format 10016 msgid "Mountain Time - west Northwest Territories" 10017 msgstr "" 10018 10019 #. i18n: comment to the previous timezone 10020 #: kdecore/TIMEZONES:357 10021 #, kde-format 10022 msgid "Mountain - NT (west)" 10023 msgstr "" 10024 10025 #: kdecore/TIMEZONES:358 10026 #, kde-format 10027 msgid "America/Iqaluit" 10028 msgstr "Amerika/Iqaluit" 10029 10030 #. i18n: comment to the previous timezone 10031 #: kdecore/TIMEZONES:360 10032 #, kde-format 10033 msgid "Eastern Time - east Nunavut - most locations" 10034 msgstr "" 10035 10036 #. i18n: comment to the previous timezone 10037 #: kdecore/TIMEZONES:362 10038 #, kde-format 10039 msgid "Eastern - NU (most east areas)" 10040 msgstr "" 10041 10042 #: kdecore/TIMEZONES:363 10043 #, kde-format 10044 msgid "America/Jamaica" 10045 msgstr "Amerika/Jamaica" 10046 10047 #: kdecore/TIMEZONES:364 10048 #, kde-format 10049 msgid "America/Jujuy" 10050 msgstr "Amerika/Jujuy" 10051 10052 #: kdecore/TIMEZONES:367 10053 #, kde-format 10054 msgid "America/Juneau" 10055 msgstr "Amerika/Juneau" 10056 10057 #. i18n: comment to the previous timezone 10058 #: kdecore/TIMEZONES:369 10059 #, kde-format 10060 msgid "Alaska Time - Alaska panhandle" 10061 msgstr "" 10062 10063 #. i18n: comment to the previous timezone 10064 #: kdecore/TIMEZONES:371 10065 #, kde-format 10066 msgid "Alaska - Juneau area" 10067 msgstr "" 10068 10069 #: kdecore/TIMEZONES:372 10070 #, fuzzy, kde-format 10071 #| msgid "America/Louisville" 10072 msgid "America/Kentucky/Louisville" 10073 msgstr "Amerika/Louisville" 10074 10075 #. i18n: comment to the previous timezone 10076 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 10077 #, fuzzy, kde-format 10078 #| msgid "America/Louisville" 10079 msgid "Eastern Time - Kentucky - Louisville area" 10080 msgstr "Amerika/Louisville" 10081 10082 #. i18n: comment to the previous timezone 10083 #: kdecore/TIMEZONES:376 10084 #, fuzzy, kde-format 10085 #| msgid "America/Louisville" 10086 msgid "Eastern - KY (Louisville area)" 10087 msgstr "Amerika/Louisville" 10088 10089 #: kdecore/TIMEZONES:377 10090 #, kde-format 10091 msgid "America/Kentucky/Monticello" 10092 msgstr "Amerika/Kentucky/Monticello" 10093 10094 #. i18n: comment to the previous timezone 10095 #: kdecore/TIMEZONES:379 10096 #, kde-format 10097 msgid "Eastern Time - Kentucky - Wayne County" 10098 msgstr "" 10099 10100 #. i18n: comment to the previous timezone 10101 #: kdecore/TIMEZONES:381 10102 #, kde-format 10103 msgid "Eastern - KY (Wayne)" 10104 msgstr "" 10105 10106 #: kdecore/TIMEZONES:382 10107 #, fuzzy, kde-format 10108 #| msgid "America/Indiana/Knox" 10109 msgid "America/Knox_IN" 10110 msgstr "Amerika/Indiana/Knox" 10111 10112 #: kdecore/TIMEZONES:385 10113 #, fuzzy, kde-format 10114 #| msgid "America/Grenada" 10115 msgid "America/Kralendijk" 10116 msgstr "Amerika/Grenada" 10117 10118 #: kdecore/TIMEZONES:386 10119 #, kde-format 10120 msgid "America/La_Paz" 10121 msgstr "Amerika/La_Paz" 10122 10123 #: kdecore/TIMEZONES:387 10124 #, kde-format 10125 msgid "America/Lima" 10126 msgstr "Amerika/Lima" 10127 10128 #: kdecore/TIMEZONES:388 10129 #, kde-format 10130 msgid "America/Los_Angeles" 10131 msgstr "Amerika/Los_Angeles" 10132 10133 #. i18n: comment to the previous timezone 10134 #: kdecore/TIMEZONES:392 10135 #, fuzzy, kde-format 10136 #| msgid "Pacific/Yap" 10137 msgid "Pacific" 10138 msgstr "Pasifik/Yap" 10139 10140 #: kdecore/TIMEZONES:393 10141 #, kde-format 10142 msgid "America/Louisville" 10143 msgstr "Amerika/Louisville" 10144 10145 #: kdecore/TIMEZONES:396 10146 #, fuzzy, kde-format 10147 #| msgid "America/Port-au-Prince" 10148 msgid "America/Lower_Princes" 10149 msgstr "Amerika/Port-au-Prince" 10150 10151 #: kdecore/TIMEZONES:397 10152 #, kde-format 10153 msgid "America/Maceio" 10154 msgstr "Amerika/Maceio" 10155 10156 #. i18n: comment to the previous timezone 10157 #: kdecore/TIMEZONES:399 10158 #, kde-format 10159 msgid "Alagoas, Sergipe" 10160 msgstr "" 10161 10162 #: kdecore/TIMEZONES:400 10163 #, kde-format 10164 msgid "America/Managua" 10165 msgstr "Amerika/Managua" 10166 10167 #: kdecore/TIMEZONES:401 10168 #, kde-format 10169 msgid "America/Manaus" 10170 msgstr "Amerika/Manaus" 10171 10172 #. i18n: comment to the previous timezone 10173 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 10174 #, kde-format 10175 msgid "E Amazonas" 10176 msgstr "" 10177 10178 #. i18n: comment to the previous timezone 10179 #: kdecore/TIMEZONES:405 10180 #, kde-format 10181 msgid "Amazonas (east)" 10182 msgstr "" 10183 10184 #: kdecore/TIMEZONES:406 10185 #, fuzzy, kde-format 10186 #| msgid "America/Maceio" 10187 msgid "America/Marigot" 10188 msgstr "Amerika/Maceio" 10189 10190 #: kdecore/TIMEZONES:407 10191 #, kde-format 10192 msgid "America/Martinique" 10193 msgstr "Amerika/Martinique" 10194 10195 #: kdecore/TIMEZONES:408 10196 #, fuzzy, kde-format 10197 #| msgid "America/Manaus" 10198 msgid "America/Matamoros" 10199 msgstr "Amerika/Manaus" 10200 10201 #. i18n: comment to the previous timezone 10202 #: kdecore/TIMEZONES:410 10203 #, kde-format 10204 msgid "" 10205 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 10206 msgstr "" 10207 10208 #. i18n: comment to the previous timezone 10209 #: kdecore/TIMEZONES:412 10210 #, kde-format 10211 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 10212 msgstr "" 10213 10214 #: kdecore/TIMEZONES:413 10215 #, kde-format 10216 msgid "America/Mazatlan" 10217 msgstr "Amerika/Mazatlan" 10218 10219 #. i18n: comment to the previous timezone 10220 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 10221 #, kde-format 10222 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 10223 msgstr "" 10224 10225 #. i18n: comment to the previous timezone 10226 #: kdecore/TIMEZONES:417 10227 #, kde-format 10228 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 10229 msgstr "" 10230 10231 #: kdecore/TIMEZONES:418 10232 #, kde-format 10233 msgid "America/Mendoza" 10234 msgstr "Amerika/Mendoza" 10235 10236 #: kdecore/TIMEZONES:421 10237 #, kde-format 10238 msgid "America/Menominee" 10239 msgstr "Amerika/Menominee" 10240 10241 #. i18n: comment to the previous timezone 10242 #: kdecore/TIMEZONES:423 10243 #, kde-format 10244 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 10245 msgstr "" 10246 10247 #. i18n: comment to the previous timezone 10248 #: kdecore/TIMEZONES:425 10249 #, kde-format 10250 msgid "Central - MI (Wisconsin border)" 10251 msgstr "" 10252 10253 #: kdecore/TIMEZONES:426 10254 #, kde-format 10255 msgid "America/Merida" 10256 msgstr "Amerika/Merida" 10257 10258 #. i18n: comment to the previous timezone 10259 #: kdecore/TIMEZONES:428 10260 #, kde-format 10261 msgid "Central Time - Campeche, Yucatan" 10262 msgstr "" 10263 10264 #: kdecore/TIMEZONES:429 10265 #, fuzzy, kde-format 10266 #| msgid "America/Mazatlan" 10267 msgid "America/Metlakatla" 10268 msgstr "Amerika/Mazatlan" 10269 10270 #. i18n: comment to the previous timezone 10271 #: kdecore/TIMEZONES:431 10272 #, kde-format 10273 msgid "Metlakatla Time - Annette Island" 10274 msgstr "" 10275 10276 #. i18n: comment to the previous timezone 10277 #: kdecore/TIMEZONES:433 10278 #, kde-format 10279 msgid "Alaska - Annette Island" 10280 msgstr "" 10281 10282 #: kdecore/TIMEZONES:434 10283 #, kde-format 10284 msgid "America/Mexico_City" 10285 msgstr "Amerika/Mexico_City" 10286 10287 #. i18n: comment to the previous timezone 10288 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 10289 #, kde-format 10290 msgid "Central Time - most locations" 10291 msgstr "" 10292 10293 #: kdecore/TIMEZONES:439 10294 #, kde-format 10295 msgid "America/Miquelon" 10296 msgstr "Amerika/Miquelon" 10297 10298 #: kdecore/TIMEZONES:440 10299 #, fuzzy, kde-format 10300 #| msgid "America/Edmonton" 10301 msgid "America/Moncton" 10302 msgstr "Amerika/Edmonton" 10303 10304 #. i18n: comment to the previous timezone 10305 #: kdecore/TIMEZONES:442 10306 #, kde-format 10307 msgid "Atlantic Time - New Brunswick" 10308 msgstr "" 10309 10310 #. i18n: comment to the previous timezone 10311 #: kdecore/TIMEZONES:444 10312 #, kde-format 10313 msgid "Atlantic - New Brunswick" 10314 msgstr "" 10315 10316 #: kdecore/TIMEZONES:445 10317 #, kde-format 10318 msgid "America/Monterrey" 10319 msgstr "Amerika/Monterrey" 10320 10321 #. i18n: comment to the previous timezone 10322 #: kdecore/TIMEZONES:447 10323 #, kde-format 10324 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10325 msgstr "" 10326 10327 #. i18n: comment to the previous timezone 10328 #: kdecore/TIMEZONES:449 10329 #, kde-format 10330 msgid "" 10331 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10332 "US border" 10333 msgstr "" 10334 10335 #. i18n: comment to the previous timezone 10336 #: kdecore/TIMEZONES:451 10337 #, kde-format 10338 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10339 msgstr "" 10340 10341 #: kdecore/TIMEZONES:452 10342 #, kde-format 10343 msgid "America/Montevideo" 10344 msgstr "Amerika/Montevideo" 10345 10346 #: kdecore/TIMEZONES:453 10347 #, kde-format 10348 msgid "America/Montreal" 10349 msgstr "Amerika/Montreal" 10350 10351 #. i18n: comment to the previous timezone 10352 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10353 #, kde-format 10354 msgid "Eastern Time - Quebec - most locations" 10355 msgstr "" 10356 10357 #: kdecore/TIMEZONES:456 10358 #, kde-format 10359 msgid "America/Montserrat" 10360 msgstr "Amerika/Montserrat" 10361 10362 #: kdecore/TIMEZONES:457 10363 #, kde-format 10364 msgid "America/Nassau" 10365 msgstr "Amerika/Nassau" 10366 10367 #: kdecore/TIMEZONES:458 10368 #, kde-format 10369 msgid "America/New_York" 10370 msgstr "Amerika/New_York" 10371 10372 #. i18n: comment to the previous timezone 10373 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10374 #, kde-format 10375 msgid "Eastern Time" 10376 msgstr "" 10377 10378 #. i18n: comment to the previous timezone 10379 #: kdecore/TIMEZONES:462 10380 #, kde-format 10381 msgid "Eastern (most areas)" 10382 msgstr "" 10383 10384 #: kdecore/TIMEZONES:463 10385 #, kde-format 10386 msgid "America/Nipigon" 10387 msgstr "Amerika/Nipigon" 10388 10389 #. i18n: comment to the previous timezone 10390 #: kdecore/TIMEZONES:465 10391 #, kde-format 10392 msgid "" 10393 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10394 msgstr "" 10395 10396 #. i18n: comment to the previous timezone 10397 #: kdecore/TIMEZONES:467 10398 #, kde-format 10399 msgid "Eastern - ON, QC (no DST 1967-73)" 10400 msgstr "" 10401 10402 #: kdecore/TIMEZONES:468 10403 #, kde-format 10404 msgid "America/Nome" 10405 msgstr "Amerika/Nome" 10406 10407 #. i18n: comment to the previous timezone 10408 #: kdecore/TIMEZONES:470 10409 #, kde-format 10410 msgid "Alaska Time - west Alaska" 10411 msgstr "" 10412 10413 #. i18n: comment to the previous timezone 10414 #: kdecore/TIMEZONES:472 10415 #, kde-format 10416 msgid "Alaska (west)" 10417 msgstr "" 10418 10419 #: kdecore/TIMEZONES:473 10420 #, kde-format 10421 msgid "America/Noronha" 10422 msgstr "Amerika/Noronha" 10423 10424 #. i18n: comment to the previous timezone 10425 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10426 #, fuzzy, kde-format 10427 #| msgid "Atlantic/Canary" 10428 msgid "Atlantic islands" 10429 msgstr "Atlantik/Canary" 10430 10431 #: kdecore/TIMEZONES:476 10432 #, fuzzy, kde-format 10433 #| msgid "America/North_Dakota/Center" 10434 msgid "America/North_Dakota/Beulah" 10435 msgstr "Amerika/North_Dakota/Center" 10436 10437 #. i18n: comment to the previous timezone 10438 #: kdecore/TIMEZONES:478 10439 #, kde-format 10440 msgid "Central Time - North Dakota - Mercer County" 10441 msgstr "" 10442 10443 #. i18n: comment to the previous timezone 10444 #: kdecore/TIMEZONES:480 10445 #, kde-format 10446 msgid "Central - ND (Mercer)" 10447 msgstr "" 10448 10449 #: kdecore/TIMEZONES:481 10450 #, kde-format 10451 msgid "America/North_Dakota/Center" 10452 msgstr "Amerika/North_Dakota/Center" 10453 10454 #. i18n: comment to the previous timezone 10455 #: kdecore/TIMEZONES:483 10456 #, kde-format 10457 msgid "Central Time - North Dakota - Oliver County" 10458 msgstr "" 10459 10460 #. i18n: comment to the previous timezone 10461 #: kdecore/TIMEZONES:485 10462 #, kde-format 10463 msgid "Central - ND (Oliver)" 10464 msgstr "" 10465 10466 #: kdecore/TIMEZONES:486 10467 #, fuzzy, kde-format 10468 #| msgid "America/North_Dakota/Center" 10469 msgid "America/North_Dakota/New_Salem" 10470 msgstr "Amerika/North_Dakota/Center" 10471 10472 #. i18n: comment to the previous timezone 10473 #: kdecore/TIMEZONES:488 10474 #, kde-format 10475 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10476 msgstr "" 10477 10478 #. i18n: comment to the previous timezone 10479 #: kdecore/TIMEZONES:490 10480 #, kde-format 10481 msgid "Central - ND (Morton rural)" 10482 msgstr "" 10483 10484 #: kdecore/TIMEZONES:491 10485 #, fuzzy, kde-format 10486 #| msgid "America/Jujuy" 10487 msgid "America/Nuuk" 10488 msgstr "Amerika/Jujuy" 10489 10490 #. i18n: comment to the previous timezone 10491 #: kdecore/TIMEZONES:493 10492 #, kde-format 10493 msgid "Greenland (most areas)" 10494 msgstr "" 10495 10496 #: kdecore/TIMEZONES:494 10497 #, fuzzy, kde-format 10498 #| msgid "America/Managua" 10499 msgid "America/Ojinaga" 10500 msgstr "Amerika/Managua" 10501 10502 #. i18n: comment to the previous timezone 10503 #: kdecore/TIMEZONES:496 10504 #, kde-format 10505 msgid "US Mountain Time - Chihuahua near US border" 10506 msgstr "" 10507 10508 #. i18n: comment to the previous timezone 10509 #: kdecore/TIMEZONES:498 10510 #, kde-format 10511 msgid "Mountain Time US - Chihuahua (US border)" 10512 msgstr "" 10513 10514 #: kdecore/TIMEZONES:499 10515 #, fuzzy, kde-format 10516 #| msgid "America/Maceio" 10517 msgid "America/Ontario" 10518 msgstr "Amerika/Maceio" 10519 10520 #: kdecore/TIMEZONES:502 10521 #, kde-format 10522 msgid "America/Panama" 10523 msgstr "Amerika/Panama" 10524 10525 #: kdecore/TIMEZONES:503 10526 #, kde-format 10527 msgid "America/Pangnirtung" 10528 msgstr "Amerika/Pangnirtung" 10529 10530 #. i18n: comment to the previous timezone 10531 #: kdecore/TIMEZONES:505 10532 #, kde-format 10533 msgid "Eastern Time - Pangnirtung, Nunavut" 10534 msgstr "" 10535 10536 #. i18n: comment to the previous timezone 10537 #: kdecore/TIMEZONES:507 10538 #, kde-format 10539 msgid "Eastern - NU (Pangnirtung)" 10540 msgstr "" 10541 10542 #: kdecore/TIMEZONES:508 10543 #, kde-format 10544 msgid "America/Paramaribo" 10545 msgstr "Amerika/Paramaribo" 10546 10547 #: kdecore/TIMEZONES:509 10548 #, kde-format 10549 msgid "America/Phoenix" 10550 msgstr "Amerika/Phoenix" 10551 10552 #. i18n: comment to the previous timezone 10553 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10554 #, kde-format 10555 msgid "Mountain Standard Time - Arizona" 10556 msgstr "" 10557 10558 #. i18n: comment to the previous timezone 10559 #: kdecore/TIMEZONES:513 10560 #, kde-format 10561 msgid "MST - Arizona (except Navajo)" 10562 msgstr "" 10563 10564 #: kdecore/TIMEZONES:514 10565 #, kde-format 10566 msgid "America/Port-au-Prince" 10567 msgstr "Amerika/Port-au-Prince" 10568 10569 #: kdecore/TIMEZONES:515 10570 #, kde-format 10571 msgid "America/Port_of_Spain" 10572 msgstr "Amerika/Port_of_Spain" 10573 10574 #: kdecore/TIMEZONES:516 10575 #, fuzzy, kde-format 10576 #| msgid "America/Porto_Velho" 10577 msgid "America/Porto_Acre" 10578 msgstr "Amerika/Porto_Velho" 10579 10580 #. i18n: comment to the previous timezone 10581 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10582 #, kde-format 10583 msgid "Acre" 10584 msgstr "" 10585 10586 #: kdecore/TIMEZONES:519 10587 #, kde-format 10588 msgid "America/Porto_Velho" 10589 msgstr "Amerika/Porto_Velho" 10590 10591 #. i18n: comment to the previous timezone 10592 #: kdecore/TIMEZONES:521 10593 #, kde-format 10594 msgid "Rondonia" 10595 msgstr "" 10596 10597 #: kdecore/TIMEZONES:522 10598 #, kde-format 10599 msgid "America/Puerto_Rico" 10600 msgstr "Amerika/Puerto_Rico" 10601 10602 #: kdecore/TIMEZONES:523 10603 #, fuzzy, kde-format 10604 #| msgid "America/Buenos_Aires" 10605 msgid "America/Punta_Arenas" 10606 msgstr "Amerika/Buenos_Aires" 10607 10608 #. i18n: comment to the previous timezone 10609 #: kdecore/TIMEZONES:525 10610 #, kde-format 10611 msgid "Region of Magallanes" 10612 msgstr "" 10613 10614 #: kdecore/TIMEZONES:526 10615 #, kde-format 10616 msgid "America/Rainy_River" 10617 msgstr "Amerika/Rainy_River" 10618 10619 #. i18n: comment to the previous timezone 10620 #: kdecore/TIMEZONES:528 10621 #, kde-format 10622 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10623 msgstr "" 10624 10625 #. i18n: comment to the previous timezone 10626 #: kdecore/TIMEZONES:530 10627 #, kde-format 10628 msgid "Central - ON (Rainy R, Ft Frances)" 10629 msgstr "" 10630 10631 #: kdecore/TIMEZONES:531 10632 #, kde-format 10633 msgid "America/Rankin_Inlet" 10634 msgstr "Amerika/Rankin_Inlet" 10635 10636 #. i18n: comment to the previous timezone 10637 #: kdecore/TIMEZONES:533 10638 #, kde-format 10639 msgid "Central Time - central Nunavut" 10640 msgstr "" 10641 10642 #. i18n: comment to the previous timezone 10643 #: kdecore/TIMEZONES:535 10644 #, kde-format 10645 msgid "Central - NU (central)" 10646 msgstr "" 10647 10648 #: kdecore/TIMEZONES:536 10649 #, kde-format 10650 msgid "America/Recife" 10651 msgstr "Amerika/Recife" 10652 10653 #. i18n: comment to the previous timezone 10654 #: kdecore/TIMEZONES:538 10655 #, kde-format 10656 msgid "Pernambuco" 10657 msgstr "" 10658 10659 #: kdecore/TIMEZONES:539 10660 #, kde-format 10661 msgid "America/Regina" 10662 msgstr "Amerika/Regina" 10663 10664 #. i18n: comment to the previous timezone 10665 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10666 #: kdecore/TIMEZONES:1123 10667 #, kde-format 10668 msgid "Central Standard Time - Saskatchewan - most locations" 10669 msgstr "" 10670 10671 #. i18n: comment to the previous timezone 10672 #: kdecore/TIMEZONES:543 10673 #, kde-format 10674 msgid "CST - SK (most areas)" 10675 msgstr "" 10676 10677 #: kdecore/TIMEZONES:544 10678 #, fuzzy, kde-format 10679 #| msgid "America/Belem" 10680 msgid "America/Resolute" 10681 msgstr "Amerika/Belem" 10682 10683 #. i18n: comment to the previous timezone 10684 #: kdecore/TIMEZONES:546 10685 #, kde-format 10686 msgid "Eastern Time - Resolute, Nunavut" 10687 msgstr "" 10688 10689 #. i18n: comment to the previous timezone 10690 #: kdecore/TIMEZONES:548 10691 #, kde-format 10692 msgid "Central Standard Time - Resolute, Nunavut" 10693 msgstr "" 10694 10695 #. i18n: comment to the previous timezone 10696 #: kdecore/TIMEZONES:550 10697 #, kde-format 10698 msgid "Central - NU (Resolute)" 10699 msgstr "" 10700 10701 #: kdecore/TIMEZONES:551 10702 #, kde-format 10703 msgid "America/Rio_Branco" 10704 msgstr "Amerika/Rio_Branco" 10705 10706 #: kdecore/TIMEZONES:554 10707 #, kde-format 10708 msgid "America/Rosario" 10709 msgstr "Amerika/Rosario" 10710 10711 #: kdecore/TIMEZONES:557 10712 #, fuzzy, kde-format 10713 #| msgid "America/Santiago" 10714 msgid "America/Santa_Isabel" 10715 msgstr "Amerika/Santiago" 10716 10717 #. i18n: comment to the previous timezone 10718 #: kdecore/TIMEZONES:559 10719 #, kde-format 10720 msgid "Mexican Pacific Time - Baja California away from US border" 10721 msgstr "" 10722 10723 #: kdecore/TIMEZONES:560 10724 #, fuzzy, kde-format 10725 #| msgid "America/Santiago" 10726 msgid "America/Santarem" 10727 msgstr "Amerika/Santiago" 10728 10729 #. i18n: comment to the previous timezone 10730 #: kdecore/TIMEZONES:562 10731 #, fuzzy, kde-format 10732 msgid "W Para" 10733 msgstr "Mac" 10734 10735 #. i18n: comment to the previous timezone 10736 #: kdecore/TIMEZONES:564 10737 #, kde-format 10738 msgid "Para (west)" 10739 msgstr "" 10740 10741 #: kdecore/TIMEZONES:565 10742 #, kde-format 10743 msgid "America/Santiago" 10744 msgstr "Amerika/Santiago" 10745 10746 #. i18n: comment to the previous timezone 10747 #: kdecore/TIMEZONES:569 10748 #, kde-format 10749 msgid "Chile (most areas)" 10750 msgstr "" 10751 10752 #: kdecore/TIMEZONES:570 10753 #, kde-format 10754 msgid "America/Santo_Domingo" 10755 msgstr "Amerika/Santo_Domingo" 10756 10757 #: kdecore/TIMEZONES:571 10758 #, kde-format 10759 msgid "America/Sao_Paulo" 10760 msgstr "Amerika/Sao_Paulo" 10761 10762 #. i18n: comment to the previous timezone 10763 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10764 #, kde-format 10765 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10766 msgstr "" 10767 10768 #. i18n: comment to the previous timezone 10769 #: kdecore/TIMEZONES:575 10770 #, kde-format 10771 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10772 msgstr "" 10773 10774 #: kdecore/TIMEZONES:576 10775 #, fuzzy, kde-format 10776 #| msgid "America/Dawson" 10777 msgid "America/Saskatoon" 10778 msgstr "Amerika/Dawson" 10779 10780 #: kdecore/TIMEZONES:579 10781 #, kde-format 10782 msgid "America/Scoresbysund" 10783 msgstr "Amerika/Scoresbysund" 10784 10785 #. i18n: comment to the previous timezone 10786 #: kdecore/TIMEZONES:581 10787 #, kde-format 10788 msgid "Scoresbysund / Ittoqqortoormiit" 10789 msgstr "" 10790 10791 #. i18n: comment to the previous timezone 10792 #: kdecore/TIMEZONES:583 10793 #, kde-format 10794 msgid "Scoresbysund/Ittoqqortoormiit" 10795 msgstr "" 10796 10797 #: kdecore/TIMEZONES:584 10798 #, kde-format 10799 msgid "America/Shiprock" 10800 msgstr "Amerika/Shiprock" 10801 10802 #. i18n: comment to the previous timezone 10803 #: kdecore/TIMEZONES:586 10804 #, kde-format 10805 msgid "Mountain Time - Navajo" 10806 msgstr "" 10807 10808 #: kdecore/TIMEZONES:587 10809 #, fuzzy, kde-format 10810 #| msgid "America/Antigua" 10811 msgid "America/Sitka" 10812 msgstr "Amerika/Antigua" 10813 10814 #. i18n: comment to the previous timezone 10815 #: kdecore/TIMEZONES:589 10816 #, kde-format 10817 msgid "Alaska Time - southeast Alaska panhandle" 10818 msgstr "" 10819 10820 #. i18n: comment to the previous timezone 10821 #: kdecore/TIMEZONES:591 10822 #, kde-format 10823 msgid "Alaska - Sitka area" 10824 msgstr "" 10825 10826 #: kdecore/TIMEZONES:592 10827 #, fuzzy, kde-format 10828 #| msgid "America/Belem" 10829 msgid "America/St_Barthelemy" 10830 msgstr "Amerika/Belem" 10831 10832 #: kdecore/TIMEZONES:593 10833 #, kde-format 10834 msgid "America/St_Johns" 10835 msgstr "Amerika/St_Johns" 10836 10837 #. i18n: comment to the previous timezone 10838 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10839 #, kde-format 10840 msgid "Newfoundland Time, including SE Labrador" 10841 msgstr "" 10842 10843 #. i18n: comment to the previous timezone 10844 #: kdecore/TIMEZONES:597 10845 #, kde-format 10846 msgid "Newfoundland; Labrador (southeast)" 10847 msgstr "" 10848 10849 #: kdecore/TIMEZONES:598 10850 #, kde-format 10851 msgid "America/St_Kitts" 10852 msgstr "Amerika/St_Kitts" 10853 10854 #: kdecore/TIMEZONES:599 10855 #, kde-format 10856 msgid "America/St_Lucia" 10857 msgstr "Amerika/St_Lucia" 10858 10859 #: kdecore/TIMEZONES:600 10860 #, kde-format 10861 msgid "America/St_Thomas" 10862 msgstr "Amerika/St_Thomas" 10863 10864 #: kdecore/TIMEZONES:601 10865 #, kde-format 10866 msgid "America/St_Vincent" 10867 msgstr "Amerika/St_Vincent" 10868 10869 #: kdecore/TIMEZONES:602 10870 #, kde-format 10871 msgid "America/Swift_Current" 10872 msgstr "Amerika/Swift_Current" 10873 10874 #. i18n: comment to the previous timezone 10875 #: kdecore/TIMEZONES:604 10876 #, kde-format 10877 msgid "Central Standard Time - Saskatchewan - midwest" 10878 msgstr "" 10879 10880 #. i18n: comment to the previous timezone 10881 #: kdecore/TIMEZONES:606 10882 #, kde-format 10883 msgid "CST - SK (midwest)" 10884 msgstr "" 10885 10886 #: kdecore/TIMEZONES:607 10887 #, kde-format 10888 msgid "America/Tegucigalpa" 10889 msgstr "Amerika/Tegucigalpa" 10890 10891 #: kdecore/TIMEZONES:608 10892 #, kde-format 10893 msgid "America/Thule" 10894 msgstr "Amerika/Thule" 10895 10896 #. i18n: comment to the previous timezone 10897 #: kdecore/TIMEZONES:610 10898 #, kde-format 10899 msgid "Thule / Pituffik" 10900 msgstr "" 10901 10902 #. i18n: comment to the previous timezone 10903 #: kdecore/TIMEZONES:612 10904 #, kde-format 10905 msgid "Thule/Pituffik" 10906 msgstr "" 10907 10908 #: kdecore/TIMEZONES:613 10909 #, kde-format 10910 msgid "America/Thunder_Bay" 10911 msgstr "Amerika/Thunder_Bay" 10912 10913 #. i18n: comment to the previous timezone 10914 #: kdecore/TIMEZONES:615 10915 #, kde-format 10916 msgid "Eastern Time - Thunder Bay, Ontario" 10917 msgstr "" 10918 10919 #. i18n: comment to the previous timezone 10920 #: kdecore/TIMEZONES:617 10921 #, kde-format 10922 msgid "Eastern - ON (Thunder Bay)" 10923 msgstr "" 10924 10925 #: kdecore/TIMEZONES:618 10926 #, kde-format 10927 msgid "America/Tijuana" 10928 msgstr "Amerika/Tijuana" 10929 10930 #. i18n: comment to the previous timezone 10931 #: kdecore/TIMEZONES:622 10932 #, kde-format 10933 msgid "US Pacific Time - Baja California near US border" 10934 msgstr "" 10935 10936 #. i18n: comment to the previous timezone 10937 #: kdecore/TIMEZONES:624 10938 #, kde-format 10939 msgid "Pacific Time US - Baja California" 10940 msgstr "" 10941 10942 #: kdecore/TIMEZONES:625 10943 #, fuzzy, kde-format 10944 msgid "America/Toronto" 10945 msgstr "Amerika/Toronto" 10946 10947 #. i18n: comment to the previous timezone 10948 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10949 #, kde-format 10950 msgid "Eastern Time - Ontario - most locations" 10951 msgstr "" 10952 10953 #. i18n: comment to the previous timezone 10954 #: kdecore/TIMEZONES:629 10955 #, kde-format 10956 msgid "Eastern - ON, QC (most areas)" 10957 msgstr "" 10958 10959 #: kdecore/TIMEZONES:630 10960 #, kde-format 10961 msgid "America/Tortola" 10962 msgstr "Amerika/Tortola" 10963 10964 #: kdecore/TIMEZONES:631 10965 #, kde-format 10966 msgid "America/Vancouver" 10967 msgstr "Amerika/Vancouver" 10968 10969 #. i18n: comment to the previous timezone 10970 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10971 #, kde-format 10972 msgid "Pacific Time - west British Columbia" 10973 msgstr "" 10974 10975 #. i18n: comment to the previous timezone 10976 #: kdecore/TIMEZONES:635 10977 #, kde-format 10978 msgid "Pacific - BC (most areas)" 10979 msgstr "" 10980 10981 #: kdecore/TIMEZONES:636 10982 #, fuzzy, kde-format 10983 #| msgid "America/Regina" 10984 msgid "America/Virgin" 10985 msgstr "Amerika/Regina" 10986 10987 #: kdecore/TIMEZONES:637 10988 #, kde-format 10989 msgid "America/Whitehorse" 10990 msgstr "Amerika/Whitehorse" 10991 10992 #. i18n: comment to the previous timezone 10993 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10994 #, kde-format 10995 msgid "Pacific Time - south Yukon" 10996 msgstr "" 10997 10998 #. i18n: comment to the previous timezone 10999 #: kdecore/TIMEZONES:641 11000 #, kde-format 11001 msgid "MST - Yukon (east)" 11002 msgstr "" 11003 11004 #: kdecore/TIMEZONES:642 11005 #, kde-format 11006 msgid "America/Winnipeg" 11007 msgstr "Amerika/Winnipeg" 11008 11009 #. i18n: comment to the previous timezone 11010 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 11011 #, kde-format 11012 msgid "Central Time - Manitoba & west Ontario" 11013 msgstr "" 11014 11015 #. i18n: comment to the previous timezone 11016 #: kdecore/TIMEZONES:646 11017 #, kde-format 11018 msgid "Central - ON (west); Manitoba" 11019 msgstr "" 11020 11021 #: kdecore/TIMEZONES:647 11022 #, kde-format 11023 msgid "America/Yakutat" 11024 msgstr "Amerika/Yakutat" 11025 11026 #. i18n: comment to the previous timezone 11027 #: kdecore/TIMEZONES:649 11028 #, kde-format 11029 msgid "Alaska Time - Alaska panhandle neck" 11030 msgstr "" 11031 11032 #. i18n: comment to the previous timezone 11033 #: kdecore/TIMEZONES:651 11034 #, kde-format 11035 msgid "Alaska - Yakutat" 11036 msgstr "" 11037 11038 #: kdecore/TIMEZONES:652 11039 #, kde-format 11040 msgid "America/Yellowknife" 11041 msgstr "Amerika/Yellowknife" 11042 11043 #. i18n: comment to the previous timezone 11044 #: kdecore/TIMEZONES:654 11045 #, kde-format 11046 msgid "Mountain Time - central Northwest Territories" 11047 msgstr "" 11048 11049 #. i18n: comment to the previous timezone 11050 #: kdecore/TIMEZONES:656 11051 #, kde-format 11052 msgid "Mountain - NT (central)" 11053 msgstr "" 11054 11055 #: kdecore/TIMEZONES:657 11056 #, kde-format 11057 msgid "Antarctica/Casey" 11058 msgstr "Antartika/Casey" 11059 11060 #. i18n: comment to the previous timezone 11061 #: kdecore/TIMEZONES:659 11062 #, kde-format 11063 msgid "Casey Station, Bailey Peninsula" 11064 msgstr "" 11065 11066 #. i18n: comment to the previous timezone 11067 #: kdecore/TIMEZONES:661 11068 #, kde-format 11069 msgid "Casey" 11070 msgstr "" 11071 11072 #: kdecore/TIMEZONES:662 11073 #, kde-format 11074 msgid "Antarctica/Davis" 11075 msgstr "Antartika/Davis" 11076 11077 #. i18n: comment to the previous timezone 11078 #: kdecore/TIMEZONES:664 11079 #, kde-format 11080 msgid "Davis Station, Vestfold Hills" 11081 msgstr "" 11082 11083 #. i18n: comment to the previous timezone 11084 #: kdecore/TIMEZONES:666 11085 #, kde-format 11086 msgid "Davis" 11087 msgstr "" 11088 11089 #: kdecore/TIMEZONES:667 11090 #, kde-format 11091 msgid "Antarctica/DumontDUrville" 11092 msgstr "Antartika/DumontDUrville" 11093 11094 #. i18n: comment to the previous timezone 11095 #: kdecore/TIMEZONES:669 11096 #, kde-format 11097 msgid "Dumont-d'Urville Station, Terre Adelie" 11098 msgstr "" 11099 11100 #. i18n: comment to the previous timezone 11101 #: kdecore/TIMEZONES:671 11102 #, fuzzy, kde-format 11103 #| msgid "Antarctica/DumontDUrville" 11104 msgid "Dumont-d'Urville" 11105 msgstr "Antartika/DumontDUrville" 11106 11107 #: kdecore/TIMEZONES:672 11108 #, fuzzy, kde-format 11109 #| msgid "Antarctica/McMurdo" 11110 msgid "Antarctica/Macquarie" 11111 msgstr "Antartika/McMurdo" 11112 11113 #. i18n: comment to the previous timezone 11114 #: kdecore/TIMEZONES:674 11115 #, kde-format 11116 msgid "Macquarie Island Station, Macquarie Island" 11117 msgstr "" 11118 11119 #. i18n: comment to the previous timezone 11120 #: kdecore/TIMEZONES:676 11121 #, kde-format 11122 msgid "Macquarie Island" 11123 msgstr "" 11124 11125 #: kdecore/TIMEZONES:677 11126 #, kde-format 11127 msgid "Antarctica/Mawson" 11128 msgstr "Antartika/Mawson" 11129 11130 #. i18n: comment to the previous timezone 11131 #: kdecore/TIMEZONES:679 11132 #, kde-format 11133 msgid "Mawson Station, Holme Bay" 11134 msgstr "" 11135 11136 #. i18n: comment to the previous timezone 11137 #: kdecore/TIMEZONES:681 11138 #, kde-format 11139 msgid "Mawson" 11140 msgstr "" 11141 11142 #: kdecore/TIMEZONES:682 11143 #, kde-format 11144 msgid "Antarctica/McMurdo" 11145 msgstr "Antartika/McMurdo" 11146 11147 #. i18n: comment to the previous timezone 11148 #: kdecore/TIMEZONES:684 11149 #, kde-format 11150 msgid "McMurdo Station, Ross Island" 11151 msgstr "" 11152 11153 #. i18n: comment to the previous timezone 11154 #: kdecore/TIMEZONES:686 11155 #, kde-format 11156 msgid "New Zealand time - McMurdo, South Pole" 11157 msgstr "" 11158 11159 #: kdecore/TIMEZONES:687 11160 #, kde-format 11161 msgid "Antarctica/Palmer" 11162 msgstr "Antartika/Palmer" 11163 11164 #. i18n: comment to the previous timezone 11165 #: kdecore/TIMEZONES:689 11166 #, kde-format 11167 msgid "Palmer Station, Anvers Island" 11168 msgstr "" 11169 11170 #. i18n: comment to the previous timezone 11171 #: kdecore/TIMEZONES:691 11172 #, kde-format 11173 msgid "Palmer" 11174 msgstr "" 11175 11176 #: kdecore/TIMEZONES:692 11177 #, fuzzy, kde-format 11178 msgid "Antarctica/Rothera" 11179 msgstr "Antartika/Rothera" 11180 11181 #. i18n: comment to the previous timezone 11182 #: kdecore/TIMEZONES:694 11183 #, kde-format 11184 msgid "Rothera Station, Adelaide Island" 11185 msgstr "" 11186 11187 #. i18n: comment to the previous timezone 11188 #: kdecore/TIMEZONES:696 11189 #, kde-format 11190 msgid "Rothera" 11191 msgstr "" 11192 11193 #: kdecore/TIMEZONES:697 11194 #, kde-format 11195 msgid "Antarctica/South_Pole" 11196 msgstr "Antartika/South_Pole" 11197 11198 #. i18n: comment to the previous timezone 11199 #: kdecore/TIMEZONES:699 11200 #, kde-format 11201 msgid "Amundsen-Scott Station, South Pole" 11202 msgstr "" 11203 11204 #: kdecore/TIMEZONES:700 11205 #, kde-format 11206 msgid "Antarctica/Syowa" 11207 msgstr "Antartika/Syowa" 11208 11209 #. i18n: comment to the previous timezone 11210 #: kdecore/TIMEZONES:702 11211 #, kde-format 11212 msgid "Syowa Station, E Ongul I" 11213 msgstr "" 11214 11215 #. i18n: comment to the previous timezone 11216 #: kdecore/TIMEZONES:704 11217 #, kde-format 11218 msgid "Syowa" 11219 msgstr "" 11220 11221 #: kdecore/TIMEZONES:705 11222 #, fuzzy, kde-format 11223 #| msgid "Antarctica/McMurdo" 11224 msgid "Antarctica/Troll" 11225 msgstr "Antartika/McMurdo" 11226 11227 #. i18n: comment to the previous timezone 11228 #: kdecore/TIMEZONES:707 11229 #, kde-format 11230 msgid "Troll" 11231 msgstr "" 11232 11233 #: kdecore/TIMEZONES:708 11234 #, kde-format 11235 msgid "Antarctica/Vostok" 11236 msgstr "Antartika/Vostok" 11237 11238 #. i18n: comment to the previous timezone 11239 #: kdecore/TIMEZONES:710 11240 #, kde-format 11241 msgid "Vostok Station, S Magnetic Pole" 11242 msgstr "" 11243 11244 #. i18n: comment to the previous timezone 11245 #: kdecore/TIMEZONES:712 11246 #, kde-format 11247 msgid "Vostok Station, Lake Vostok" 11248 msgstr "" 11249 11250 #. i18n: comment to the previous timezone 11251 #: kdecore/TIMEZONES:714 11252 #, kde-format 11253 msgid "Vostok" 11254 msgstr "" 11255 11256 #: kdecore/TIMEZONES:715 11257 #, kde-format 11258 msgid "Arctic/Longyearbyen" 11259 msgstr "Arctic/Longyearbyen" 11260 11261 #: kdecore/TIMEZONES:716 11262 #, kde-format 11263 msgid "Asia/Aden" 11264 msgstr "Asia/Aden" 11265 11266 #: kdecore/TIMEZONES:717 11267 #, kde-format 11268 msgid "Asia/Almaty" 11269 msgstr "Asia/Almaty" 11270 11271 #. i18n: comment to the previous timezone 11272 #: kdecore/TIMEZONES:721 11273 #, kde-format 11274 msgid "Kazakhstan (most areas)" 11275 msgstr "" 11276 11277 #: kdecore/TIMEZONES:722 11278 #, kde-format 11279 msgid "Asia/Amman" 11280 msgstr "Asia/Amman" 11281 11282 #: kdecore/TIMEZONES:723 11283 #, kde-format 11284 msgid "Asia/Anadyr" 11285 msgstr "Asia/Anadyr" 11286 11287 #. i18n: comment to the previous timezone 11288 #: kdecore/TIMEZONES:725 11289 #, kde-format 11290 msgid "Moscow+10 - Bering Sea" 11291 msgstr "" 11292 11293 #. i18n: comment to the previous timezone 11294 #: kdecore/TIMEZONES:727 11295 #, kde-format 11296 msgid "Moscow+08 - Bering Sea" 11297 msgstr "" 11298 11299 #. i18n: comment to the previous timezone 11300 #: kdecore/TIMEZONES:729 11301 #, kde-format 11302 msgid "MSK+09 - Bering Sea" 11303 msgstr "" 11304 11305 #: kdecore/TIMEZONES:730 11306 #, kde-format 11307 msgid "Asia/Aqtau" 11308 msgstr "Asia/Aqtau" 11309 11310 #. i18n: comment to the previous timezone 11311 #: kdecore/TIMEZONES:732 11312 #, kde-format 11313 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11314 msgstr "" 11315 11316 #. i18n: comment to the previous timezone 11317 #: kdecore/TIMEZONES:734 11318 #, kde-format 11319 msgid "Mangghystau/Mankistau" 11320 msgstr "" 11321 11322 #: kdecore/TIMEZONES:735 11323 #, kde-format 11324 msgid "Asia/Aqtobe" 11325 msgstr "Asia/Aqtobe" 11326 11327 #. i18n: comment to the previous timezone 11328 #: kdecore/TIMEZONES:737 11329 #, kde-format 11330 msgid "Aqtobe (Aktobe)" 11331 msgstr "" 11332 11333 #. i18n: comment to the previous timezone 11334 #: kdecore/TIMEZONES:739 11335 #, kde-format 11336 msgid "Aqtobe/Aktobe" 11337 msgstr "" 11338 11339 #: kdecore/TIMEZONES:740 11340 #, kde-format 11341 msgid "Asia/Ashgabat" 11342 msgstr "Asia/Ashgabat" 11343 11344 #: kdecore/TIMEZONES:741 11345 #, fuzzy, kde-format 11346 #| msgid "Asia/Ashgabat" 11347 msgid "Asia/Ashkhabad" 11348 msgstr "Asia/Ashgabat" 11349 11350 #: kdecore/TIMEZONES:742 11351 #, fuzzy, kde-format 11352 #| msgid "Asia/Aqtau" 11353 msgid "Asia/Atyrau" 11354 msgstr "Asia/Aqtau" 11355 11356 #. i18n: comment to the previous timezone 11357 #: kdecore/TIMEZONES:744 11358 #, kde-format 11359 msgid "Atyrau/Atirau/Gur'yev" 11360 msgstr "" 11361 11362 #: kdecore/TIMEZONES:745 11363 #, kde-format 11364 msgid "Asia/Baghdad" 11365 msgstr "Asia/Baghdad" 11366 11367 #: kdecore/TIMEZONES:746 11368 #, kde-format 11369 msgid "Asia/Bahrain" 11370 msgstr "Asia/Bahrain" 11371 11372 #: kdecore/TIMEZONES:747 11373 #, kde-format 11374 msgid "Asia/Baku" 11375 msgstr "Asia/Baku" 11376 11377 #: kdecore/TIMEZONES:748 11378 #, kde-format 11379 msgid "Asia/Bangkok" 11380 msgstr "Asia/Bangkok" 11381 11382 #: kdecore/TIMEZONES:749 11383 #, fuzzy, kde-format 11384 #| msgid "Asia/Baku" 11385 msgid "Asia/Barnaul" 11386 msgstr "Asia/Baku" 11387 11388 #. i18n: comment to the previous timezone 11389 #: kdecore/TIMEZONES:751 11390 #, kde-format 11391 msgid "MSK+04 - Altai" 11392 msgstr "" 11393 11394 #: kdecore/TIMEZONES:752 11395 #, fuzzy, kde-format 11396 #| msgid "Asia/Beirut" 11397 msgid "Asia/Beijing" 11398 msgstr "Asia/Beirut" 11399 11400 #. i18n: comment to the previous timezone 11401 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11402 #, kde-format 11403 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11404 msgstr "" 11405 11406 #. i18n: comment to the previous timezone 11407 #: kdecore/TIMEZONES:756 11408 #, kde-format 11409 msgid "China Standard Time" 11410 msgstr "" 11411 11412 #: kdecore/TIMEZONES:757 11413 #, kde-format 11414 msgid "Asia/Beirut" 11415 msgstr "Asia/Beirut" 11416 11417 #: kdecore/TIMEZONES:758 11418 #, kde-format 11419 msgid "Asia/Bishkek" 11420 msgstr "Asia/Bishkek" 11421 11422 #: kdecore/TIMEZONES:759 11423 #, kde-format 11424 msgid "Asia/Brunei" 11425 msgstr "Asia/Brunei" 11426 11427 #: kdecore/TIMEZONES:760 11428 #, kde-format 11429 msgid "Asia/Calcutta" 11430 msgstr "Asia/Calcutta" 11431 11432 #: kdecore/TIMEZONES:761 11433 #, fuzzy, kde-format 11434 #| msgid "Asia/Choibalsan" 11435 msgid "Asia/Chita" 11436 msgstr "Asia/Choibalsan" 11437 11438 #. i18n: comment to the previous timezone 11439 #: kdecore/TIMEZONES:763 11440 #, kde-format 11441 msgid "MSK+06 - Zabaykalsky" 11442 msgstr "" 11443 11444 #: kdecore/TIMEZONES:764 11445 #, kde-format 11446 msgid "Asia/Choibalsan" 11447 msgstr "Asia/Choibalsan" 11448 11449 #. i18n: comment to the previous timezone 11450 #: kdecore/TIMEZONES:766 11451 #, kde-format 11452 msgid "Dornod, Sukhbaatar" 11453 msgstr "" 11454 11455 #: kdecore/TIMEZONES:767 11456 #, kde-format 11457 msgid "Asia/Chongqing" 11458 msgstr "Asia/Chongqing" 11459 11460 #. i18n: comment to the previous timezone 11461 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11462 #, kde-format 11463 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11464 msgstr "" 11465 11466 #. i18n: comment to the previous timezone 11467 #: kdecore/TIMEZONES:771 11468 #, kde-format 11469 msgid "China mountains" 11470 msgstr "" 11471 11472 #: kdecore/TIMEZONES:772 11473 #, fuzzy, kde-format 11474 #| msgid "Asia/Chongqing" 11475 msgid "Asia/Chungking" 11476 msgstr "Asia/Chongqing" 11477 11478 #: kdecore/TIMEZONES:775 11479 #, kde-format 11480 msgid "Asia/Colombo" 11481 msgstr "Asia/Colombo" 11482 11483 #: kdecore/TIMEZONES:776 11484 #, fuzzy, kde-format 11485 #| msgid "Asia/Dhaka" 11486 msgid "Asia/Dacca" 11487 msgstr "Asia/Dhaka" 11488 11489 #: kdecore/TIMEZONES:777 11490 #, kde-format 11491 msgid "Asia/Damascus" 11492 msgstr "Asia/Damaskus" 11493 11494 #: kdecore/TIMEZONES:778 11495 #, kde-format 11496 msgid "Asia/Dhaka" 11497 msgstr "Asia/Dhaka" 11498 11499 #: kdecore/TIMEZONES:779 11500 #, kde-format 11501 msgid "Asia/Dili" 11502 msgstr "Asia/Dili" 11503 11504 #: kdecore/TIMEZONES:780 11505 #, kde-format 11506 msgid "Asia/Dubai" 11507 msgstr "Asia/Dubai" 11508 11509 #: kdecore/TIMEZONES:781 11510 #, fuzzy, kde-format 11511 #| msgid "Do shanbe" 11512 msgid "Asia/Dushanbe" 11513 msgstr "Do shanbe" 11514 11515 #: kdecore/TIMEZONES:782 11516 #, fuzzy, kde-format 11517 #| msgid "Asia/Damascus" 11518 msgid "Asia/Famagusta" 11519 msgstr "Asia/Damaskus" 11520 11521 #. i18n: comment to the previous timezone 11522 #: kdecore/TIMEZONES:784 11523 #, kde-format 11524 msgid "Northern Cyprus" 11525 msgstr "" 11526 11527 #: kdecore/TIMEZONES:785 11528 #, kde-format 11529 msgid "Asia/Gaza" 11530 msgstr "Asia/Gaza" 11531 11532 #. i18n: comment to the previous timezone 11533 #: kdecore/TIMEZONES:787 11534 #, kde-format 11535 msgid "Gaza Strip" 11536 msgstr "" 11537 11538 #: kdecore/TIMEZONES:788 11539 #, kde-format 11540 msgid "Asia/Harbin" 11541 msgstr "Asia/Harbin" 11542 11543 #. i18n: comment to the previous timezone 11544 #: kdecore/TIMEZONES:790 11545 #, kde-format 11546 msgid "Heilongjiang (except Mohe), Jilin" 11547 msgstr "" 11548 11549 #. i18n: comment to the previous timezone 11550 #: kdecore/TIMEZONES:792 11551 #, kde-format 11552 msgid "China north" 11553 msgstr "" 11554 11555 #: kdecore/TIMEZONES:793 11556 #, fuzzy, kde-format 11557 #| msgid "Asia/Harbin" 11558 msgid "Asia/Hebron" 11559 msgstr "Asia/Harbin" 11560 11561 #. i18n: comment to the previous timezone 11562 #: kdecore/TIMEZONES:795 11563 #, kde-format 11564 msgid "West Bank" 11565 msgstr "" 11566 11567 #: kdecore/TIMEZONES:796 11568 #, fuzzy, kde-format 11569 #| msgid "Asia/Chongqing" 11570 msgid "Asia/Ho_Chi_Minh" 11571 msgstr "Asia/Chongqing" 11572 11573 #: kdecore/TIMEZONES:797 11574 #, kde-format 11575 msgid "Asia/Hong_Kong" 11576 msgstr "Asia/Hong_Kong" 11577 11578 #: kdecore/TIMEZONES:798 11579 #, kde-format 11580 msgid "Asia/Hovd" 11581 msgstr "Asia/Hovd" 11582 11583 #. i18n: comment to the previous timezone 11584 #: kdecore/TIMEZONES:800 11585 #, kde-format 11586 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11587 msgstr "" 11588 11589 #: kdecore/TIMEZONES:801 11590 #, kde-format 11591 msgid "Asia/Irkutsk" 11592 msgstr "Asia/Irkutsk" 11593 11594 #. i18n: comment to the previous timezone 11595 #: kdecore/TIMEZONES:803 11596 #, kde-format 11597 msgid "Moscow+05 - Lake Baikal" 11598 msgstr "" 11599 11600 #. i18n: comment to the previous timezone 11601 #: kdecore/TIMEZONES:805 11602 #, kde-format 11603 msgid "MSK+05 - Irkutsk, Buryatia" 11604 msgstr "" 11605 11606 #: kdecore/TIMEZONES:806 11607 #, kde-format 11608 msgid "Asia/Jakarta" 11609 msgstr "Asia/Jakarta" 11610 11611 #. i18n: comment to the previous timezone 11612 #: kdecore/TIMEZONES:808 11613 #, kde-format 11614 msgid "Java & Sumatra" 11615 msgstr "" 11616 11617 #. i18n: comment to the previous timezone 11618 #: kdecore/TIMEZONES:810 11619 #, kde-format 11620 msgid "Java, Sumatra" 11621 msgstr "" 11622 11623 #: kdecore/TIMEZONES:811 11624 #, kde-format 11625 msgid "Asia/Jayapura" 11626 msgstr "Asia/Jayapura" 11627 11628 #. i18n: comment to the previous timezone 11629 #: kdecore/TIMEZONES:813 11630 #, kde-format 11631 msgid "Irian Jaya & the Moluccas" 11632 msgstr "" 11633 11634 #. i18n: comment to the previous timezone 11635 #: kdecore/TIMEZONES:815 11636 #, kde-format 11637 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11638 msgstr "" 11639 11640 #. i18n: comment to the previous timezone 11641 #: kdecore/TIMEZONES:817 11642 #, kde-format 11643 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11644 msgstr "" 11645 11646 #: kdecore/TIMEZONES:818 11647 #, kde-format 11648 msgid "Asia/Jerusalem" 11649 msgstr "Asia/Jerusalem" 11650 11651 #: kdecore/TIMEZONES:819 11652 #, kde-format 11653 msgid "Asia/Kabul" 11654 msgstr "Asia/Kabul" 11655 11656 #: kdecore/TIMEZONES:820 11657 #, kde-format 11658 msgid "Asia/Kamchatka" 11659 msgstr "Asia/Kamchatka" 11660 11661 #. i18n: comment to the previous timezone 11662 #: kdecore/TIMEZONES:822 11663 #, kde-format 11664 msgid "Moscow+09 - Kamchatka" 11665 msgstr "" 11666 11667 #. i18n: comment to the previous timezone 11668 #: kdecore/TIMEZONES:824 11669 #, kde-format 11670 msgid "Moscow+08 - Kamchatka" 11671 msgstr "" 11672 11673 #. i18n: comment to the previous timezone 11674 #: kdecore/TIMEZONES:826 11675 #, kde-format 11676 msgid "MSK+09 - Kamchatka" 11677 msgstr "" 11678 11679 #: kdecore/TIMEZONES:827 11680 #, kde-format 11681 msgid "Asia/Karachi" 11682 msgstr "Asia/Karachi" 11683 11684 #: kdecore/TIMEZONES:828 11685 #, kde-format 11686 msgid "Asia/Kashgar" 11687 msgstr "Asia/Kashgar" 11688 11689 #. i18n: comment to the previous timezone 11690 #: kdecore/TIMEZONES:830 11691 #, kde-format 11692 msgid "west Tibet & Xinjiang" 11693 msgstr "" 11694 11695 #. i18n: comment to the previous timezone 11696 #: kdecore/TIMEZONES:832 11697 #, kde-format 11698 msgid "China west Xinjiang" 11699 msgstr "" 11700 11701 #: kdecore/TIMEZONES:833 11702 #, fuzzy, kde-format 11703 #| msgid "Asia/Katmandu" 11704 msgid "Asia/Kathmandu" 11705 msgstr "Asia/Katmandu" 11706 11707 #: kdecore/TIMEZONES:834 11708 #, kde-format 11709 msgid "Asia/Katmandu" 11710 msgstr "Asia/Katmandu" 11711 11712 #: kdecore/TIMEZONES:835 11713 #, fuzzy, kde-format 11714 #| msgid "Asia/Shanghai" 11715 msgid "Asia/Khandyga" 11716 msgstr "Asia/Shanghai" 11717 11718 #. i18n: comment to the previous timezone 11719 #: kdecore/TIMEZONES:837 11720 #, kde-format 11721 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11722 msgstr "" 11723 11724 #: kdecore/TIMEZONES:838 11725 #, fuzzy, kde-format 11726 #| msgid "Asia/Jakarta" 11727 msgid "Asia/Kolkata" 11728 msgstr "Asia/Jakarta" 11729 11730 #: kdecore/TIMEZONES:839 11731 #, kde-format 11732 msgid "Asia/Krasnoyarsk" 11733 msgstr "Asia/Krasnoyarsk" 11734 11735 #. i18n: comment to the previous timezone 11736 #: kdecore/TIMEZONES:841 11737 #, kde-format 11738 msgid "Moscow+04 - Yenisei River" 11739 msgstr "" 11740 11741 #. i18n: comment to the previous timezone 11742 #: kdecore/TIMEZONES:843 11743 #, kde-format 11744 msgid "MSK+04 - Krasnoyarsk area" 11745 msgstr "" 11746 11747 #: kdecore/TIMEZONES:844 11748 #, kde-format 11749 msgid "Asia/Kuala_Lumpur" 11750 msgstr "Asia/Kuala_Lumpur" 11751 11752 #. i18n: comment to the previous timezone 11753 #: kdecore/TIMEZONES:846 11754 #, kde-format 11755 msgid "peninsular Malaysia" 11756 msgstr "" 11757 11758 #. i18n: comment to the previous timezone 11759 #: kdecore/TIMEZONES:848 11760 #, kde-format 11761 msgid "Malaysia (peninsula)" 11762 msgstr "" 11763 11764 #: kdecore/TIMEZONES:849 11765 #, kde-format 11766 msgid "Asia/Kuching" 11767 msgstr "Asia/Kuching" 11768 11769 #. i18n: comment to the previous timezone 11770 #: kdecore/TIMEZONES:851 11771 #, kde-format 11772 msgid "Sabah & Sarawak" 11773 msgstr "" 11774 11775 #. i18n: comment to the previous timezone 11776 #: kdecore/TIMEZONES:853 11777 #, kde-format 11778 msgid "Sabah, Sarawak" 11779 msgstr "" 11780 11781 #: kdecore/TIMEZONES:854 11782 #, kde-format 11783 msgid "Asia/Kuwait" 11784 msgstr "Asia/Kuwait" 11785 11786 #: kdecore/TIMEZONES:855 11787 #, fuzzy, kde-format 11788 #| msgid "Asia/Macau" 11789 msgid "Asia/Macao" 11790 msgstr "Asia/Macau" 11791 11792 #: kdecore/TIMEZONES:856 11793 #, kde-format 11794 msgid "Asia/Macau" 11795 msgstr "Asia/Macau" 11796 11797 #: kdecore/TIMEZONES:857 11798 #, kde-format 11799 msgid "Asia/Magadan" 11800 msgstr "Asia/Magadan" 11801 11802 #. i18n: comment to the previous timezone 11803 #: kdecore/TIMEZONES:859 11804 #, kde-format 11805 msgid "Moscow+08 - Magadan" 11806 msgstr "" 11807 11808 #. i18n: comment to the previous timezone 11809 #: kdecore/TIMEZONES:861 11810 #, kde-format 11811 msgid "MSK+08 - Magadan" 11812 msgstr "" 11813 11814 #: kdecore/TIMEZONES:862 11815 #, fuzzy, kde-format 11816 msgid "Asia/Makassar" 11817 msgstr "Asia/Makassar" 11818 11819 #. i18n: comment to the previous timezone 11820 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11821 #, kde-format 11822 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11823 msgstr "" 11824 11825 #. i18n: comment to the previous timezone 11826 #: kdecore/TIMEZONES:866 11827 #, kde-format 11828 msgid "" 11829 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11830 msgstr "" 11831 11832 #. i18n: comment to the previous timezone 11833 #: kdecore/TIMEZONES:868 11834 #, kde-format 11835 msgid "" 11836 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11837 msgstr "" 11838 11839 #: kdecore/TIMEZONES:869 11840 #, kde-format 11841 msgid "Asia/Manila" 11842 msgstr "Asia/Manila" 11843 11844 #: kdecore/TIMEZONES:870 11845 #, kde-format 11846 msgid "Asia/Muscat" 11847 msgstr "Asia/Muscat" 11848 11849 #: kdecore/TIMEZONES:871 11850 #, kde-format 11851 msgid "Asia/Nicosia" 11852 msgstr "Asia/Nicosia" 11853 11854 #. i18n: comment to the previous timezone 11855 #: kdecore/TIMEZONES:873 11856 #, kde-format 11857 msgid "Cyprus (most areas)" 11858 msgstr "" 11859 11860 #: kdecore/TIMEZONES:874 11861 #, fuzzy, kde-format 11862 #| msgid "Asia/Irkutsk" 11863 msgid "Asia/Novokuznetsk" 11864 msgstr "Asia/Irkutsk" 11865 11866 #. i18n: comment to the previous timezone 11867 #: kdecore/TIMEZONES:876 11868 #, fuzzy, kde-format 11869 #| msgid "Asia/Novosibirsk" 11870 msgid "Moscow+03 - Novokuznetsk" 11871 msgstr "Asia/Novosibirsk" 11872 11873 #. i18n: comment to the previous timezone 11874 #: kdecore/TIMEZONES:878 11875 #, kde-format 11876 msgid "MSK+04 - Kemerovo" 11877 msgstr "" 11878 11879 #: kdecore/TIMEZONES:879 11880 #, kde-format 11881 msgid "Asia/Novosibirsk" 11882 msgstr "Asia/Novosibirsk" 11883 11884 #. i18n: comment to the previous timezone 11885 #: kdecore/TIMEZONES:881 11886 #, fuzzy, kde-format 11887 #| msgid "Asia/Novosibirsk" 11888 msgid "Moscow+03 - Novosibirsk" 11889 msgstr "Asia/Novosibirsk" 11890 11891 #. i18n: comment to the previous timezone 11892 #: kdecore/TIMEZONES:883 11893 #, fuzzy, kde-format 11894 #| msgid "Asia/Novosibirsk" 11895 msgid "MSK+04 - Novosibirsk" 11896 msgstr "Asia/Novosibirsk" 11897 11898 #: kdecore/TIMEZONES:884 11899 #, kde-format 11900 msgid "Asia/Omsk" 11901 msgstr "Asia/Omsk" 11902 11903 #. i18n: comment to the previous timezone 11904 #: kdecore/TIMEZONES:886 11905 #, kde-format 11906 msgid "Moscow+03 - west Siberia" 11907 msgstr "" 11908 11909 #. i18n: comment to the previous timezone 11910 #: kdecore/TIMEZONES:888 11911 #, kde-format 11912 msgid "MSK+03 - Omsk" 11913 msgstr "" 11914 11915 #: kdecore/TIMEZONES:889 11916 #, kde-format 11917 msgid "Asia/Oral" 11918 msgstr "Asia/Oral" 11919 11920 #. i18n: comment to the previous timezone 11921 #: kdecore/TIMEZONES:891 11922 #, kde-format 11923 msgid "West Kazakhstan" 11924 msgstr "" 11925 11926 #: kdecore/TIMEZONES:892 11927 #, kde-format 11928 msgid "Asia/Phnom_Penh" 11929 msgstr "Asia/Phnom_Penh" 11930 11931 #: kdecore/TIMEZONES:893 11932 #, kde-format 11933 msgid "Asia/Pontianak" 11934 msgstr "Asia/Pontianak" 11935 11936 #. i18n: comment to the previous timezone 11937 #: kdecore/TIMEZONES:895 11938 #, kde-format 11939 msgid "west & central Borneo" 11940 msgstr "" 11941 11942 #. i18n: comment to the previous timezone 11943 #: kdecore/TIMEZONES:897 11944 #, kde-format 11945 msgid "Borneo (west, central)" 11946 msgstr "" 11947 11948 #: kdecore/TIMEZONES:898 11949 #, kde-format 11950 msgid "Asia/Pyongyang" 11951 msgstr "Asia/Pyongyang" 11952 11953 #: kdecore/TIMEZONES:899 11954 #, kde-format 11955 msgid "Asia/Qatar" 11956 msgstr "Asia/Qatar" 11957 11958 #: kdecore/TIMEZONES:900 11959 #, fuzzy, kde-format 11960 #| msgid "Asia/Pontianak" 11961 msgid "Asia/Qostanay" 11962 msgstr "Asia/Pontianak" 11963 11964 #. i18n: comment to the previous timezone 11965 #: kdecore/TIMEZONES:902 11966 #, kde-format 11967 msgid "Qostanay/Kostanay/Kustanay" 11968 msgstr "" 11969 11970 #: kdecore/TIMEZONES:903 11971 #, kde-format 11972 msgid "Asia/Qyzylorda" 11973 msgstr "Asia/Qyzylorda" 11974 11975 #. i18n: comment to the previous timezone 11976 #: kdecore/TIMEZONES:905 11977 #, kde-format 11978 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11979 msgstr "" 11980 11981 #. i18n: comment to the previous timezone 11982 #: kdecore/TIMEZONES:907 11983 #, kde-format 11984 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11985 msgstr "" 11986 11987 #: kdecore/TIMEZONES:908 11988 #, kde-format 11989 msgid "Asia/Rangoon" 11990 msgstr "Asia/Rangoon" 11991 11992 #: kdecore/TIMEZONES:909 11993 #, kde-format 11994 msgid "Asia/Riyadh" 11995 msgstr "Asia/Riyadh" 11996 11997 #: kdecore/TIMEZONES:910 11998 #, kde-format 11999 msgid "Asia/Saigon" 12000 msgstr "Asia/Saigon" 12001 12002 #: kdecore/TIMEZONES:911 12003 #, kde-format 12004 msgid "Asia/Sakhalin" 12005 msgstr "Asia/Sakhalin" 12006 12007 #. i18n: comment to the previous timezone 12008 #: kdecore/TIMEZONES:913 12009 #, kde-format 12010 msgid "Moscow+07 - Sakhalin Island" 12011 msgstr "" 12012 12013 #. i18n: comment to the previous timezone 12014 #: kdecore/TIMEZONES:915 12015 #, kde-format 12016 msgid "MSK+08 - Sakhalin Island" 12017 msgstr "" 12018 12019 #: kdecore/TIMEZONES:916 12020 #, kde-format 12021 msgid "Asia/Samarkand" 12022 msgstr "Asia/Samarkand" 12023 12024 #. i18n: comment to the previous timezone 12025 #: kdecore/TIMEZONES:918 12026 #, kde-format 12027 msgid "west Uzbekistan" 12028 msgstr "" 12029 12030 #. i18n: comment to the previous timezone 12031 #: kdecore/TIMEZONES:920 12032 #, kde-format 12033 msgid "Uzbekistan (west)" 