Warning, /frameworks/kdelibs4support/po/mk/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Macedonian 0002 # 0003 # Copyright (C) 2000,2002,2003, 2004, 2005, 2006, 2007, 2008, 2009 Free Software Foundation, Inc. 0004 # Dimitar Indovski <dime@gord.com.mk> 0005 # Damjan Janevski <miopa@freemail.org.mk> 0006 # Dragan Sekulovski <d_sekulovski@yahoo.com> 0007 # 0008 # Maratonec , 2002. 0009 # Dragan Bocevski <d_bocevski@hotmail.com>, 2002. 0010 # Danko Ilik <danko@mindless.com>, 2002,2003. 0011 # Bozidar Proevski <bobibobi@freemail.com.mk>, 2002,2003, 2004, 2005, 2006, 2007, 2008, 2009. 0012 # Danko Ilik <danko@on.net.mk>, 2003. 0013 # Darko Nikolovski <darkon@macedonia.homelinux.org>, 2003. 0014 # Ivan Dimitrov <ivan34mk@yahoo.com>, 2003. 0015 # Magdica Shambevska <magdica@yahoo.com>, 2004. 0016 msgid "" 0017 msgstr "" 0018 "Project-Id-Version: kdelibs4\n" 0019 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0020 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0021 "PO-Revision-Date: 2009-06-15 09:15+0200\n" 0022 "Last-Translator: Bozidar Proevski <bobibobi@freemail.com.mk>\n" 0023 "Language-Team: Macedonian <mkde-l10n@lists.sourceforge.net>\n" 0024 "Language: mk\n" 0025 "MIME-Version: 1.0\n" 0026 "Content-Type: text/plain; charset=UTF-8\n" 0027 "Content-Transfer-Encoding: 8bit\n" 0028 "X-Generator: KBabel 1.11.4\n" 0029 "Plural-Forms: Plural-Forms: nplurals=3; plural=n%10==1 ? 0 : n%10==2 ? 1 : " 0030 "2;\n" 0031 0032 #, kde-format 0033 msgctxt "NAME OF TRANSLATORS" 0034 msgid "Your names" 0035 msgstr "Божидар Проевски" 0036 0037 #, kde-format 0038 msgctxt "EMAIL OF TRANSLATORS" 0039 msgid "Your emails" 0040 msgstr "bobibobi@freemail.com.mk" 0041 0042 #, kde-format 0043 msgctxt "color" 0044 msgid "AliceBlue" 0045 msgstr "Алиса-сина" 0046 0047 #, kde-format 0048 msgctxt "color" 0049 msgid "AntiqueWhite" 0050 msgstr "Античка бела" 0051 0052 #, kde-format 0053 msgctxt "color" 0054 msgid "AntiqueWhite1" 0055 msgstr "Античка бела 1" 0056 0057 #, kde-format 0058 msgctxt "color" 0059 msgid "AntiqueWhite2" 0060 msgstr "Античка бела 2" 0061 0062 #, kde-format 0063 msgctxt "color" 0064 msgid "AntiqueWhite3" 0065 msgstr "Античка бела 3" 0066 0067 #, kde-format 0068 msgctxt "color" 0069 msgid "AntiqueWhite4" 0070 msgstr "Античка бела 4" 0071 0072 #, kde-format 0073 msgctxt "color" 0074 msgid "BlanchedAlmond" 0075 msgstr "Бланширан бадем" 0076 0077 #, kde-format 0078 msgctxt "color" 0079 msgid "BlueViolet" 0080 msgstr "Сино-виолетова" 0081 0082 #, kde-format 0083 msgctxt "color" 0084 msgid "CadetBlue" 0085 msgstr "Кадетска сина" 0086 0087 #, kde-format 0088 msgctxt "color" 0089 msgid "CadetBlue1" 0090 msgstr "Кадетска сина 1" 0091 0092 #, kde-format 0093 msgctxt "color" 0094 msgid "CadetBlue2" 0095 msgstr "Кадетска сина 2" 0096 0097 #, kde-format 0098 msgctxt "color" 0099 msgid "CadetBlue3" 0100 msgstr "Кадетска сина 3" 0101 0102 #, kde-format 0103 msgctxt "color" 0104 msgid "CadetBlue4" 0105 msgstr "Кадетска сина 4" 0106 0107 #, kde-format 0108 msgctxt "color" 0109 msgid "CornflowerBlue" 0110 msgstr "Синчец-сина" 0111 0112 #, kde-format 0113 msgctxt "color" 0114 msgid "DarkBlue" 0115 msgstr "Темносина" 0116 0117 #, kde-format 0118 msgctxt "color" 0119 msgid "DarkCyan" 0120 msgstr "Темна цијан" 0121 0122 #, kde-format 0123 msgctxt "color" 0124 msgid "DarkGoldenrod" 0125 msgstr "Темна златица" 0126 0127 #, kde-format 0128 msgctxt "color" 0129 msgid "DarkGoldenrod1" 0130 msgstr "Темна златица 1" 0131 0132 #, kde-format 0133 msgctxt "color" 0134 msgid "DarkGoldenrod2" 0135 msgstr "Темна златица 2" 0136 0137 #, kde-format 0138 msgctxt "color" 0139 msgid "DarkGoldenrod3" 0140 msgstr "Темна златица 3" 0141 0142 #, kde-format 0143 msgctxt "color" 0144 msgid "DarkGoldenrod4" 0145 msgstr "Темна златица 4" 0146 0147 #, kde-format 0148 msgctxt "color" 0149 msgid "DarkGray" 0150 msgstr "Темносива" 0151 0152 #, kde-format 0153 msgctxt "color" 0154 msgid "DarkGreen" 0155 msgstr "Темнозелена" 0156 0157 #, kde-format 0158 msgctxt "color" 0159 msgid "DarkGrey" 0160 msgstr "Темносива" 0161 0162 #, kde-format 0163 msgctxt "color" 0164 msgid "DarkKhaki" 0165 msgstr "Темна каки" 0166 0167 #, kde-format 0168 msgctxt "color" 0169 msgid "DarkMagenta" 0170 msgstr "Темна магента" 0171 0172 #, kde-format 0173 msgctxt "color" 0174 msgid "DarkOliveGreen" 0175 msgstr "Темна маслинесто-зелена" 0176 0177 #, kde-format 0178 msgctxt "color" 0179 msgid "DarkOliveGreen1" 0180 msgstr "Темна маслинесто-зелена 1" 0181 0182 #, kde-format 0183 msgctxt "color" 0184 msgid "DarkOliveGreen2" 0185 msgstr "Темна маслинесто-зелена 2" 0186 0187 #, kde-format 0188 msgctxt "color" 0189 msgid "DarkOliveGreen3" 0190 msgstr "Темна