12034 msgstr "" 12035 12036 #: kdecore/TIMEZONES:921 12037 #, kde-format 12038 msgid "Asia/Seoul" 12039 msgstr "Asia/Seoul" 12040 12041 #: kdecore/TIMEZONES:922 12042 #, kde-format 12043 msgid "Asia/Shanghai" 12044 msgstr "Asia/Shanghai" 12045 12046 #. i18n: comment to the previous timezone 12047 #: kdecore/TIMEZONES:926 12048 #, kde-format 12049 msgid "China east" 12050 msgstr "" 12051 12052 #. i18n: comment to the previous timezone 12053 #: kdecore/TIMEZONES:928 12054 #, kde-format 12055 msgid "Beijing Time" 12056 msgstr "" 12057 12058 #: kdecore/TIMEZONES:929 12059 #, kde-format 12060 msgid "Asia/Singapore" 12061 msgstr "Asia/Singapura" 12062 12063 #: kdecore/TIMEZONES:930 12064 #, fuzzy, kde-format 12065 #| msgid "Asia/Krasnoyarsk" 12066 msgid "Asia/Srednekolymsk" 12067 msgstr "Asia/Krasnoyarsk" 12068 12069 #. i18n: comment to the previous timezone 12070 #: kdecore/TIMEZONES:932 12071 #, kde-format 12072 msgid "MSK+08 - Sakha (E); North Kuril Is" 12073 msgstr "" 12074 12075 #: kdecore/TIMEZONES:933 12076 #, kde-format 12077 msgid "Asia/Taipei" 12078 msgstr "Asia/Taipei" 12079 12080 #: kdecore/TIMEZONES:934 12081 #, kde-format 12082 msgid "Asia/Tashkent" 12083 msgstr "Asia/Tashkent" 12084 12085 #. i18n: comment to the previous timezone 12086 #: kdecore/TIMEZONES:936 12087 #, kde-format 12088 msgid "east Uzbekistan" 12089 msgstr "" 12090 12091 #. i18n: comment to the previous timezone 12092 #: kdecore/TIMEZONES:938 12093 #, kde-format 12094 msgid "Uzbekistan (east)" 12095 msgstr "" 12096 12097 #: kdecore/TIMEZONES:939 12098 #, kde-format 12099 msgid "Asia/Tbilisi" 12100 msgstr "Asia/Tbilisi" 12101 12102 #: kdecore/TIMEZONES:940 12103 #, kde-format 12104 msgid "Asia/Tehran" 12105 msgstr "Asia/Tehran" 12106 12107 #: kdecore/TIMEZONES:941 12108 #, fuzzy, kde-format 12109 #| msgid "Asia/Taipei" 12110 msgid "Asia/Tel_Aviv" 12111 msgstr "Asia/Taipei" 12112 12113 #: kdecore/TIMEZONES:942 12114 #, fuzzy, kde-format 12115 #| msgid "Asia/Thimphu" 12116 msgid "Asia/Thimbu" 12117 msgstr "Asia/Thimphu" 12118 12119 #: kdecore/TIMEZONES:943 12120 #, kde-format 12121 msgid "Asia/Thimphu" 12122 msgstr "Asia/Thimphu" 12123 12124 #: kdecore/TIMEZONES:944 12125 #, kde-format 12126 msgid "Asia/Tokyo" 12127 msgstr "Asia/Tokyo" 12128 12129 #: kdecore/TIMEZONES:945 12130 #, fuzzy, kde-format 12131 #| msgid "Asia/Omsk" 12132 msgid "Asia/Tomsk" 12133 msgstr "Asia/Omsk" 12134 12135 #. i18n: comment to the previous timezone 12136 #: kdecore/TIMEZONES:947 12137 #, kde-format 12138 msgid "MSK+04 - Tomsk" 12139 msgstr "" 12140 12141 #: kdecore/TIMEZONES:948 12142 #, kde-format 12143 msgid "Asia/Ujung_Pandang" 12144 msgstr "Asia/Ujung_Pandang" 12145 12146 #: kdecore/TIMEZONES:951 12147 #, kde-format 12148 msgid "Asia/Ulaanbaatar" 12149 msgstr "Asia/Ulaanbaatar" 12150 12151 #. i18n: comment to the previous timezone 12152 #: kdecore/TIMEZONES:955 12153 #, kde-format 12154 msgid "Mongolia (most areas)" 12155 msgstr "" 12156 12157 #: kdecore/TIMEZONES:956 12158 #, fuzzy, kde-format 12159 #| msgid "Asia/Ulaanbaatar" 12160 msgid "Asia/Ulan_Bator" 12161 msgstr "Asia/Ulaanbaatar" 12162 12163 #: kdecore/TIMEZONES:959 12164 #, kde-format 12165 msgid "Asia/Urumqi" 12166 msgstr "Asia/Urumqi" 12167 12168 #. i18n: comment to the previous timezone 12169 #: kdecore/TIMEZONES:961 12170 #, kde-format 12171 msgid "most of Tibet & Xinjiang" 12172 msgstr "" 12173 12174 #. i18n: comment to the previous timezone 12175 #: kdecore/TIMEZONES:963 12176 #, kde-format 12177 msgid "China Xinjiang-Tibet" 12178 msgstr "" 12179 12180 #. i18n: comment to the previous timezone 12181 #: kdecore/TIMEZONES:965 12182 #, kde-format 12183 msgid "Xinjiang Time" 12184 msgstr "" 12185 12186 #: kdecore/TIMEZONES:966 12187 #, fuzzy, kde-format 12188 #| msgid "Asia/Tehran" 12189 msgid "Asia/Ust-Nera" 12190 msgstr "Asia/Tehran" 12191 12192 #. i18n: comment to the previous timezone 12193 #: kdecore/TIMEZONES:968 12194 #, kde-format 12195 msgid "MSK+07 - Oymyakonsky" 12196 msgstr "" 12197 12198 #: kdecore/TIMEZONES:969 12199 #, kde-format 12200 msgid "Asia/Vientiane" 12201 msgstr "Asia/Vientiane" 12202 12203 #: kdecore/TIMEZONES:970 12204 #, kde-format 12205 msgid "Asia/Vladivostok" 12206 msgstr "Asia/Vladivostok" 12207 12208 #. i18n: comment to the previous timezone 12209 #: kdecore/TIMEZONES:972 12210 #, kde-format 12211 msgid "Moscow+07 - Amur River" 12212 msgstr "" 12213 12214 #. i18n: comment to the previous timezone 12215 #: kdecore/TIMEZONES:974 12216 #, kde-format 12217 msgid "MSK+07 - Amur River" 12218 msgstr "" 12219 12220 #: kdecore/TIMEZONES:975 12221 #, kde-format 12222 msgid "Asia/Yakutsk" 12223 msgstr "Asia/Yakutsk" 12224 12225 #. i18n: comment to the previous timezone 12226 #: kdecore/TIMEZONES:977 12227 #, kde-format 12228 msgid "Moscow+06 - Lena River" 12229 msgstr "" 12230 12231 #. i18n: comment to the previous timezone 12232 #: kdecore/TIMEZONES:979 12233 #, kde-format 12234 msgid "MSK+06 - Lena River" 12235 msgstr "" 12236 12237 #: kdecore/TIMEZONES:980 12238 #, fuzzy, kde-format 12239 #| msgid "Asia/Rangoon" 12240 msgid "Asia/Yangon" 12241 msgstr "Asia/Rangoon" 12242 12243 #: kdecore/TIMEZONES:981 12244 #, kde-format 12245 msgid "Asia/Yekaterinburg" 12246 msgstr "Asia/Yekaterinburg" 12247 12248 #. i18n: comment to the previous timezone 12249 #: kdecore/TIMEZONES:983 12250 #, kde-format 12251 msgid "Moscow+02 - Urals" 12252 msgstr "" 12253 12254 #. i18n: comment to the previous timezone 12255 #: kdecore/TIMEZONES:985 12256 #, kde-format 12257 msgid "MSK+02 - Urals" 12258 msgstr "" 12259 12260 #: kdecore/TIMEZONES:986 12261 #, kde-format 12262 msgid "Asia/Yerevan" 12263 msgstr "Asia/Yerevan" 12264 12265 #: kdecore/TIMEZONES:987 12266 #, kde-format 12267 msgid "Atlantic/Azores" 12268 msgstr "Atlantik/Azores" 12269 12270 #. i18n: comment to the previous timezone 12271 #: kdecore/TIMEZONES:989 12272 #, kde-format 12273 msgid "Azores" 12274 msgstr "" 12275 12276 #: kdecore/TIMEZONES:990 12277 #, kde-format 12278 msgid "Atlantic/Bermuda" 12279 msgstr "Atlantik/Bermuda" 12280 12281 #: kdecore/TIMEZONES:991 12282 #, kde-format 12283 msgid "Atlantic/Canary" 12284 msgstr "Atlantik/Canary" 12285 12286 #. i18n: comment to the previous timezone 12287 #: kdecore/TIMEZONES:993 12288 #, kde-format 12289 msgid "Canary Islands" 12290 msgstr "" 12291 12292 #: kdecore/TIMEZONES:994 12293 #, kde-format 12294 msgid "Atlantic/Cape_Verde" 12295 msgstr "Atlantik/Cape_Verde" 12296 12297 #: kdecore/TIMEZONES:995 12298 #, kde-format 12299 msgid "Atlantic/Faeroe" 12300 msgstr "Atlantik/Faeroe" 12301 12302 #: kdecore/TIMEZONES:996 12303 #, fuzzy, kde-format 12304 #| msgid "Atlantic/Faeroe" 12305 msgid "Atlantic/Faroe" 12306 msgstr "Atlantik/Faeroe" 12307 12308 #: kdecore/TIMEZONES:997 12309 #, kde-format 12310 msgid "Atlantic/Jan_Mayen" 12311 msgstr "Atlantik/Jan_Mayen" 12312 12313 #: kdecore/TIMEZONES:998 12314 #, kde-format 12315 msgid "Atlantic/Madeira" 12316 msgstr "Atlantik/Madeira" 12317 12318 #. i18n: comment to the previous timezone 12319 #: kdecore/TIMEZONES:1000 12320 #, kde-format 12321 msgid "Madeira Islands" 12322 msgstr "" 12323 12324 #: kdecore/TIMEZONES:1001 12325 #, kde-format 12326 msgid "Atlantic/Reykjavik" 12327 msgstr "Atlantik/Reykjavik" 12328 12329 #: kdecore/TIMEZONES:1002 12330 #, kde-format 12331 msgid "Atlantic/South_Georgia" 12332 msgstr "Atlantik/Georgia_Selatan" 12333 12334 #: kdecore/TIMEZONES:1003 12335 #, kde-format 12336 msgid "Atlantic/St_Helena" 12337 msgstr "Atlantik/St_Helena" 12338 12339 #: kdecore/TIMEZONES:1004 12340 #, kde-format 12341 msgid "Atlantic/Stanley" 12342 msgstr "Atlantik/Stanley" 12343 12344 #: kdecore/TIMEZONES:1005 12345 #, fuzzy, kde-format 12346 #| msgid "Australia/Brisbane" 12347 msgid "Australia/ACT" 12348 msgstr "Australia/Brisbane" 12349 12350 #. i18n: comment to the previous timezone 12351 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12352 #: kdecore/TIMEZONES:1073 12353 #, kde-format 12354 msgid "New South Wales - most locations" 12355 msgstr "" 12356 12357 #: kdecore/TIMEZONES:1008 12358 #, kde-format 12359 msgid "Australia/Adelaide" 12360 msgstr "Australia/Adelaide" 12361 12362 #. i18n: comment to the previous timezone 12363 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12364 #, fuzzy, kde-format 12365 #| msgid "Australia/Adelaide" 12366 msgid "South Australia" 12367 msgstr "Australia/Adelaide" 12368 12369 #: kdecore/TIMEZONES:1011 12370 #, kde-format 12371 msgid "Australia/Brisbane" 12372 msgstr "Australia/Brisbane" 12373 12374 #. i18n: comment to the previous timezone 12375 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12376 #, kde-format 12377 msgid "Queensland - most locations" 12378 msgstr "" 12379 12380 #. i18n: comment to the previous timezone 12381 #: kdecore/TIMEZONES:1015 12382 #, kde-format 12383 msgid "Queensland (most areas)" 12384 msgstr "" 12385 12386 #: kdecore/TIMEZONES:1016 12387 #, kde-format 12388 msgid "Australia/Broken_Hill" 12389 msgstr "Australia/Broken_Hill" 12390 12391 #. i18n: comment to the previous timezone 12392 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12393 #, kde-format 12394 msgid "New South Wales - Yancowinna" 12395 msgstr "" 12396 12397 #. i18n: comment to the previous timezone 12398 #: kdecore/TIMEZONES:1020 12399 #, kde-format 12400 msgid "New South Wales (Yancowinna)" 12401 msgstr "" 12402 12403 #: kdecore/TIMEZONES:1021 12404 #, fuzzy, kde-format 12405 #| msgid "Australia/Brisbane" 12406 msgid "Australia/Canberra" 12407 msgstr "Australia/Brisbane" 12408 12409 #: kdecore/TIMEZONES:1024 12410 #, fuzzy, kde-format 12411 #| msgid "Australia/Brisbane" 12412 msgid "Australia/Currie" 12413 msgstr "Australia/Brisbane" 12414 12415 #. i18n: comment to the previous timezone 12416 #: kdecore/TIMEZONES:1026 12417 #, kde-format 12418 msgid "Tasmania - King Island" 12419 msgstr "" 12420 12421 #: kdecore/TIMEZONES:1027 12422 #, kde-format 12423 msgid "Australia/Darwin" 12424 msgstr "Australia/Darwin" 12425 12426 #. i18n: comment to the previous timezone 12427 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12428 #, kde-format 12429 msgid "Northern Territory" 12430 msgstr "" 12431 12432 #: kdecore/TIMEZONES:1030 12433 #, fuzzy, kde-format 12434 #| msgid "Australia/Adelaide" 12435 msgid "Australia/Eucla" 12436 msgstr "Australia/Adelaide" 12437 12438 #. i18n: comment to the previous timezone 12439 #: kdecore/TIMEZONES:1032 12440 #, fuzzy, kde-format 12441 #| msgid "Australia/Adelaide" 12442 msgid "Western Australia - Eucla area" 12443 msgstr "Australia/Adelaide" 12444 12445 #. i18n: comment to the previous timezone 12446 #: kdecore/TIMEZONES:1034 12447 #, fuzzy, kde-format 12448 #| msgid "Australia/Adelaide" 12449 msgid "Western Australia (Eucla)" 12450 msgstr "Australia/Adelaide" 12451 12452 #: kdecore/TIMEZONES:1035 12453 #, kde-format 12454 msgid "Australia/Hobart" 12455 msgstr "Australia/Hobart" 12456 12457 #. i18n: comment to the previous timezone 12458 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12459 #, kde-format 12460 msgid "Tasmania - most locations" 12461 msgstr "" 12462 12463 #. i18n: comment to the previous timezone 12464 #: kdecore/TIMEZONES:1039 12465 #, fuzzy, kde-format 12466 #| msgid "Australia/Brisbane" 12467 msgid "Tasmania" 12468 msgstr "Australia/Brisbane" 12469 12470 #: kdecore/TIMEZONES:1040 12471 #, fuzzy, kde-format 12472 #| msgid "Australia/Hobart" 12473 msgid "Australia/LHI" 12474 msgstr "Australia/Hobart" 12475 12476 #. i18n: comment to the previous timezone 12477 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12478 #, kde-format 12479 msgid "Lord Howe Island" 12480 msgstr "" 12481 12482 #: kdecore/TIMEZONES:1043 12483 #, kde-format 12484 msgid "Australia/Lindeman" 12485 msgstr "Australia/Lindeman" 12486 12487 #. i18n: comment to the previous timezone 12488 #: kdecore/TIMEZONES:1045 12489 #, kde-format 12490 msgid "Queensland - Holiday Islands" 12491 msgstr "" 12492 12493 #. i18n: comment to the previous timezone 12494 #: kdecore/TIMEZONES:1047 12495 #, kde-format 12496 msgid "Queensland (Whitsunday Islands)" 12497 msgstr "" 12498 12499 #: kdecore/TIMEZONES:1048 12500 #, kde-format 12501 msgid "Australia/Lord_Howe" 12502 msgstr "Australia/Lord_Howe" 12503 12504 #: kdecore/TIMEZONES:1051 12505 #, kde-format 12506 msgid "Australia/Melbourne" 12507 msgstr "Australia/Melbourne" 12508 12509 #. i18n: comment to the previous timezone 12510 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12511 #, kde-format 12512 msgid "Victoria" 12513 msgstr "" 12514 12515 #: kdecore/TIMEZONES:1054 12516 #, fuzzy, kde-format 12517 #| msgid "Australia/Sydney" 12518 msgid "Australia/NSW" 12519 msgstr "Australia/Sydney" 12520 12521 #: kdecore/TIMEZONES:1057 12522 #, fuzzy, kde-format 12523 #| msgid "Australia/Perth" 12524 msgid "Australia/North" 12525 msgstr "Australia/Perth" 12526 12527 #: kdecore/TIMEZONES:1060 12528 #, kde-format 12529 msgid "Australia/Perth" 12530 msgstr "Australia/Perth" 12531 12532 #. i18n: comment to the previous timezone 12533 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12534 #, kde-format 12535 msgid "Western Australia - most locations" 12536 msgstr "" 12537 12538 #. i18n: comment to the previous timezone 12539 #: kdecore/TIMEZONES:1064 12540 #, fuzzy, kde-format 12541 #| msgid "Australia/Adelaide" 12542 msgid "Western Australia (most areas)" 12543 msgstr "Australia/Adelaide" 12544 12545 #: kdecore/TIMEZONES:1065 12546 #, fuzzy, kde-format 12547 #| msgid "Australia/Adelaide" 12548 msgid "Australia/Queensland" 12549 msgstr "Australia/Adelaide" 12550 12551 #: kdecore/TIMEZONES:1068 12552 #, fuzzy, kde-format 12553 #| msgid "Australia/Perth" 12554 msgid "Australia/South" 12555 msgstr "Australia/Perth" 12556 12557 #: kdecore/TIMEZONES:1071 12558 #, kde-format 12559 msgid "Australia/Sydney" 12560 msgstr "Australia/Sydney" 12561 12562 #. i18n: comment to the previous timezone 12563 #: kdecore/TIMEZONES:1075 12564 #, kde-format 12565 msgid "New South Wales (most areas)" 12566 msgstr "" 12567 12568 #: kdecore/TIMEZONES:1076 12569 #, fuzzy, kde-format 12570 #| msgid "Australia/Brisbane" 12571 msgid "Australia/Tasmania" 12572 msgstr "Australia/Brisbane" 12573 12574 #: kdecore/TIMEZONES:1079 12575 #, fuzzy, kde-format 12576 #| msgid "Australia/Adelaide" 12577 msgid "Australia/Victoria" 12578 msgstr "Australia/Adelaide" 12579 12580 #: kdecore/TIMEZONES:1082 12581 #, fuzzy, kde-format 12582 #| msgid "Australia/Perth" 12583 msgid "Australia/West" 12584 msgstr "Australia/Perth" 12585 12586 #: kdecore/TIMEZONES:1085 12587 #, fuzzy, kde-format 12588 #| msgid "Australia/Darwin" 12589 msgid "Australia/Yancowinna" 12590 msgstr "Australia/Darwin" 12591 12592 #: kdecore/TIMEZONES:1088 12593 #, kde-format 12594 msgid "Brazil/Acre" 12595 msgstr "" 12596 12597 #: kdecore/TIMEZONES:1091 12598 #, fuzzy, kde-format 12599 #| msgid "America/Noronha" 12600 msgid "Brazil/DeNoronha" 12601 msgstr "Amerika/Noronha" 12602 12603 #: kdecore/TIMEZONES:1094 12604 #, kde-format 12605 msgid "Brazil/East" 12606 msgstr "" 12607 12608 #: kdecore/TIMEZONES:1097 12609 #, kde-format 12610 msgid "Brazil/West" 12611 msgstr "" 12612 12613 #: kdecore/TIMEZONES:1100 12614 #, kde-format 12615 msgid "Canada/Atlantic" 12616 msgstr "" 12617 12618 #: kdecore/TIMEZONES:1103 12619 #, kde-format 12620 msgid "Canada/Central" 12621 msgstr "" 12622 12623 #: kdecore/TIMEZONES:1106 12624 #, kde-format 12625 msgid "Canada/East-Saskatchewan" 12626 msgstr "" 12627 12628 #: kdecore/TIMEZONES:1109 12629 #, kde-format 12630 msgid "Canada/Eastern" 12631 msgstr "" 12632 12633 #: kdecore/TIMEZONES:1112 12634 #, kde-format 12635 msgid "Canada/Mountain" 12636 msgstr "" 12637 12638 #: kdecore/TIMEZONES:1115 12639 #, kde-format 12640 msgid "Canada/Newfoundland" 12641 msgstr "" 12642 12643 #: kdecore/TIMEZONES:1118 12644 #, kde-format 12645 msgid "Canada/Pacific" 12646 msgstr "" 12647 12648 #: kdecore/TIMEZONES:1121 12649 #, kde-format 12650 msgid "Canada/Saskatchewan" 12651 msgstr "" 12652 12653 #: kdecore/TIMEZONES:1124 12654 #, kde-format 12655 msgid "Canada/Yukon" 12656 msgstr "" 12657 12658 #: kdecore/TIMEZONES:1127 12659 #, kde-format 12660 msgid "Chile/Continental" 12661 msgstr "" 12662 12663 #: kdecore/TIMEZONES:1130 12664 #, kde-format 12665 msgid "Chile/EasterIsland" 12666 msgstr "" 12667 12668 #. i18n: comment to the previous timezone 12669 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12670 #, kde-format 12671 msgid "Easter Island & Sala y Gomez" 12672 msgstr "" 12673 12674 #: kdecore/TIMEZONES:1133 12675 #, fuzzy, kde-format 12676 msgid "Cuba" 12677 msgstr "Cuba" 12678 12679 #: kdecore/TIMEZONES:1134 12680 #, fuzzy, kde-format 12681 msgid "Egypt" 12682 msgstr "Mesir" 12683 12684 #: kdecore/TIMEZONES:1135 12685 #, kde-format 12686 msgid "Eire" 12687 msgstr "" 12688 12689 #: kdecore/TIMEZONES:1136 12690 #, kde-format 12691 msgid "Europe/Amsterdam" 12692 msgstr "Eropah/Amsterdam" 12693 12694 #: kdecore/TIMEZONES:1137 12695 #, kde-format 12696 msgid "Europe/Andorra" 12697 msgstr "Eropah/Andorra" 12698 12699 #: kdecore/TIMEZONES:1138 12700 #, fuzzy, kde-format 12701 #| msgid "Europe/Athens" 12702 msgid "Europe/Astrakhan" 12703 msgstr "Eropah/Athens" 12704 12705 #. i18n: comment to the previous timezone 12706 #: kdecore/TIMEZONES:1140 12707 #, kde-format 12708 msgid "MSK+01 - Astrakhan" 12709 msgstr "" 12710 12711 #: kdecore/TIMEZONES:1141 12712 #, kde-format 12713 msgid "Europe/Athens" 12714 msgstr "Eropah/Athens" 12715 12716 #: kdecore/TIMEZONES:1142 12717 #, kde-format 12718 msgid "Europe/Belfast" 12719 msgstr "Eropah/Belfast" 12720 12721 #: kdecore/TIMEZONES:1143 12722 #, kde-format 12723 msgid "Europe/Belgrade" 12724 msgstr "Eropah/Belgrade" 12725 12726 #: kdecore/TIMEZONES:1144 12727 #, kde-format 12728 msgid "Europe/Berlin" 12729 msgstr "Eropah/Berlin" 12730 12731 #. i18n: comment to the previous timezone 12732 #: kdecore/TIMEZONES:1146 12733 #, kde-format 12734 msgid "Germany (most areas)" 12735 msgstr "" 12736 12737 #: kdecore/TIMEZONES:1147 12738 #, kde-format 12739 msgid "Europe/Bratislava" 12740 msgstr "Eropah/Bratislava" 12741 12742 #: kdecore/TIMEZONES:1148 12743 #, kde-format 12744 msgid "Europe/Brussels" 12745 msgstr "Eropah/Brussels" 12746 12747 #: kdecore/TIMEZONES:1149 12748 #, kde-format 12749 msgid "Europe/Bucharest" 12750 msgstr "Eropah/Bucharest" 12751 12752 #: kdecore/TIMEZONES:1150 12753 #, kde-format 12754 msgid "Europe/Budapest" 12755 msgstr "Eropah/Budapest" 12756 12757 #: kdecore/TIMEZONES:1151 12758 #, fuzzy, kde-format 12759 #| msgid "Europe/Brussels" 12760 msgid "Europe/Busingen" 12761 msgstr "Eropah/Brussels" 12762 12763 #. i18n: comment to the previous timezone 12764 #: kdecore/TIMEZONES:1153 12765 #, kde-format 12766 msgid "Busingen" 12767 msgstr "" 12768 12769 #: kdecore/TIMEZONES:1154 12770 #, kde-format 12771 msgid "Europe/Chisinau" 12772 msgstr "Eropah/Chisinau" 12773 12774 #: kdecore/TIMEZONES:1155 12775 #, kde-format 12776 msgid "Europe/Copenhagen" 12777 msgstr "Eropah/Copenhagen" 12778 12779 #: kdecore/TIMEZONES:1156 12780 #, kde-format 12781 msgid "Europe/Dublin" 12782 msgstr "Eropah/Dublin" 12783 12784 #: kdecore/TIMEZONES:1157 12785 #, kde-format 12786 msgid "Europe/Gibraltar" 12787 msgstr "Eropah/Gibraltar" 12788 12789 #: kdecore/TIMEZONES:1158 12790 #, fuzzy, kde-format 12791 #| msgid "Europe/Athens" 12792 msgid "Europe/Guernsey" 12793 msgstr "Eropah/Athens" 12794 12795 #: kdecore/TIMEZONES:1159 12796 #, kde-format 12797 msgid "Europe/Helsinki" 12798 msgstr "Eropah/Helsinki" 12799 12800 #: kdecore/TIMEZONES:1160 12801 #, fuzzy, kde-format 12802 #| msgid "Europe/Oslo" 12803 msgid "Europe/Isle_of_Man" 12804 msgstr "Eropah/Oslo" 12805 12806 #: kdecore/TIMEZONES:1161 12807 #, kde-format 12808 msgid "Europe/Istanbul" 12809 msgstr "Eropah/Istanbul" 12810 12811 #: kdecore/TIMEZONES:1162 12812 #, fuzzy, kde-format 12813 #| msgid "Europe/Paris" 12814 msgid "Europe/Jersey" 12815 msgstr "Eropah/Paris" 12816 12817 #: kdecore/TIMEZONES:1163 12818 #, kde-format 12819 msgid "Europe/Kaliningrad" 12820 msgstr "Eropah/Kaliningrad" 12821 12822 #. i18n: comment to the previous timezone 12823 #: kdecore/TIMEZONES:1165 12824 #, kde-format 12825 msgid "Moscow-01 - Kaliningrad" 12826 msgstr "" 12827 12828 #. i18n: comment to the previous timezone 12829 #: kdecore/TIMEZONES:1167 12830 #, kde-format 12831 msgid "MSK-01 - Kaliningrad" 12832 msgstr "" 12833 12834 #: kdecore/TIMEZONES:1168 12835 #, kde-format 12836 msgid "Europe/Kiev" 12837 msgstr "Eropah/Kiev" 12838 12839 #. i18n: comment to the previous timezone 12840 #: kdecore/TIMEZONES:1172 12841 #, kde-format 12842 msgid "Ukraine (most areas)" 12843 msgstr "" 12844 12845 #: kdecore/TIMEZONES:1173 12846 #, fuzzy, kde-format 12847 #| msgid "Europe/Kiev" 12848 msgid "Europe/Kirov" 12849 msgstr "Eropah/Kiev" 12850 12851 #. i18n: comment to the previous timezone 12852 #: kdecore/TIMEZONES:1175 12853 #, kde-format 12854 msgid "MSK+00 - Kirov" 12855 msgstr "" 12856 12857 #: kdecore/TIMEZONES:1176 12858 #, kde-format 12859 msgid "Europe/Lisbon" 12860 msgstr "Eropah/Lisbon" 12861 12862 #. i18n: comment to the previous timezone 12863 #: kdecore/TIMEZONES:1180 12864 #, kde-format 12865 msgid "Portugal (mainland)" 12866 msgstr "" 12867 12868 #: kdecore/TIMEZONES:1181 12869 #, kde-format 12870 msgid "Europe/Ljubljana" 12871 msgstr "Eropah/Ljubljana" 12872 12873 #: kdecore/TIMEZONES:1182 12874 #, kde-format 12875 msgid "Europe/London" 12876 msgstr "Eropah/London" 12877 12878 #: kdecore/TIMEZONES:1183 12879 #, kde-format 12880 msgid "Europe/Luxembourg" 12881 msgstr "Eropah/Luxembourg" 12882 12883 #: kdecore/TIMEZONES:1184 12884 #, kde-format 12885 msgid "Europe/Madrid" 12886 msgstr "Eropah/Madrid" 12887 12888 #. i18n: comment to the previous timezone 12889 #: kdecore/TIMEZONES:1188 12890 #, kde-format 12891 msgid "Spain (mainland)" 12892 msgstr "" 12893 12894 #: kdecore/TIMEZONES:1189 12895 #, kde-format 12896 msgid "Europe/Malta" 12897 msgstr "Eropah/Malta" 12898 12899 #: kdecore/TIMEZONES:1190 12900 #, kde-format 12901 msgid "Europe/Mariehamn" 12902 msgstr "Eropah/Mariehamn" 12903 12904 #: kdecore/TIMEZONES:1191 12905 #, kde-format 12906 msgid "Europe/Minsk" 12907 msgstr "Eropah/Minsk" 12908 12909 #: kdecore/TIMEZONES:1192 12910 #, kde-format 12911 msgid "Europe/Monaco" 12912 msgstr "Eropah/Monaco" 12913 12914 #: kdecore/TIMEZONES:1193 12915 #, kde-format 12916 msgid "Europe/Moscow" 12917 msgstr "Eropah/Moscow" 12918 12919 #. i18n: comment to the previous timezone 12920 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12921 #, kde-format 12922 msgid "Moscow+00 - west Russia" 12923 msgstr "" 12924 12925 #. i18n: comment to the previous timezone 12926 #: kdecore/TIMEZONES:1197 12927 #, kde-format 12928 msgid "MSK+00 - Moscow area" 12929 msgstr "" 12930 12931 #: kdecore/TIMEZONES:1198 12932 #, kde-format 12933 msgid "Europe/Oslo" 12934 msgstr "Eropah/Oslo" 12935 12936 #: kdecore/TIMEZONES:1199 12937 #, kde-format 12938 msgid "Europe/Paris" 12939 msgstr "Eropah/Paris" 12940 12941 #: kdecore/TIMEZONES:1200 12942 #, fuzzy, kde-format 12943 #| msgid "Europe/Andorra" 12944 msgid "Europe/Podgorica" 12945 msgstr "Eropah/Andorra" 12946 12947 #: kdecore/TIMEZONES:1201 12948 #, kde-format 12949 msgid "Europe/Prague" 12950 msgstr "Eropah/Prague" 12951 12952 #: kdecore/TIMEZONES:1202 12953 #, kde-format 12954 msgid "Europe/Riga" 12955 msgstr "Eropah/Riga" 12956 12957 #: kdecore/TIMEZONES:1203 12958 #, kde-format 12959 msgid "Europe/Rome" 12960 msgstr "Eropah/Rome" 12961 12962 #: kdecore/TIMEZONES:1204 12963 #, kde-format 12964 msgid "Europe/Samara" 12965 msgstr "Eropah/Samara" 12966 12967 #. i18n: comment to the previous timezone 12968 #: kdecore/TIMEZONES:1206 12969 #, kde-format 12970 msgid "Moscow+01 - Samara, Udmurtia" 12971 msgstr "" 12972 12973 #. i18n: comment to the previous timezone 12974 #: kdecore/TIMEZONES:1208 12975 #, kde-format 12976 msgid "Moscow+00 - Samara, Udmurtia" 12977 msgstr "" 12978 12979 #. i18n: comment to the previous timezone 12980 #: kdecore/TIMEZONES:1210 12981 #, kde-format 12982 msgid "MSK+01 - Samara, Udmurtia" 12983 msgstr "" 12984 12985 #: kdecore/TIMEZONES:1211 12986 #, kde-format 12987 msgid "Europe/San_Marino" 12988 msgstr "Eropah/San_Marino" 12989 12990 #: kdecore/TIMEZONES:1212 12991 #, kde-format 12992 msgid "Europe/Sarajevo" 12993 msgstr "Eropah/Sarajevo" 12994 12995 #: kdecore/TIMEZONES:1213 12996 #, fuzzy, kde-format 12997 #| msgid "Europe/Sarajevo" 12998 msgid "Europe/Saratov" 12999 msgstr "Eropah/Sarajevo" 13000 13001 #. i18n: comment to the previous timezone 13002 #: kdecore/TIMEZONES:1215 13003 #, kde-format 13004 msgid "MSK+01 - Saratov" 13005 msgstr "" 13006 13007 #: kdecore/TIMEZONES:1216 13008 #, kde-format 13009 msgid "Europe/Simferopol" 13010 msgstr "Eropah/Simferopol" 13011 13012 #. i18n: comment to the previous timezone 13013 #: kdecore/TIMEZONES:1218 13014 #, kde-format 13015 msgid "central Crimea" 13016 msgstr "" 13017 13018 #. i18n: comment to the previous timezone 13019 #: kdecore/TIMEZONES:1220 13020 #, fuzzy, kde-format 13021 #| msgid "Prime: " 13022 msgid "Crimea" 13023 msgstr "Primer:" 13024 13025 #: kdecore/TIMEZONES:1221 13026 #, kde-format 13027 msgid "Europe/Skopje" 13028 msgstr "Eropah/Skopje" 13029 13030 #: kdecore/TIMEZONES:1222 13031 #, kde-format 13032 msgid "Europe/Sofia" 13033 msgstr "Eropah/Sofia" 13034 13035 #: kdecore/TIMEZONES:1223 13036 #, kde-format 13037 msgid "Europe/Stockholm" 13038 msgstr "Eropah/Stockholm" 13039 13040 #: kdecore/TIMEZONES:1224 13041 #, kde-format 13042 msgid "Europe/Tallinn" 13043 msgstr "Eropah/Tallinn" 13044 13045 #: kdecore/TIMEZONES:1225 13046 #, kde-format 13047 msgid "Europe/Tirane" 13048 msgstr "Eropah/Tirane" 13049 13050 #: kdecore/TIMEZONES:1226 13051 #, fuzzy, kde-format 13052 #| msgid "Europe/Tirane" 13053 msgid "Europe/Tiraspol" 13054 msgstr "Eropah/Tirane" 13055 13056 #: kdecore/TIMEZONES:1227 13057 #, fuzzy, kde-format 13058 #| msgid "Europe/Minsk" 13059 msgid "Europe/Ulyanovsk" 13060 msgstr "Eropah/Minsk" 13061 13062 #. i18n: comment to the previous timezone 13063 #: kdecore/TIMEZONES:1229 13064 #, kde-format 13065 msgid "MSK+01 - Ulyanovsk" 13066 msgstr "" 13067 13068 #: kdecore/TIMEZONES:1230 13069 #, kde-format 13070 msgid "Europe/Uzhgorod" 13071 msgstr "Eropah/Uzhgorod" 13072 13073 #. i18n: comment to the previous timezone 13074 #: kdecore/TIMEZONES:1232 13075 #, kde-format 13076 msgid "Ruthenia" 13077 msgstr "" 13078 13079 #. i18n: comment to the previous timezone 13080 #: kdecore/TIMEZONES:1234 13081 #, kde-format 13082 msgid "Transcarpathia" 13083 msgstr "" 13084 13085 #: kdecore/TIMEZONES:1235 13086 #, kde-format 13087 msgid "Europe/Vaduz" 13088 msgstr "Eropah/Vaduz" 13089 13090 #: kdecore/TIMEZONES:1236 13091 #, kde-format 13092 msgid "Europe/Vatican" 13093 msgstr "Eropah/Vatican" 13094 13095 #: kdecore/TIMEZONES:1237 13096 #, kde-format 13097 msgid "Europe/Vienna" 13098 msgstr "Eropah/Vienna" 13099 13100 #: kdecore/TIMEZONES:1238 13101 #, kde-format 13102 msgid "Europe/Vilnius" 13103 msgstr "Eropah/Vilnius" 13104 13105 #: kdecore/TIMEZONES:1239 13106 #, fuzzy, kde-format 13107 #| msgid "Europe/Belgrade" 13108 msgid "Europe/Volgograd" 13109 msgstr "Eropah/Belgrade" 13110 13111 #. i18n: comment to the previous timezone 13112 #: kdecore/TIMEZONES:1241 13113 #, kde-format 13114 msgid "Moscow+00 - Caspian Sea" 13115 msgstr "" 13116 13117 #. i18n: comment to the previous timezone 13118 #: kdecore/TIMEZONES:1243 13119 #, kde-format 13120 msgid "MSK+00 - Volgograd" 13121 msgstr "" 13122 13123 #: kdecore/TIMEZONES:1244 13124 #, kde-format 13125 msgid "Europe/Warsaw" 13126 msgstr "Eropah/Warsaw" 13127 13128 #: kdecore/TIMEZONES:1245 13129 #, kde-format 13130 msgid "Europe/Zagreb" 13131 msgstr "Eropah/Zagreb" 13132 13133 #: kdecore/TIMEZONES:1246 13134 #, kde-format 13135 msgid "Europe/Zaporozhye" 13136 msgstr "Eropah/Zaporozhye" 13137 13138 #. i18n: comment to the previous timezone 13139 #: kdecore/TIMEZONES:1248 13140 #, kde-format 13141 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 13142 msgstr "" 13143 13144 #. i18n: comment to the previous timezone 13145 #: kdecore/TIMEZONES:1250 13146 #, kde-format 13147 msgid "Zaporozhye and east Lugansk" 13148 msgstr "" 13149 13150 #: kdecore/TIMEZONES:1251 13151 #, kde-format 13152 msgid "Europe/Zurich" 13153 msgstr "Eropah/Zurich" 13154 13155 #: kdecore/TIMEZONES:1252 13156 #, fuzzy, kde-format 13157 msgid "GB" 13158 msgstr "GB" 13159 13160 #: kdecore/TIMEZONES:1253 13161 #, kde-format 13162 msgid "GB-Eire" 13163 msgstr "" 13164 13165 #: kdecore/TIMEZONES:1254 13166 #, fuzzy, kde-format 13167 #| msgid "Asia/Hong_Kong" 13168 msgid "Hongkong" 13169 msgstr "Asia/Hong_Kong" 13170 13171 #: kdecore/TIMEZONES:1255 13172 #, fuzzy, kde-format 13173 msgid "Iceland" 13174 msgstr "Iceland" 13175 13176 #: kdecore/TIMEZONES:1256 13177 #, kde-format 13178 msgid "Indian/Antananarivo" 13179 msgstr "Indian/Antananarivo" 13180 13181 #: kdecore/TIMEZONES:1257 13182 #, kde-format 13183 msgid "Indian/Chagos" 13184 msgstr "India/Chagos" 13185 13186 #: kdecore/TIMEZONES:1258 13187 #, kde-format 13188 msgid "Indian/Christmas" 13189 msgstr "Indian/Christmas" 13190 13191 #: kdecore/TIMEZONES:1259 13192 #, kde-format 13193 msgid "Indian/Cocos" 13194 msgstr "India/Cocos" 13195 13196 #: kdecore/TIMEZONES:1260 13197 #, kde-format 13198 msgid "Indian/Comoro" 13199 msgstr "Indian/Comoro" 13200 13201 #: kdecore/TIMEZONES:1261 13202 #, kde-format 13203 msgid "Indian/Kerguelen" 13204 msgstr "Indian/Kerguelen" 13205 13206 #: kdecore/TIMEZONES:1262 13207 #, kde-format 13208 msgid "Indian/Mahe" 13209 msgstr "Indian/Mahe" 13210 13211 #: kdecore/TIMEZONES:1263 13212 #, kde-format 13213 msgid "Indian/Maldives" 13214 msgstr "India/Maldives" 13215 13216 #: kdecore/TIMEZONES:1264 13217 #, kde-format 13218 msgid "Indian/Mauritius" 13219 msgstr "India/Mauritius" 13220 13221 #: kdecore/TIMEZONES:1265 13222 #, kde-format 13223 msgid "Indian/Mayotte" 13224 msgstr "Indian/Mayotte" 13225 13226 #: kdecore/TIMEZONES:1266 13227 #, kde-format 13228 msgid "Indian/Reunion" 13229 msgstr "Indian/Reunion" 13230 13231 #: kdecore/TIMEZONES:1267 13232 #, fuzzy, kde-format 13233 msgid "Iran" 13234 msgstr "Iran" 13235 13236 #: kdecore/TIMEZONES:1268 13237 #, fuzzy, kde-format 13238 #| msgid "Pacific/Kosrae" 13239 msgid "Israel" 13240 msgstr "Israel" 13241 13242 #: kdecore/TIMEZONES:1269 13243 #, fuzzy, kde-format 13244 #| msgid "America/Jamaica" 13245 msgid "Jamaica" 13246 msgstr "Jamaica" 13247 13248 #: kdecore/TIMEZONES:1270 13249 #, fuzzy, kde-format 13250 msgid "Japan" 13251 msgstr "Japan" 13252 13253 #. i18n: comment to the previous timezone 13254 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 13255 #, fuzzy, kde-format 13256 #| msgid "Pacific/Kwajalein" 13257 msgid "Kwajalein" 13258 msgstr "Pasifik/Kwajalein" 13259 13260 #: kdecore/TIMEZONES:1274 13261 #, fuzzy, kde-format 13262 msgid "Libya" 13263 msgstr "Libya" 13264 13265 #: kdecore/TIMEZONES:1275 13266 #, kde-format 13267 msgid "Mexico/BajaNorte" 13268 msgstr "" 13269 13270 #: kdecore/TIMEZONES:1278 13271 #, kde-format 13272 msgid "Mexico/BajaSur" 13273 msgstr "" 13274 13275 #: kdecore/TIMEZONES:1281 13276 #, kde-format 13277 msgid "Mexico/General" 13278 msgstr "" 13279 13280 #: kdecore/TIMEZONES:1284 13281 #, fuzzy, kde-format 13282 msgid "NZ" 13283 msgstr "NZ" 13284 13285 #: kdecore/TIMEZONES:1287 13286 #, kde-format 13287 msgid "NZ-CHAT" 13288 msgstr "" 13289 13290 #. i18n: comment to the previous timezone 13291 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 13292 #, kde-format 13293 msgid "Chatham Islands" 13294 msgstr "" 13295 13296 #: kdecore/TIMEZONES:1290 13297 #, fuzzy, kde-format 13298 msgid "Navajo" 13299 msgstr "Navajo" 13300 13301 #: kdecore/TIMEZONES:1293 13302 #, kde-format 13303 msgid "PRC" 13304 msgstr "" 13305 13306 #: kdecore/TIMEZONES:1296 13307 #, kde-format 13308 msgid "Pacific/Apia" 13309 msgstr "Pasifik/Apia" 13310 13311 #: kdecore/TIMEZONES:1297 13312 #, kde-format 13313 msgid "Pacific/Auckland" 13314 msgstr "Pasifik/Auckland" 13315 13316 #. i18n: comment to the previous timezone 13317 #: kdecore/TIMEZONES:1301 13318 #, kde-format 13319 msgid "New Zealand (most areas)" 13320 msgstr "" 13321 13322 #: kdecore/TIMEZONES:1302 13323 #, fuzzy, kde-format 13324 #| msgid "Pacific/Honolulu" 13325 msgid "Pacific/Bougainville" 13326 msgstr "Pasifik/Honolulu" 13327 13328 #. i18n: comment to the previous timezone 13329 #: kdecore/TIMEZONES:1304 13330 #, kde-format 13331 msgid "Bougainville" 13332 msgstr "" 13333 13334 #: kdecore/TIMEZONES:1305 13335 #, kde-format 13336 msgid "Pacific/Chatham" 13337 msgstr "Pasifik/Chatham" 13338 13339 #: kdecore/TIMEZONES:1308 13340 #, fuzzy, kde-format 13341 #| msgid "Pacific/Truk" 13342 msgid "Pacific/Chuuk" 13343 msgstr "Pasifik/Truk" 13344 13345 #. i18n: comment to the previous timezone 13346 #: kdecore/TIMEZONES:1310 13347 #, kde-format 13348 msgid "Chuuk (Truk) and Yap" 13349 msgstr "" 13350 13351 #. i18n: comment to the previous timezone 13352 #: kdecore/TIMEZONES:1312 13353 #, kde-format 13354 msgid "Chuuk/Truk, Yap" 13355 msgstr "" 13356 13357 #: kdecore/TIMEZONES:1313 13358 #, kde-format 13359 msgid "Pacific/Easter" 13360 msgstr "Pasifik/Easter" 13361 13362 #. i18n: comment to the previous timezone 13363 #: kdecore/TIMEZONES:1317 13364 #, fuzzy, kde-format 13365 #| msgctxt "digit set" 13366 #| msgid "Eastern Arabic-Indic" 13367 msgid "Easter Island" 13368 msgstr "Arab-Indic Timur" 13369 13370 #: kdecore/TIMEZONES:1318 13371 #, kde-format 13372 msgid "Pacific/Efate" 13373 msgstr "Pasifik/Efate" 13374 13375 #: kdecore/TIMEZONES:1319 13376 #, kde-format 13377 msgid "Pacific/Enderbury" 13378 msgstr "Pasifik/Enderbury" 13379 13380 #. i18n: comment to the previous timezone 13381 #: kdecore/TIMEZONES:1321 13382 #, kde-format 13383 msgid "Phoenix Islands" 13384 msgstr "" 13385 13386 #: kdecore/TIMEZONES:1322 13387 #, kde-format 13388 msgid "Pacific/Fakaofo" 13389 msgstr "Pasifik/Fakaofo" 13390 13391 #: kdecore/TIMEZONES:1323 13392 #, kde-format 13393 msgid "Pacific/Fiji" 13394 msgstr "Pasifik/Fiji" 13395 13396 #: kdecore/TIMEZONES:1324 13397 #, kde-format 13398 msgid "Pacific/Funafuti" 13399 msgstr "Pasifik/Funafuti" 13400 13401 #: kdecore/TIMEZONES:1325 13402 #, kde-format 13403 msgid "Pacific/Galapagos" 13404 msgstr "Pasifik/Galapagos" 13405 13406 #. i18n: comment to the previous timezone 13407 #: kdecore/TIMEZONES:1327 13408 #, kde-format 13409 msgid "Galapagos Islands" 13410 msgstr "" 13411 13412 #: kdecore/TIMEZONES:1328 13413 #, kde-format 13414 msgid "Pacific/Gambier" 13415 msgstr "Pasifik/Gambier" 13416 13417 #. i18n: comment to the previous timezone 13418 #: kdecore/TIMEZONES:1330 13419 #, kde-format 13420 msgid "Gambier Islands" 13421 msgstr "" 13422 13423 #: kdecore/TIMEZONES:1331 13424 #, kde-format 13425 msgid "Pacific/Guadalcanal" 13426 msgstr "Pasifik/Guadalcanal" 13427 13428 #: kdecore/TIMEZONES:1332 13429 #, kde-format 13430 msgid "Pacific/Guam" 13431 msgstr "Pasifik/Guam" 13432 13433 #: kdecore/TIMEZONES:1333 13434 #, kde-format 13435 msgid "Pacific/Honolulu" 13436 msgstr "Pasifik/Honolulu" 13437 13438 #. i18n: comment to the previous timezone 13439 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13440 #, kde-format 13441 msgid "Hawaii" 13442 msgstr "" 13443 13444 #: kdecore/TIMEZONES:1336 13445 #, kde-format 13446 msgid "Pacific/Johnston" 13447 msgstr "Pasifik/Johnston" 13448 13449 #. i18n: comment to the previous timezone 13450 #: kdecore/TIMEZONES:1338 13451 #, kde-format 13452 msgid "Johnston Atoll" 13453 msgstr "" 13454 13455 #: kdecore/TIMEZONES:1339 13456 #, kde-format 13457 msgid "Pacific/Kiritimati" 13458 msgstr "Pasifik/Kiritimati" 13459 13460 #. i18n: comment to the previous timezone 13461 #: kdecore/TIMEZONES:1341 13462 #, kde-format 13463 msgid "Line Islands" 13464 msgstr "" 13465 13466 #: kdecore/TIMEZONES:1342 13467 #, kde-format 13468 msgid "Pacific/Kosrae" 13469 msgstr "Pasifik/Kosrae" 13470 13471 #. i18n: comment to the previous timezone 13472 #: kdecore/TIMEZONES:1344 13473 #, fuzzy, kde-format 13474 #| msgid "Pacific/Kosrae" 13475 msgid "Kosrae" 13476 msgstr "Pasifik/Kosrae" 13477 13478 #: kdecore/TIMEZONES:1345 13479 #, kde-format 13480 msgid "Pacific/Kwajalein" 13481 msgstr "Pasifik/Kwajalein" 13482 13483 #: kdecore/TIMEZONES:1348 13484 #, kde-format 13485 msgid "Pacific/Majuro" 13486 msgstr "Pasifik/Majuro" 13487 13488 #. i18n: comment to the previous timezone 13489 #: kdecore/TIMEZONES:1352 13490 #, kde-format 13491 msgid "Marshall Islands (most areas)" 13492 msgstr "" 13493 13494 #: kdecore/TIMEZONES:1353 13495 #, kde-format 13496 msgid "Pacific/Marquesas" 13497 msgstr "Pasifik/Marquesas" 13498 13499 #. i18n: comment to the previous timezone 13500 #: kdecore/TIMEZONES:1355 13501 #, kde-format 13502 msgid "Marquesas Islands" 13503 msgstr "" 13504 13505 #: kdecore/TIMEZONES:1356 13506 #, kde-format 13507 msgid "Pacific/Midway" 13508 msgstr "Pasifik/Midway" 13509 13510 #. i18n: comment to the previous timezone 13511 #: kdecore/TIMEZONES:1358 13512 #, kde-format 13513 msgid "Midway Islands" 13514 msgstr "" 13515 13516 #: kdecore/TIMEZONES:1359 13517 #, kde-format 13518 msgid "Pacific/Nauru" 13519 msgstr "Pasifik/Nauru" 13520 13521 #: kdecore/TIMEZONES:1360 13522 #, kde-format 13523 msgid "Pacific/Niue" 13524 msgstr "Pasifik/Niue" 13525 13526 #: kdecore/TIMEZONES:1361 13527 #, kde-format 13528 msgid "Pacific/Norfolk" 13529 msgstr "Pasifik/Norfolk" 13530 13531 #: kdecore/TIMEZONES:1362 13532 #, kde-format 13533 msgid "Pacific/Noumea" 13534 msgstr "Pasifik/Noumea" 13535 13536 #: kdecore/TIMEZONES:1363 13537 #, kde-format 13538 msgid "Pacific/Pago_Pago" 13539 msgstr "Pasifik/Pago_Pago" 13540 13541 #: kdecore/TIMEZONES:1364 13542 #, kde-format 13543 msgid "Pacific/Palau" 13544 msgstr "Pasifik/Palau" 13545 13546 #: kdecore/TIMEZONES:1365 13547 #, kde-format 13548 msgid "Pacific/Pitcairn" 13549 msgstr "Pasifik/Pitcairn" 13550 13551 #: kdecore/TIMEZONES:1366 13552 #, fuzzy, kde-format 13553 #| msgid "Pacific/Ponape" 13554 msgid "Pacific/Pohnpei" 13555 msgstr "Pasifik/Ponape" 13556 13557 #. i18n: comment to the previous timezone 13558 #: kdecore/TIMEZONES:1368 13559 #, kde-format 13560 msgid "Pohnpei (Ponape)" 13561 msgstr "" 13562 13563 #. i18n: comment to the previous timezone 13564 #: kdecore/TIMEZONES:1370 13565 #, fuzzy, kde-format 13566 #| msgid "Pacific/Ponape" 13567 msgid "Pohnpei/Ponape" 13568 msgstr "Pasifik/Ponape" 13569 13570 #: kdecore/TIMEZONES:1371 13571 #, kde-format 13572 msgid "Pacific/Ponape" 13573 msgstr "Pasifik/Ponape" 13574 13575 #. i18n: comment to the previous timezone 13576 #: kdecore/TIMEZONES:1373 13577 #, kde-format 13578 msgid "Ponape (Pohnpei)" 13579 msgstr "" 13580 13581 #: kdecore/TIMEZONES:1374 13582 #, kde-format 13583 msgid "Pacific/Port_Moresby" 13584 msgstr "Pasifik/Port_Moresby" 13585 13586 #. i18n: comment to the previous timezone 13587 #: kdecore/TIMEZONES:1376 13588 #, kde-format 13589 msgid "Papua New Guinea (most areas)" 13590 msgstr "" 13591 13592 #: kdecore/TIMEZONES:1377 13593 #, kde-format 13594 msgid "Pacific/Rarotonga" 13595 msgstr "Pasifik/Rarotonga" 13596 13597 #: kdecore/TIMEZONES:1378 13598 #, kde-format 13599 msgid "Pacific/Saipan" 13600 msgstr "Pasifik/Saipan" 13601 13602 #: kdecore/TIMEZONES:1379 13603 #, fuzzy, kde-format 13604 #| msgid "Pacific/Saipan" 13605 msgid "Pacific/Samoa" 13606 msgstr "Pasifik/Saipan" 13607 13608 #: kdecore/TIMEZONES:1380 13609 #, kde-format 13610 msgid "Pacific/Tahiti" 13611 msgstr "Pasifik/Tahiti" 13612 13613 #. i18n: comment to the previous timezone 13614 #: kdecore/TIMEZONES:1382 13615 #, kde-format 13616 msgid "Society Islands" 13617 msgstr "" 13618 13619 #: kdecore/TIMEZONES:1383 13620 #, kde-format 13621 msgid "Pacific/Tarawa" 13622 msgstr "Pasifik/Tarawa" 13623 13624 #. i18n: comment to the previous timezone 13625 #: kdecore/TIMEZONES:1385 13626 #, kde-format 13627 msgid "Gilbert Islands" 13628 msgstr "" 13629 13630 #: kdecore/TIMEZONES:1386 13631 #, kde-format 13632 msgid "Pacific/Tongatapu" 13633 msgstr "Pasifik/Tongatapu" 13634 13635 #: kdecore/TIMEZONES:1387 13636 #, kde-format 13637 msgid "Pacific/Truk" 13638 msgstr "Pasifik/Truk" 13639 13640 #. i18n: comment to the previous timezone 13641 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13642 #, kde-format 13643 msgid "Truk (Chuuk) and Yap" 13644 msgstr "" 13645 13646 #: kdecore/TIMEZONES:1390 13647 #, kde-format 13648 msgid "Pacific/Wake" 13649 msgstr "Pasifik/Wake" 13650 13651 #. i18n: comment to the previous timezone 13652 #: kdecore/TIMEZONES:1392 13653 #, kde-format 13654 msgid "Wake Island" 13655 msgstr "" 13656 13657 #: kdecore/TIMEZONES:1393 13658 #, kde-format 13659 msgid "Pacific/Wallis" 13660 msgstr "Pasifik/Wallis" 13661 13662 #: kdecore/TIMEZONES:1394 13663 #, kde-format 13664 msgid "Pacific/Yap" 13665 msgstr "Pasifik/Yap" 13666 13667 #: kdecore/TIMEZONES:1397 13668 #, fuzzy, kde-format 13669 msgid "Poland" 13670 msgstr "Poland" 13671 13672 #: kdecore/TIMEZONES:1398 13673 #, fuzzy, kde-format 13674 msgid "Portugal" 13675 msgstr "Portugal" 13676 13677 #: kdecore/TIMEZONES:1401 13678 #, kde-format 13679 msgid "ROC" 13680 msgstr "" 13681 13682 #: kdecore/TIMEZONES:1402 13683 #, kde-format 13684 msgid "ROK" 13685 msgstr "" 13686 13687 #: kdecore/TIMEZONES:1403 13688 #, fuzzy, kde-format 13689 #| msgid "Asia/Singapore" 13690 msgid "Singapore" 13691 msgstr "Singapura" 13692 13693 #: kdecore/TIMEZONES:1404 13694 #, fuzzy, kde-format 13695 msgid "Turkey" 13696 msgstr "Turki" 13697 13698 #: kdecore/TIMEZONES:1405 13699 #, kde-format 13700 msgid "US/Alaska" 13701 msgstr "" 13702 13703 #: kdecore/TIMEZONES:1408 13704 #, kde-format 13705 msgid "US/Aleutian" 13706 msgstr "" 13707 13708 #: kdecore/TIMEZONES:1411 13709 #, kde-format 13710 msgid "US/Arizona" 13711 msgstr "" 13712 13713 #: kdecore/TIMEZONES:1414 13714 #, kde-format 13715 msgid "US/Central" 13716 msgstr "" 13717 13718 #: kdecore/TIMEZONES:1417 13719 #, kde-format 13720 msgid "US/East-Indiana" 13721 msgstr "" 13722 13723 #: kdecore/TIMEZONES:1420 13724 #, kde-format 13725 msgid "US/Eastern" 13726 msgstr "" 13727 13728 #: kdecore/TIMEZONES:1423 13729 #, kde-format 13730 msgid "US/Hawaii" 13731 msgstr "" 13732 13733 #: kdecore/TIMEZONES:1426 13734 #, kde-format 13735 msgid "US/Indiana-Starke" 13736 msgstr "" 13737 13738 #: kdecore/TIMEZONES:1429 13739 #, kde-format 13740 msgid "US/Michigan" 13741 msgstr "" 13742 13743 #: kdecore/TIMEZONES:1432 13744 #, kde-format 13745 msgid "US/Mountain" 13746 msgstr "" 13747 13748 #: kdecore/TIMEZONES:1435 13749 #, fuzzy, kde-format 13750 #| msgid "Pacific/Yap" 13751 msgid "US/Pacific" 13752 msgstr "Pasifik/Yap" 13753 13754 #: kdecore/TIMEZONES:1438 13755 #, kde-format 13756 msgid "US/Samoa" 13757 msgstr "" 13758 13759 #: kdecore/TIMEZONES:1439 13760 #, kde-format 13761 msgid "W-SU" 13762 msgstr "" 13763 13764 #. i18n: Generic sans serif font presented in font choosers. When selected, 13765 #. the system will choose a real font, mandated by distro settings. 13766 #: kdeui/fonthelpers.cpp:29 13767 #, kde-format 13768 msgctxt "@item Font name" 13769 msgid "Sans Serif" 13770 msgstr "Sans Serif" 13771 13772 #. i18n: Generic serif font presented in font choosers. When selected, 13773 #. the system will choose a real font, mandated by distro settings. 13774 #: kdeui/fonthelpers.cpp:32 13775 #, kde-format 13776 msgctxt "@item Font name" 13777 msgid "Serif" 13778 msgstr "Serif" 13779 13780 #. i18n: Generic monospace font presented in font choosers. When selected, 13781 #. the system will choose a real font, mandated by distro settings. 13782 #: kdeui/fonthelpers.cpp:35 13783 #, kde-format 13784 msgctxt "@item Font name" 13785 msgid "Monospace" 13786 msgstr "Monospace" 13787 13788 #: kdeui/k4timezonewidget.cpp:62 13789 #, kde-format 13790 msgctxt "Define an area in the time zone, like a town area" 13791 msgid "Area" 13792 msgstr "Kawasan" 13793 13794 #: kdeui/k4timezonewidget.cpp:62 13795 #, kde-format 13796 msgctxt "Time zone" 13797 msgid "Region" 13798 msgstr "Wilayah" 13799 13800 #: kdeui/k4timezonewidget.cpp:62 13801 #, fuzzy, kde-format 13802 msgid "Comment" 13803 msgstr "Komen" 13804 13805 #: kdeui/kapplication.cpp:741 13806 #, kde-format 13807 msgid "The style '%1' was not found" 13808 msgstr "Gaya '%1' tidak ditemui" 13809 13810 #: kdeui/kcolordialog.cpp:102 13811 #, kde-format 13812 msgctxt "palette name" 13813 msgid "* Recent Colors *" 13814 msgstr "* Warna Terkini *" 13815 13816 #: kdeui/kcolordialog.cpp:103 13817 #, kde-format 13818 msgctxt "palette name" 13819 msgid "* Custom Colors *" 13820 msgstr "* Warna Langganan *" 13821 13822 #: kdeui/kcolordialog.cpp:104 13823 #, kde-format 13824 msgctxt "palette name" 13825 msgid "Forty Colors" 13826 msgstr "Warna Forty" 13827 13828 #: kdeui/kcolordialog.cpp:105 13829 #, kde-format 13830 msgctxt "palette name" 13831 msgid "Oxygen Colors" 13832 msgstr "Warna Oxygen" 13833 13834 #: kdeui/kcolordialog.cpp:106 13835 #, kde-format 13836 msgctxt "palette name" 13837 msgid "Rainbow Colors" 13838 msgstr "Warna Pelangi" 13839 13840 #: kdeui/kcolordialog.cpp:107 13841 #, kde-format 13842 msgctxt "palette name" 13843 msgid "Royal Colors" 13844 msgstr "Warna Diraja" 13845 13846 #: kdeui/kcolordialog.cpp:108 13847 #, kde-format 13848 msgctxt "palette name" 13849 msgid "Web Colors" 13850 msgstr "Warna Web" 13851 13852 #: kdeui/kcolordialog.cpp:572 13853 #, kde-format 13854 msgid "Named Colors" 13855 msgstr "Warna Telah Dinamakan" 13856 13857 #: kdeui/kcolordialog.cpp:746 13858 #, kde-format 13859 msgctxt "" 13860 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13861 "them)" 13862 msgid "" 13863 "Unable to read X11 RGB color strings. The following file location was " 13864 "examined:\n" 13865 "%2" 13866 msgid_plural "" 13867 "Unable to read X11 RGB color strings. The following file locations were " 13868 "examined:\n" 13869 "%2" 13870 msgstr[0] "" 13871 msgstr[1] "" 13872 13873 #: kdeui/kcolordialog.cpp:997 13874 #, kde-format 13875 msgid "Select Color" 13876 msgstr "Pilih Warna" 13877 13878 #: kdeui/kcolordialog.cpp:1077 13879 #, kde-format 13880 msgid "Hue:" 13881 msgstr "Hue:" 13882 13883 #: kdeui/kcolordialog.cpp:1083 13884 #, kde-format 13885 msgctxt "The angular degree unit (for hue)" 13886 msgid "°" 13887 msgstr "°" 13888 13889 #: kdeui/kcolordialog.cpp:1088 13890 #, fuzzy, kde-format 13891 #| msgid "Saturday" 13892 msgid "Saturation:" 13893 msgstr "Sabtu" 13894 13895 #: kdeui/kcolordialog.cpp:1098 13896 #, kde-format 13897 msgctxt "This is the V of HSV" 13898 msgid "Value:" 13899 msgstr "Nilai:" 13900 13901 #: kdeui/kcolordialog.cpp:1111 13902 #, kde-format 13903 msgid "Red:" 13904 msgstr "Merah:" 13905 13906 #: kdeui/kcolordialog.cpp:1121 13907 #, kde-format 13908 msgid "Green:" 13909 msgstr "Hijau:" 13910 13911 #: kdeui/kcolordialog.cpp:1131 13912 #, kde-format 13913 msgid "Blue:" 13914 msgstr "Biru:" 13915 13916 #: kdeui/kcolordialog.cpp:1152 13917 #, kde-format 13918 msgid "Alpha:" 13919 msgstr "Alpha:" 13920 13921 #: kdeui/kcolordialog.cpp:1206 13922 #, kde-format 13923 msgid "&Add to Custom Colors" 13924 msgstr "T&ambah kepada WarnaTersendiri" 13925 13926 #: kdeui/kcolordialog.cpp:1234 13927 #, kde-format 13928 msgid "Name:" 13929 msgstr "Nama:" 13930 13931 #: kdeui/kcolordialog.cpp:1241 13932 #, kde-format 13933 msgid "HTML:" 13934 msgstr "HTML:" 13935 13936 #: kdeui/kcolordialog.cpp:1328 13937 #, kde-format 13938 msgid "Default color" 13939 msgstr "Warna Default" 13940 13941 #: kdeui/kcolordialog.cpp:1393 13942 #, kde-format 13943 msgid "-default-" 13944 msgstr "-default-" 13945 13946 #: kdeui/kcolordialog.cpp:1668 13947 #, kde-format 13948 msgid "-unnamed-" 13949 msgstr "-unnamed-" 13950 13951 #: kdeui/kdeprintdialog.cpp:40 13952 #, kde-format 13953 msgctxt "@title:window" 13954 msgid "Print" 13955 msgstr "Cetak" 13956 13957 #: kdeui/kdialog.cpp:271 13958 #, kde-format 13959 msgid "&Try" 13960 msgstr "&Cuba" 13961 13962 #: kdeui/kdialog.cpp:484 13963 #, kde-format 13964 msgid "modified" 13965 msgstr "telah diubah" 13966 13967 #: kdeui/kdialog.cpp:495 13968 #, kde-format 13969 msgctxt "Document/application separator in titlebar" 13970 msgid " – " 13971 msgstr " – " 13972 13973 #: kdeui/kdialog.cpp:896 13974 #, kde-format 13975 msgid "&Details" 13976 msgstr "&Terperinci" 13977 13978 #: kdeui/kdialog.cpp:1054 13979 #, kde-format 13980 msgid "Get help..." 13981 msgstr "Dapatkan bantuan..." 13982 13983 #: kdeui/keditlistbox.cpp:324 13984 #, kde-format 13985 msgid "&Add" 13986 msgstr "T&ambah" 13987 13988 #: kdeui/keditlistbox.cpp:336 13989 #, kde-format 13990 msgid "&Remove" 13991 msgstr "&Buang" 13992 13993 #: kdeui/keditlistbox.cpp:348 13994 #, kde-format 13995 msgid "Move &Up" 13996 msgstr "Pindah &Atas" 13997 13998 #: kdeui/keditlistbox.cpp:353 13999 #, kde-format 14000 msgid "Move &Down" 14001 msgstr "Pin&dah Bawah" 14002 14003 #. i18n: A shorter version of the alphabet test phrase translated in 14004 #. another message. It is displayed in the dropdown list of font previews 14005 #. (the font selection combo box), so keep it under the length equivalent 14006 #. to 60 or so proportional Latin characters. 14007 #: kdeui/kfontcombobox.cpp:48 14008 #, kde-format 14009 msgctxt "short" 14010 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 14011 msgstr "The Quick Brown Fox Jumps Over The Lazy Dog" 14012 14013 #. i18n: Integer which indicates the script you used in the sample text 14014 #. for font previews in your language. For the possible values, see 14015 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 14016 #. If the sample text contains several scripts, their IDs can be given 14017 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 14018 #: kdeui/kfontcombobox.cpp:119 14019 #, kde-format 14020 msgctxt "Numeric IDs of scripts for font previews" 14021 msgid "1" 14022 msgstr "1" 14023 14024 #: kdeui/kfontdialog.cpp:51 14025 #, kde-format 14026 msgid "Select Font" 14027 msgstr "Pilih Font" 14028 14029 #: kdeui/kprintpreview.cpp:118 14030 #, kde-format 14031 msgid "Could not load print preview part" 14032 msgstr "Tidak dapat memuatkan bahagian prapapar cetakan" 14033 14034 #: kdeui/kprintpreview.cpp:135 14035 #, kde-format 14036 msgid "Print Preview" 14037 msgstr "Prapapar Cetakan" 14038 14039 #: kdeui/ksystemtrayicon.cpp:153 14040 #, kde-format 14041 msgid "Minimize" 14042 msgstr "Miniatur" 14043 14044 #: kdeui/ksystemtrayicon.cpp:205 14045 #, kde-format 14046 msgid "&Minimize" 14047 msgstr "&Minimumkan" 14048 14049 #: kdeui/ksystemtrayicon.cpp:207 14050 #, kde-format 14051 msgid "&Restore" 14052 msgstr "&Pulih" 14053 14054 #: kdeui/ksystemtrayicon.cpp:226 14055 #, kde-format 14056 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 14057 msgstr "<qt>Anda pasti ingin keluar <b>%1</b>?</qt>" 14058 14059 #: kdeui/ksystemtrayicon.cpp:229 14060 #, kde-format 14061 msgid "Confirm Quit From System Tray" 14062 msgstr "Sahkan Keluar Dari Dulang Sistem" 14063 14064 #: kdeui/kundostack.cpp:47 14065 #, kde-format 14066 msgid "Redo" 14067 msgstr "Ulangbuat" 14068 14069 #: kdeui/kundostack.cpp:66 14070 #, kde-format 14071 msgid "Undo" 14072 msgstr "Nyahcara" 14073 14074 #: kdeui/kuniqueapplication.cpp:79 14075 #, kde-format 14076 msgid "Do not run in the background." 14077 msgstr "Jangan laksana di latar belakang." 14078 14079 #: kdeui/kuniqueapplication.cpp:81 14080 #, kde-format 14081 msgid "Internally added if launched from Finder" 14082 msgstr "" 14083 14084 #: kio/kcommentwidget.cpp:68 14085 #, fuzzy, kde-format 14086 msgctxt "@label" 14087 msgid "Add Comment..." 14088 msgstr "Tambah masukan PXE" 14089 14090 #: kio/kcommentwidget.cpp:74 14091 #, kde-format 14092 msgctxt "@label" 14093 msgid "Change..." 14094 msgstr "Ubah..." 14095 14096 #: kio/kcommentwidget.cpp:128 14097 #, fuzzy, kde-format 14098 #| msgid "Comment" 14099 msgctxt "@title:window" 14100 msgid "Change Comment" 14101 msgstr "Komen" 14102 14103 #: kio/kcommentwidget.cpp:129 14104 #, fuzzy, kde-format 14105 #| msgid "Comment" 14106 msgctxt "@title:window" 14107 msgid "Add Comment" 14108 msgstr "Komen" 14109 14110 #: kio/kdevicelistmodel.cpp:115 14111 #, fuzzy, kde-format 14112 msgid "Device name" 14113 msgstr "Peranti:" 14114 14115 #: kio/kdirselectdialog.cpp:136 14116 #, fuzzy, kde-format 14117 #| msgid "New Folder" 14118 msgctxt "folder name" 14119 msgid "New Folder" 14120 msgstr "Folder Baru" 14121 14122 #: kio/kdirselectdialog.cpp:141 14123 #, fuzzy, kde-format 14124 #| msgid "New Folder" 14125 msgctxt "@title:window" 14126 msgid "New Folder" 14127 msgstr "Folder Baru" 14128 14129 #: kio/kdirselectdialog.cpp:142 14130 #, fuzzy, kde-format 14131 #| msgid "" 14132 #| "Create new folder in:\n" 14133 #| "%1" 14134 msgctxt "@label:textbox" 14135 msgid "" 14136 "Create new folder in:\n" 14137 "%1" 14138 msgstr "" 14139 "Cipta folder baru dalam:\n" 14140 "%1" 14141 14142 #: kio/kdirselectdialog.cpp:172 14143 #, kde-format 14144 msgid "A file or folder named %1 already exists." 14145 msgstr "Fail atau folder bernama %1 sudah wujud." 14146 14147 #: kio/kdirselectdialog.cpp:175 14148 #, kde-format 14149 msgid "You do not have permission to create that folder." 14150 msgstr "Anda tidak mempunyai keizinan untuk mencipta folder itu." 14151 14152 #: kio/kdirselectdialog.cpp:290 14153 #, fuzzy, kde-format 14154 #| msgid "Select Folder" 14155 msgctxt "@title:window" 14156 msgid "Select Folder" 14157 msgstr "Pilih Folder" 14158 14159 #: kio/kdirselectdialog.cpp:299 14160 #, fuzzy, kde-format 14161 #| msgid "New Folder..." 14162 msgctxt "@action:button" 14163 msgid "New Folder..." 14164 msgstr "Folder Baru..." 14165 14166 #: kio/kdirselectdialog.cpp:345 14167 #, fuzzy, kde-format 14168 #| msgid "New Folder..." 14169 msgctxt "@action:inmenu" 14170 msgid "New Folder..." 14171 msgstr "Folder Baru..." 14172 14173 #: kio/kdirselectdialog.cpp:352 14174 #, fuzzy, kde-format 14175 #| msgid "Move to Trash" 14176 msgctxt "@action:inmenu" 14177 msgid "Move to Trash" 14178 msgstr "Alihkan ke Tong Sampah" 14179 14180 #: kio/kdirselectdialog.cpp:359 14181 #, fuzzy, kde-format 14182 msgctxt "@action:inmenu" 14183 msgid "Delete" 14184 msgstr "Menghapus" 14185 14186 #: kio/kdirselectdialog.cpp:368 14187 #, fuzzy, kde-format 14188 #| msgid "Show Hidden Folders" 14189 msgctxt "@option:check" 14190 msgid "Show Hidden Folders" 14191 msgstr "Papar Folder Tersembunyi" 14192 14193 #: kio/kdirselectdialog.cpp:375 14194 #, fuzzy, kde-format 14195 msgctxt "@action:inmenu" 14196 msgid "Properties" 14197 msgstr "Ciri-ciri untuk %1" 14198 14199 #: kio/kfiledialog.cpp:132 14200 #, fuzzy, kde-format 14201 #| msgid "*|All Files" 14202 msgid "*|All files" 14203 msgstr "*|Semua Fail" 14204 14205 #: kio/kfiledialog.cpp:332 14206 #, kde-format 14207 msgid "All Supported Files" 14208 msgstr "Semua Fail Yang Disokong" 14209 14210 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 14211 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 14212 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 14213 #, kde-format 14214 msgid "Open" 14215 msgstr "Buka" 14216 14217 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 14218 #: kio/kfiledialog.cpp:838 14219 #, kde-format 14220 msgid "Save As" 14221 msgstr "Simpan Sebagai" 14222 14223 #: kio/kfilemetadataprovider.cpp:245 14224 #, kde-format 14225 msgctxt "@item:intable" 14226 msgid "%1 item" 14227 msgid_plural "%1 items" 14228 msgstr[0] "" 14229 msgstr[1] "" 14230 14231 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 14232 #, fuzzy, kde-format 14233 msgctxt "@label" 14234 msgid "Comment" 14235 msgstr "Komen" 14236 14237 #: kio/kfilemetadataprovider.cpp:447 14238 #, fuzzy, kde-format 14239 #| msgid "Modified:" 14240 msgctxt "@label" 14241 msgid "Modified" 14242 msgstr "Diubah Suai:" 14243 14244 #: kio/kfilemetadataprovider.cpp:448 14245 #, fuzzy, kde-format 14246 #| msgid "Owner" 14247 msgctxt "@label" 14248 msgid "Owner" 14249 msgstr "Pemilik" 14250 14251 #: kio/kfilemetadataprovider.cpp:449 14252 #, fuzzy, kde-format 14253 #| msgid "Permissions" 14254 msgctxt "@label" 14255 msgid "Permissions" 14256 msgstr "Keizinan" 14257 14258 #: kio/kfilemetadataprovider.cpp:450 14259 #, fuzzy, kde-format 14260 #| msgid "Sorting" 14261 msgctxt "@label" 14262 msgid "Rating" 14263 msgstr "Isihan" 14264 14265 #: kio/kfilemetadataprovider.cpp:451 14266 #, fuzzy, kde-format 14267 #| msgid "Size" 14268 msgctxt "@label" 14269 msgid "Size" 14270 msgstr "Saiz" 14271 14272 #: kio/kfilemetadataprovider.cpp:452 14273 #, fuzzy, kde-format 14274 #| msgctxt "to trash" 14275 #| msgid "&Trash" 14276 msgctxt "@label" 14277 msgid "Tags" 14278 msgstr "&Tong Sampah" 14279 14280 #: kio/kfilemetadataprovider.cpp:453 14281 #, fuzzy, kde-format 14282 #| msgid "Size:" 14283 msgctxt "@label" 14284 msgid "Total Size" 14285 msgstr "Saiz:" 14286 14287 #: kio/kfilemetadataprovider.cpp:454 14288 #, fuzzy, kde-format 14289 msgctxt "@label" 14290 msgid "Type" 14291 msgstr "Jenis" 14292 14293 #: kio/kfilemetadatareaderprocess.cpp:234 14294 #, kde-format 14295 msgid "KFileMetaDataReader" 14296 msgstr "" 14297 14298 #: kio/kfilemetadatareaderprocess.cpp:236 14299 #, kde-format 14300 msgid "KFileMetaDataReader can be used to read metadata from a file" 14301 msgstr "" 14302 14303 #: kio/kfilemetadatareaderprocess.cpp:238 14304 #, kde-format 14305 msgid "(C) 2011, Peter Penz" 14306 msgstr "" 14307 14308 #: kio/kfilemetadatareaderprocess.cpp:239 14309 #, kde-format 14310 msgid "Peter Penz" 14311 msgstr "" 14312 14313 #: kio/kfilemetadatareaderprocess.cpp:239 14314 #, kde-format 14315 msgid "Current maintainer" 14316 msgstr "" 14317 14318 #: kio/kfilemetadatareaderprocess.cpp:244 14319 #, kde-format 14320 msgid "Only the meta data that is part of the file is read" 14321 msgstr "" 14322 14323 #: kio/kfilemetadatareaderprocess.cpp:245 14324 #, kde-format 14325 msgid "List of URLs where the meta-data should be read from" 14326 msgstr "" 14327 14328 #: kio/kfilemetainfowidget.cpp:161 14329 #, kde-format 14330 msgid "<Error>" 14331 msgstr "<Error>" 14332 14333 #: kio/kfiletreeview.cpp:192 14334 #, fuzzy, kde-format 14335 #| msgid "Show Hidden Folders" 14336 msgid "Show Hidden Folders" 14337 msgstr "Papar Folder Tersembunyi" 14338 14339 #: kio/kimageio.cpp:46 14340 #, kde-format 14341 msgid "All Pictures" 14342 msgstr "Semua Gambar" 14343 14344 #: kio/kmetaprops.cpp:57 14345 #, kde-format 14346 msgctxt "@title:window" 14347 msgid "Configure Shown Data" 14348 msgstr "" 14349 14350 #: kio/kmetaprops.cpp:60 14351 #, kde-format 14352 msgctxt "@label::textbox" 14353 msgid "Select which data should be shown:" 14354 msgstr "" 14355 14356 #: kio/kmetaprops.cpp:123 14357 #, fuzzy, kde-format 14358 #| msgid "Calculating..." 14359 msgctxt "@action:button" 14360 msgid "Configure..." 14361 msgstr "Mengira..." 14362 14363 #: kio/kmetaprops.cpp:133 14364 #, fuzzy, kde-format 14365 msgctxt "@title:tab" 14366 msgid "Information" 14367 msgstr "Maklumat SSL KDE" 14368 14369 #: kio/knfotranslator.cpp:40 14370 #, fuzzy, kde-format 14371 #| msgid "Created:" 14372 msgctxt "@label creation date" 14373 msgid "Created" 14374 msgstr "Dicipta:" 14375 14376 #: kio/knfotranslator.cpp:41 14377 #, fuzzy, kde-format 14378 #| msgid "Size" 14379 msgctxt "@label file content size" 14380 msgid "Size" 14381 msgstr "Saiz" 14382 14383 #: kio/knfotranslator.cpp:42 14384 #, kde-format 14385 msgctxt "@label file depends from" 14386 msgid "Depends" 14387 msgstr "" 14388 14389 #: kio/knfotranslator.cpp:43 14390 #, fuzzy, kde-format 14391 #| msgid "Description" 14392 msgctxt "@label" 14393 msgid "Description" 14394 msgstr "Huraian" 14395 14396 #: kio/knfotranslator.cpp:44 14397 #, fuzzy, kde-format 14398 #| msgid "&General" 14399 msgctxt "@label Software used to generate content" 14400 msgid "Generator" 14401 msgstr "U&mum" 14402 14403 #: kio/knfotranslator.cpp:45 14404 #, kde-format 14405 msgctxt "" 14406 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14407 msgid "Has Part" 14408 msgstr "" 14409 14410 #: kio/knfotranslator.cpp:46 14411 #, kde-format 14412 msgctxt "" 14413 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14414 "nie#hasLogicalPart" 14415 msgid "Has Logical Part" 14416 msgstr "" 14417 14418 #: kio/knfotranslator.cpp:47 14419 #, fuzzy, kde-format 14420 #| msgid "Parent Folder" 14421 msgctxt "@label parent directory" 14422 msgid "Part of" 14423 msgstr "Folder Induk" 14424 14425 #: kio/knfotranslator.cpp:48 14426 #, kde-format 14427 msgctxt "@label" 14428 msgid "Keyword" 14429 msgstr "" 14430 14431 #: kio/knfotranslator.cpp:49 14432 #, fuzzy, kde-format 14433 #| msgid "Modified:" 14434 msgctxt "@label modified date of file" 14435 msgid "Modified" 14436 msgstr "Diubah Suai:" 14437 14438 #: kio/knfotranslator.cpp:50 14439 #, fuzzy, kde-format 14440 #| msgid "Mime Type" 14441 msgctxt "@label" 14442 msgid "MIME Type" 14443 msgstr "Jenis Mime" 14444 14445 #: kio/knfotranslator.cpp:51 14446 #, fuzzy, kde-format 14447 #| msgid "Contents:" 14448 msgctxt "@label" 14449 msgid "Content" 14450 msgstr "Kandungan:" 14451 14452 #: kio/knfotranslator.cpp:52 14453 #, fuzzy, kde-format 14454 #| msgid "created on %1" 14455 msgctxt "@label" 14456 msgid "Related To" 14457 msgstr "dicipta pada %1" 14458 14459 #: kio/knfotranslator.cpp:53 14460 #, fuzzy, kde-format 14461 #| msgid "Subject line" 14462 msgctxt "@label" 14463 msgid "Subject" 14464 msgstr "Baris subjek" 14465 14466 #: kio/knfotranslator.cpp:54 14467 #, fuzzy, kde-format 14468 msgctxt "@label music title" 14469 msgid "Title" 14470 msgstr "Tapi&s:" 14471 14472 #: kio/knfotranslator.cpp:55 14473 #, kde-format 14474 msgctxt "@label file URL" 14475 msgid "File Location" 14476 msgstr "" 14477 14478 #: kio/knfotranslator.cpp:56 14479 #, fuzzy, kde-format 14480 #| msgid "Created:" 14481 msgctxt "@label" 14482 msgid "Creator" 14483 msgstr "Dicipta:" 14484 14485 #: kio/knfotranslator.cpp:57 14486 #, kde-format 14487 msgctxt "@label" 14488 msgid "Average Bitrate" 14489 msgstr "" 14490 14491 #: kio/knfotranslator.cpp:58 14492 #, kde-format 14493 msgctxt "@label" 14494 msgid "Channels" 14495 msgstr "" 14496 14497 #: kio/knfotranslator.cpp:59 14498 #, fuzzy, kde-format 14499 msgctxt "@label number of characters" 14500 msgid "Characters" 14501 msgstr "Kategori" 14502 14503 #: kio/knfotranslator.cpp:60 14504 #, fuzzy, kde-format 14505 #| msgid "C&onnect" 14506 msgctxt "@label" 14507 msgid "Codec" 14508 msgstr "&Sambung" 14509 14510 #: kio/knfotranslator.cpp:61 14511 #, kde-format 14512 msgctxt "@label" 14513 msgid "Color Depth" 14514 msgstr "" 14515 14516 #: kio/knfotranslator.cpp:62 14517 #, fuzzy, kde-format 14518 msgctxt "@label" 14519 msgid "Duration" 14520 msgstr "Destinasi:" 14521 14522 #: kio/knfotranslator.cpp:63 14523 #, fuzzy, kde-format 14524 msgctxt "@label" 14525 msgid "Filename" 14526 msgstr "Peranti:" 14527 14528 #: kio/knfotranslator.cpp:64 14529 #, kde-format 14530 msgctxt "@label" 14531 msgid "Hash" 14532 msgstr "" 14533 14534 #: kio/knfotranslator.cpp:65 14535 #, kde-format 14536 msgctxt "@label" 14537 msgid "Height" 14538 msgstr "" 14539 14540 #: kio/knfotranslator.cpp:66 14541 #, kde-format 14542 msgctxt "@label" 14543 msgid "Interlace Mode" 14544 msgstr "" 14545 14546 #: kio/knfotranslator.cpp:67 14547 #, fuzzy, kde-format 14548 #| msgid "Link" 14549 msgctxt "@label number of lines" 14550 msgid "Lines" 14551 msgstr "Pautan" 14552 14553 #: kio/knfotranslator.cpp:68 14554 #, kde-format 14555 msgctxt "@label" 14556 msgid "Programming Language" 14557 msgstr "" 14558 14559 #: kio/knfotranslator.cpp:69 14560 #, kde-format 14561 msgctxt "@label" 14562 msgid "Sample Rate" 14563 msgstr "" 14564 14565 #: kio/knfotranslator.cpp:70 14566 #, fuzzy, kde-format 14567 #| msgid "Write" 14568 msgctxt "@label" 14569 msgid "Width" 14570 msgstr "Tulis" 14571 14572 #: kio/knfotranslator.cpp:71 14573 #, kde-format 14574 msgctxt "@label number of words" 14575 msgid "Words" 14576 msgstr "" 14577 14578 #: kio/knfotranslator.cpp:72 14579 #, kde-format 14580 msgctxt "@label EXIF aperture value" 14581 msgid "Aperture" 14582 msgstr "" 14583 14584 #: kio/knfotranslator.cpp:73 14585 #, kde-format 14586 msgctxt "@label EXIF" 14587 msgid "Exposure Bias Value" 14588 msgstr "" 14589 14590 #: kio/knfotranslator.cpp:74 14591 #, fuzzy, kde-format 14592 #| msgid "Exposure:" 14593 msgctxt "@label EXIF" 14594 msgid "Exposure Time" 14595 msgstr "Pendedahan:" 14596 14597 #: kio/knfotranslator.cpp:75 14598 #, fuzzy, kde-format 14599 #| msgid "Class" 14600 msgctxt "@label EXIF" 14601 msgid "Flash" 14602 msgstr "Kelas" 14603 14604 #: kio/knfotranslator.cpp:76 14605 #, kde-format 14606 msgctxt "@label EXIF" 14607 msgid "Focal Length" 14608 msgstr "" 14609 14610 #: kio/knfotranslator.cpp:77 14611 #, kde-format 14612 msgctxt "@label EXIF" 14613 msgid "Focal Length 35 mm" 14614 msgstr "" 14615 14616 #: kio/knfotranslator.cpp:78 14617 #, kde-format 14618 msgctxt "@label EXIF" 14619 msgid "ISO Speed Ratings" 14620 msgstr "" 14621 14622 #: kio/knfotranslator.cpp:79 14623 #, fuzzy, kde-format 14624 msgctxt "@label EXIF" 14625 msgid "Make" 14626 msgstr "Topengan" 14627 14628 #: kio/knfotranslator.cpp:80 14629 #, kde-format 14630 msgctxt "@label EXIF" 14631 msgid "Metering Mode" 14632 msgstr "" 14633 14634 #: kio/knfotranslator.cpp:81 14635 #, kde-format 14636 msgctxt "@label EXIF" 14637 msgid "Model" 14638 msgstr "" 14639 14640 #: kio/knfotranslator.cpp:82 14641 #, fuzzy, kde-format 14642 #| msgid "Organization:" 14643 msgctxt "@label EXIF" 14644 msgid "Orientation" 14645 msgstr "Organisasi:" 14646 14647 #: kio/knfotranslator.cpp:83 14648 #, kde-format 14649 msgctxt "@label EXIF" 14650 msgid "White Balance" 14651 msgstr "" 14652 14653 #: kio/knfotranslator.cpp:84 14654 #, kde-format 14655 msgctxt "@label video director" 14656 msgid "Director" 14657 msgstr "" 14658 14659 #: kio/knfotranslator.cpp:85 14660 #, fuzzy, kde-format 14661 #| msgid "&General" 14662 msgctxt "@label music genre" 14663 msgid "Genre" 14664 msgstr "U&mum" 14665 14666 #: kio/knfotranslator.cpp:86 14667 #, kde-format 14668 msgctxt "@label music album" 14669 msgid "Album" 14670 msgstr "" 14671 14672 #: kio/knfotranslator.cpp:87 14673 #, kde-format 14674 msgctxt "@label" 14675 msgid "Performer" 14676 msgstr "" 14677 14678 #: kio/knfotranslator.cpp:88 14679 #, fuzzy, kde-format 14680 msgctxt "@label" 14681 msgid "Release Date" 14682 msgstr "&Buang Input" 14683 14684 #: kio/knfotranslator.cpp:89 14685 #, kde-format 14686 msgctxt "@label music track number" 14687 msgid "Track" 14688 msgstr "" 14689 14690 #: kio/knfotranslator.cpp:90 14691 #, fuzzy, kde-format 14692 #| msgid "URL Resource Invalid" 14693 msgctxt "@label resource created time" 14694 msgid "Resource Created" 14695 msgstr "Sumber URL Tidak Sah" 14696 14697 #: kio/knfotranslator.cpp:91 14698 #, fuzzy, kde-format 14699 msgctxt "@label" 14700 msgid "Sub Resource" 14701 msgstr "Sumber:" 14702 14703 #: kio/knfotranslator.cpp:92 14704 #, fuzzy, kde-format 14705 #| msgid "Modified:" 14706 msgctxt "@label resource last modified" 14707 msgid "Resource Modified" 14708 msgstr "Diubah Suai:" 14709 14710 #: kio/knfotranslator.cpp:93 14711 #, fuzzy, kde-format 14712 #| msgid "Sorting" 14713 msgctxt "@label" 14714 msgid "Numeric Rating" 14715 msgstr "Isihan" 14716 14717 #: kio/knfotranslator.cpp:94 14718 #, kde-format 14719 msgctxt "@label" 14720 msgid "Copied From" 14721 msgstr "" 14722 14723 #: kio/knfotranslator.cpp:95 14724 #, kde-format 14725 msgctxt "@label" 14726 msgid "First Usage" 14727 msgstr "" 14728 14729 #: kio/knfotranslator.cpp:96 14730 #, kde-format 14731 msgctxt "@label" 14732 msgid "Last Usage" 14733 msgstr "" 14734 14735 #: kio/knfotranslator.cpp:97 14736 #, fuzzy, kde-format 14737 #| msgid "Comment" 14738 msgctxt "@label" 14739 msgid "Usage Count" 14740 msgstr "Komen" 14741 14742 #: kio/knfotranslator.cpp:98 14743 #, kde-format 14744 msgctxt "@label" 14745 msgid "Unix File Group" 14746 msgstr "" 14747 14748 #: kio/knfotranslator.cpp:99 14749 #, kde-format 14750 msgctxt "@label" 14751 msgid "Unix File Mode" 14752 msgstr "" 14753 14754 #: kio/knfotranslator.cpp:100 14755 #, fuzzy, kde-format 14756 #| msgid "Open file dialog" 14757 msgctxt "@label" 14758 msgid "Unix File Owner" 14759 msgstr "Buka dialog fail" 14760 14761 #: kio/knfotranslator.cpp:101 14762 #, fuzzy, kde-format 14763 msgctxt "@label file type" 14764 msgid "Type" 14765 msgstr "Jenis" 14766 14767 #: kio/knfotranslator.cpp:102 14768 #, kde-format 14769 msgctxt "@label Number of fuzzy translations" 14770 msgid "Fuzzy Translations" 14771 msgstr "" 14772 14773 #: kio/knfotranslator.cpp:103 14774 #, kde-format 14775 msgctxt "@label Name of last translator" 14776 msgid "Last Translator" 14777 msgstr "" 14778 14779 #: kio/knfotranslator.cpp:104 14780 #, kde-format 14781 msgctxt "@label Number of obsolete translations" 14782 msgid "Obsolete Translations" 14783 msgstr "" 14784 14785 #: kio/knfotranslator.cpp:105 14786 #, kde-format 14787 msgctxt "@label" 14788 msgid "Translation Source Date" 14789 msgstr "" 14790 14791 #: kio/knfotranslator.cpp:106 14792 #, kde-format 14793 msgctxt "@label Number of total translations" 14794 msgid "Total Translations" 14795 msgstr "" 14796 14797 #: kio/knfotranslator.cpp:107 14798 #, fuzzy, kde-format 14799 #| msgid "Created:" 14800 msgctxt "@label Number of translated strings" 14801 msgid "Translated" 14802 msgstr "Dicipta:" 14803 14804 #: kio/knfotranslator.cpp:108 14805 #, kde-format 14806 msgctxt "@label" 14807 msgid "Translation Date" 14808 msgstr "" 14809 14810 #: kio/knfotranslator.cpp:109 14811 #, kde-format 14812 msgctxt "@label Number of untranslated strings" 14813 msgid "Untranslated" 14814 msgstr "" 14815 14816 #: kio/kpreviewprops.cpp:51 14817 #, kde-format 14818 msgid "P&review" 14819 msgstr "&Prapapar" 14820 14821 #: kio/kscan.cpp:49 14822 #, kde-format 14823 msgid "Acquire Image" 14824 msgstr "Cekup Imej" 14825 14826 #: kio/kscan.cpp:97 14827 #, kde-format 14828 msgid "OCR Image" 14829 msgstr "Imej OCR" 14830 14831 #: kio/netaccess.cpp:102 14832 #, kde-format 14833 msgid "File '%1' is not readable" 14834 msgstr "Fail '%1' gagal dibaca" 14835 14836 #: kio/netaccess.cpp:435 14837 #, fuzzy, kde-format 14838 msgid "ERROR: Unknown protocol '%1'" 14839 msgstr "Kod ralat tak dikenal %d\n" 14840 14841 #: kio/passworddialog.cpp:56 14842 #, kde-format 14843 msgid "Authorization Dialog" 14844 msgstr "Dialog Keizinan" 14845 14846 #: kioslave/metainfo/metainfo.cpp:98 14847 #, kde-format 14848 msgid "No metainfo for %1" 14849 msgstr "Tidak terdapat info meta untuk %1" 14850 14851 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14852 #: kssl/kcm/cacertificates.ui:24 14853 #, fuzzy, kde-format 14854 #| msgid "Organization:" 14855 msgid "Organization / Common Name" 14856 msgstr "Organisasi:" 14857 14858 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14859 #: kssl/kcm/cacertificates.ui:29 14860 #, fuzzy, kde-format 14861 #| msgid "Organizational unit:" 14862 msgid "Organizational Unit" 14863 msgstr "unit organisasi:" 14864 14865 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14866 #: kssl/kcm/cacertificates.ui:42 14867 #, kde-format 14868 msgid "Display..." 14869 msgstr "" 14870 14871 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14872 #: kssl/kcm/cacertificates.ui:68 14873 #, fuzzy, kde-format 14874 #| msgid "disable XIM" 14875 msgid "Disable" 14876 msgstr "matikan XIM" 14877 14878 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14879 #: kssl/kcm/cacertificates.ui:78 14880 #, kde-format 14881 msgid "Enable" 14882 msgstr "" 14883 14884 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14885 #: kssl/kcm/cacertificates.ui:104 14886 #, kde-format 14887 msgid "Remove" 14888 msgstr "Buang" 14889 14890 #. i18n: ectx: property (text), widget (QPushButton, add) 14891 #: kssl/kcm/cacertificates.ui:111 14892 #, kde-format 14893 msgid "Add..." 14894 msgstr "Tambah..." 14895 14896 #: kssl/kcm/cacertificatespage.cpp:140 14897 #, fuzzy, kde-format 14898 msgid "System certificates" 14899 msgstr "_Fail Sijil:" 14900 14901 #: kssl/kcm/cacertificatespage.cpp:147 14902 #, fuzzy, kde-format 14903 msgid "User-added certificates" 14904 msgstr "_Fail Sijil:" 14905 14906 #: kssl/kcm/cacertificatespage.cpp:302 14907 #, fuzzy, kde-format 14908 #| msgid "Certificate" 14909 msgid "Pick Certificates" 14910 msgstr "Sijil" 14911 14912 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14913 #: kssl/kcm/displaycert.ui:23 14914 #, fuzzy, kde-format 14915 #| msgid "Security Information" 14916 msgid "<b>Subject Information</b>" 14917 msgstr "Maklumat Sekuriti" 14918 14919 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14920 #: kssl/kcm/displaycert.ui:39 14921 #, fuzzy, kde-format 14922 msgid "<b>Issuer Information</b>" 14923 msgstr " <b>[Domain Silang!]</b>" 14924 14925 #. i18n: ectx: property (text), widget (QLabel, label) 14926 #: kssl/kcm/displaycert.ui:55 14927 #, fuzzy, kde-format 14928 #| msgid "<b>%1</b>" 14929 msgid "<b>Other</b>" 14930 msgstr "<b>%1</b>" 14931 14932 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14933 #: kssl/kcm/displaycert.ui:64 14934 #, fuzzy, kde-format 14935 #| msgid "Valid from:" 14936 msgid "Validity period" 14937 msgstr "Sah dari:" 14938 14939 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14940 #: kssl/kcm/displaycert.ui:78 14941 #, fuzzy, kde-format 14942 #| msgid "Serial number:" 14943 msgid "Serial number" 14944 msgstr "Nombor siri:" 14945 14946 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14947 #: kssl/kcm/displaycert.ui:92 14948 #, fuzzy, kde-format 14949 #| msgid "MD5 digest:" 14950 msgid "MD5 digest" 14951 msgstr "Rumusan MD5:" 14952 14953 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14954 #: kssl/kcm/displaycert.ui:106 14955 #, fuzzy, kde-format 14956 #| msgid "MD5 digest:" 14957 msgid "SHA1 digest" 14958 msgstr "Rumusan MD5:" 14959 14960 #: kssl/kcm/displaycertdialog.cpp:73 14961 #, fuzzy, kde-format 14962 #| msgid "%1 (%2)" 14963 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14964 msgid "%1 to %2" 14965 msgstr "%1 (%2)" 14966 14967 #: kssl/kcm/kcmssl.cpp:37 14968 #, fuzzy, kde-format 14969 #| msgid "Reload configuration file" 14970 msgid "SSL Configuration Module" 14971 msgstr "Ulangmuat konfigurasi fail" 14972 14973 #: kssl/kcm/kcmssl.cpp:39 14974 #, kde-format 14975 msgid "Copyright 2010 Andreas Hartmetz" 14976 msgstr "" 14977 14978 #: kssl/kcm/kcmssl.cpp:40 14979 #, kde-format 14980 msgid "Andreas Hartmetz" 14981 msgstr "" 14982 14983 #: kssl/kcm/kcmssl.cpp:52 14984 #, fuzzy, kde-format 14985 #| msgid "Link" 14986 msgid "SSL Signers" 14987 msgstr "Pautan" 14988 14989 #: kssl/ksslcertificate.cpp:202 14990 #, kde-format 14991 msgid "Signature Algorithm: " 14992 msgstr "Algoritma Tandatangan:" 14993 14994 #: kssl/ksslcertificate.cpp:203 14995 #, kde-format 14996 msgid "Unknown" 14997 msgstr "Tidak Diketahui" 14998 14999 #: kssl/ksslcertificate.cpp:206 15000 #, kde-format 15001 msgid "Signature Contents:" 15002 msgstr "Kandungan Tandatangan:" 15003 15004 #: kssl/ksslcertificate.cpp:341 15005 #, kde-format 15006 msgctxt "Unknown" 15007 msgid "Unknown key algorithm" 15008 msgstr "Algoritma kekunci tidak diketahui" 15009 15010 #: kssl/ksslcertificate.cpp:347 15011 #, kde-format 15012 msgid "Key type: RSA (%1 bit)" 15013 msgstr "Jenis kekunci: RSA (%1 bit)" 15014 15015 #: kssl/ksslcertificate.cpp:349 15016 #, kde-format 15017 msgid "Modulus: " 15018 msgstr "Modulus: " 15019 15020 #: kssl/ksslcertificate.cpp:362 15021 #, kde-format 15022 msgid "Exponent: 0x" 15023 msgstr "Eksponen: 0x" 15024 15025 #: kssl/ksslcertificate.cpp:374 15026 #, kde-format 15027 msgid "Key type: DSA (%1 bit)" 15028 msgstr "Jenis kekunci: DSA (%1 bit)" 15029 15030 #: kssl/ksslcertificate.cpp:376 15031 #, kde-format 15032 msgid "Prime: " 15033 msgstr "Primer:" 15034 15035 #: kssl/ksslcertificate.cpp:389 15036 #, kde-format 15037 msgid "160 bit prime factor: " 15038 msgstr "Faktor primer 160 bit:" 15039 15040 #: kssl/ksslcertificate.cpp:417 15041 #, kde-format 15042 msgid "Public key: " 15043 msgstr "Kekunci awam:" 15044 15045 #: kssl/ksslcertificate.cpp:1065 15046 #, kde-format 15047 msgid "The certificate is valid." 15048 msgstr "Sijil adalah sah." 15049 15050 #: kssl/ksslcertificate.cpp:1067 15051 #, kde-format 15052 msgid "" 15053 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 15054 "Authority) certificate can not be found." 15055 msgstr "" 15056 15057 #: kssl/ksslcertificate.cpp:1069 15058 #, fuzzy, kde-format 15059 #| msgid "" 15060 #| "Certificate signing authority root files could not be found so the " 15061 #| "certificate is not verified." 15062 msgid "" 15063 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 15064 "CA's (Certificate Authority) CRL can not be found." 15065 msgstr "" 15066 "Fail root pihak berkuasa tandatangan sijil tidak dapat ditemui, justeru " 15067 "sijil tidak disahkan." 15068 15069 #: kssl/ksslcertificate.cpp:1071 15070 #, kde-format 15071 msgid "" 15072 "The decryption of the certificate's signature failed. This means it could " 15073 "not even be calculated as opposed to just not matching the expected result." 15074 msgstr "" 15075 15076 #: kssl/ksslcertificate.cpp:1073 15077 #, kde-format 15078 msgid "" 15079 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 15080 "This means it could not even be calculated as opposed to just not matching " 15081 "the expected result." 15082 msgstr "" 15083 15084 #: kssl/ksslcertificate.cpp:1075 15085 #, kde-format 15086 msgid "" 15087 "The decoding of the public key of the issuer failed. This means that the " 15088 "CA's (Certificate Authority) certificate can not be used to verify the " 15089 "certificate you wanted to use." 15090 msgstr "" 15091 15092 #: kssl/ksslcertificate.cpp:1077 15093 #, fuzzy, kde-format 15094 #| msgid "" 15095 #| "Certificate signing authority root files could not be found so the " 15096 #| "certificate is not verified." 15097 msgid "" 15098 "The certificate's signature is invalid. This means that the certificate can " 15099 "not be verified." 15100 msgstr "" 15101 "Fail root pihak berkuasa tandatangan sijil tidak dapat ditemui, justeru " 15102 "sijil tidak disahkan." 15103 15104 #: kssl/ksslcertificate.cpp:1079 15105 #, fuzzy, kde-format 15106 #| msgid "" 15107 #| "Certificate signing authority root files could not be found so the " 15108 #| "certificate is not verified." 15109 msgid "" 15110 "The CRL's (Certificate Revocation List) signature is invalid. This means " 15111 "that the CRL can not be verified." 15112 msgstr "" 15113 "Fail root pihak berkuasa tandatangan sijil tidak dapat ditemui, justeru " 15114 "sijil tidak disahkan." 15115 15116 #: kssl/ksslcertificate.cpp:1081 15117 #, fuzzy, kde-format 15118 #| msgid "The certificate is invalid." 15119 msgid "The certificate is not valid, yet." 15120 msgstr "Sijil tidak sah." 15121 15122 #: kssl/ksslcertificate.cpp:1083 15123 #, fuzzy, kde-format 15124 #| msgid "The certificate is invalid." 15125 msgid "The certificate is not valid, any more." 15126 msgstr "Sijil tidak sah." 15127 15128 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 15129 #, fuzzy, kde-format 15130 #| msgid "The certificate is invalid." 15131 msgid "The CRL (Certificate Revocation List) is not valid, yet." 15132 msgstr "Sijil tidak sah." 15133 15134 #: kssl/ksslcertificate.cpp:1089 15135 #, kde-format 15136 msgid "The time format of the certificate's 'notBefore' field is invalid." 15137 msgstr "" 15138 15139 #: kssl/ksslcertificate.cpp:1091 15140 #, kde-format 15141 msgid "The time format of the certificate's 'notAfter' field is invalid." 15142 msgstr "" 15143 15144 #: kssl/ksslcertificate.cpp:1093 15145 #, fuzzy, kde-format 15146 #| msgid "The certificate is invalid." 15147 msgid "" 15148 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 15149 "field is invalid." 15150 msgstr "Sijil tidak sah." 15151 15152 #: kssl/ksslcertificate.cpp:1095 15153 #, fuzzy, kde-format 15154 #| msgid "The certificate is invalid." 15155 msgid "" 15156 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 15157 "field is invalid." 15158 msgstr "Sijil tidak sah." 15159 15160 #: kssl/ksslcertificate.cpp:1097 15161 #, kde-format 15162 msgid "The OpenSSL process ran out of memory." 15163 msgstr "" 15164 15165 #: kssl/ksslcertificate.cpp:1099 15166 #, kde-format 15167 msgid "" 15168 "The certificate is self-signed and not in the list of trusted certificates. " 15169 "If you want to accept this certificate, import it into the list of trusted " 15170 "certificates." 15171 msgstr "" 15172 15173 #: kssl/ksslcertificate.cpp:1102 15174 #, kde-format 15175 msgid "" 15176 "The certificate is self-signed. While the trust chain could be built up, the " 15177 "root CA's (Certificate Authority) certificate can not be found." 15178 msgstr "" 15179 15180 #: kssl/ksslcertificate.cpp:1104 15181 #, kde-format 15182 msgid "" 15183 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 15184 "your trust chain is broken." 15185 msgstr "" 15186 15187 #: kssl/ksslcertificate.cpp:1106 15188 #, kde-format 15189 msgid "" 15190 "The certificate can not be verified as it is the only certificate in the " 15191 "trust chain and not self-signed. If you self-sign the certificate, make sure " 15192 "to import it into the list of trusted certificates." 15193 msgstr "" 15194 15195 #: kssl/ksslcertificate.cpp:1108 15196 #, kde-format 15197 msgid "The certificate chain is longer than the maximum depth specified." 15198 msgstr "" 15199 15200 #: kssl/ksslcertificate.cpp:1111 15201 #, fuzzy, kde-format 15202 #| msgid "Certificate has been revoked." 15203 msgid "The certificate has been revoked." 15204 msgstr "Sijil telah dibatalkan." 15205 15206 #: kssl/ksslcertificate.cpp:1113 15207 #, fuzzy, kde-format 15208 #| msgid "The certificate is invalid." 15209 msgid "The certificate's CA (Certificate Authority) is invalid." 15210 msgstr "Sijil tidak sah." 15211 15212 #: kssl/ksslcertificate.cpp:1115 15213 #, kde-format 15214 msgid "" 15215 "The length of the trust chain exceeded one of the CA's (Certificate " 15216 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 15217 msgstr "" 15218 15219 #: kssl/ksslcertificate.cpp:1117 15220 #, kde-format 15221 msgid "" 15222 "The certificate has not been signed for the purpose you tried to use it for. " 15223 "This means the CA (Certificate Authority) does not allow this usage." 15224 msgstr "" 15225 15226 #: kssl/ksslcertificate.cpp:1120 15227 #, kde-format 15228 msgid "" 15229 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 15230 "to use this certificate for." 15231 msgstr "" 15232 15233 #: kssl/ksslcertificate.cpp:1123 15234 #, kde-format 15235 msgid "" 15236 "The root CA (Certificate Authority) has been marked to be rejected for the " 15237 "purpose you tried to use it for." 15238 msgstr "" 15239 15240 #: kssl/ksslcertificate.cpp:1125 15241 #, fuzzy, kde-format 15242 #| msgid "" 15243 #| "The IP address of the host %1 does not match the one the certificate was " 15244 #| "issued to." 15245 msgid "" 15246 "The certificate's CA (Certificate Authority) does not match the CA name of " 15247 "the certificate." 15248 msgstr "" 15249 "Alamat IP untuk hos %1tidak padan dengan yang ada pada sijil yang telah " 15250 "dikeluarkan." 15251 15252 #: kssl/ksslcertificate.cpp:1127 15253 #, fuzzy, kde-format 15254 #| msgid "" 15255 #| "The IP address of the host %1 does not match the one the certificate was " 15256 #| "issued to." 15257 msgid "" 15258 "The CA (Certificate Authority) certificate's key ID does not match the key " 15259 "ID in the 'Issuer' section of the certificate you are trying to use." 15260 msgstr "" 15261 "Alamat IP untuk hos %1tidak padan dengan yang ada pada sijil yang telah " 15262 "dikeluarkan." 15263 15264 #: kssl/ksslcertificate.cpp:1129 15265 #, kde-format 15266 msgid "" 15267 "The CA (Certificate Authority) certificate's key ID and name do not match " 15268 "the key ID and name in the 'Issuer' section of the certificate you are " 15269 "trying to use." 15270 msgstr "" 15271 15272 #: kssl/ksslcertificate.cpp:1131 15273 #, kde-format 15274 msgid "" 15275 "The certificate's CA (Certificate Authority) is not allowed to sign " 15276 "certificates." 15277 msgstr "" 15278 15279 #: kssl/ksslcertificate.cpp:1133 15280 #, kde-format 15281 msgid "OpenSSL could not be verified." 15282 msgstr "" 15283 15284 #: kssl/ksslcertificate.cpp:1137 15285 #, kde-format 15286 msgid "" 15287 "The signature test for this certificate failed. This could mean that the " 15288 "signature of this certificate or any in its trust path are invalid, could " 15289 "not be decoded or that the CRL (Certificate Revocation List) could not be " 15290 "verified. If you see this message, please let the author of the software you " 15291 "are using know that he or she should use the new, more specific error " 15292 "messages." 15293 msgstr "" 15294 15295 #: kssl/ksslcertificate.cpp:1139 15296 #, kde-format 15297 msgid "" 15298 "This certificate, any in its trust path or its CA's (Certificate Authority) " 15299 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 15300 "valid yet or not valid any more. If you see this message, please let the " 15301 "author of the software you are using know that he or she should use the new, " 15302 "more specific error messages." 15303 msgstr "" 15304 15305 #: kssl/ksslcertificate.cpp:1145 15306 #, kde-format 15307 msgid "" 15308 "Certificate signing authority root files could not be found so the " 15309 "certificate is not verified." 15310 msgstr "" 15311 "Fail root pihak berkuasa tandatangan sijil tidak dapat ditemui, justeru " 15312 "sijil tidak disahkan." 15313 15314 #: kssl/ksslcertificate.cpp:1147 15315 #, kde-format 15316 msgid "SSL support was not found." 15317 msgstr "Sokongan SSL tidak ditemui." 15318 15319 #: kssl/ksslcertificate.cpp:1149 15320 #, kde-format 15321 msgid "Private key test failed." 15322 msgstr "Ujian kunci peribadi gagal." 15323 15324 #: kssl/ksslcertificate.cpp:1151 15325 #, kde-format 15326 msgid "The certificate has not been issued for this host." 15327 msgstr "Sijil tidak dikeluarkan untuk hos ini." 15328 15329 #: kssl/ksslcertificate.cpp:1153 15330 #, kde-format 15331 msgid "This certificate is not relevant." 15332 msgstr "Sijil tidak relevan." 15333 15334 #: kssl/ksslcertificate.cpp:1158 15335 #, kde-format 15336 msgid "The certificate is invalid." 15337 msgstr "Sijil tidak sah." 15338 15339 #: kssl/ksslutils.cpp:90 15340 #, kde-format 15341 msgid "GMT" 15342 msgstr "GMT" 15343 15344 #, fuzzy 15345 #~ msgctxt "color" 15346 #~ msgid "hot" 15347 #~ msgstr "Sel" 15348 15349 #, fuzzy 15350 #~ msgctxt "color" 15351 #~ msgid "sea" 15352 #~ msgstr "Jeda" 15353 15354 #, fuzzy 15355 #~ msgctxt "@item Calendar system" 15356 #~ msgid "Gregorian (Proleptic)" 15357 #~ msgstr "Gregorian" 15358 15359 #, fuzzy 15360 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15361 #~ msgid "of Mes" 15362 #~ msgstr "bagi Meh" 15363 15364 #, fuzzy 15365 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15366 #~ msgid "of Ter" 15367 #~ msgstr "bagi Tir" 15368 15369 #, fuzzy 15370 #~ msgctxt "Ethiopian month 1 - ShortName" 15371 #~ msgid "Mes" 15372 #~ msgstr "Ya" 15373 15374 #, fuzzy 15375 #~ msgctxt "Ethiopian month 5 - LongName" 15376 #~ msgid "Ter" 15377 #~ msgstr "Sel" 15378 15379 #, fuzzy 15380 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15381 #~ msgid "Ham" 15382 #~ msgstr "Ham" 15383 15384 #, fuzzy 15385 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15386 #~ msgid "Arb" 15387 #~ msgstr "Rab" 15388 15389 #, fuzzy 15390 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15391 #~ msgid "Rob" 15392 #~ msgstr "Tugas" 15393 15394 #, fuzzy 15395 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15396 #~ msgid "Arb" 15397 #~ msgstr "Rab" 15398 15399 #~ msgctxt "of May long" 15400 #~ msgid "of May" 15401 #~ msgstr "dari Mei" 15402 15403 #~ msgctxt "May long" 15404 #~ msgid "May" 15405 #~ msgstr "Mei" 15406 15407 #~ msgid "R. Thaani" 15408 #~ msgstr "R. Thaani" 15409 15410 #~ msgid "J. Thaani" 15411 #~ msgstr "J. Thaani" 15412 15413 #~ msgid "Hijjah" 15414 #~ msgstr "Zulhijjah" 15415 15416 #~ msgctxt "of Tir long" 15417 #~ msgid "of Tir" 15418 #~ msgstr "bagi Tir" 15419 15420 #~ msgctxt "of Dei long" 15421 #~ msgid "of Dei" 15422 #~ msgstr "bagi Dei" 15423 15424 #~ msgctxt "Tir long" 15425 #~ msgid "Tir" 15426 #~ msgstr "Tir" 15427 15428 #~ msgctxt "Dei long" 15429 #~ msgid "Dei" 15430 #~ msgstr "Dei" 15431 15432 #~ msgctxt "Shanbe short" 15433 #~ msgid "shn" 15434 #~ msgstr "shn"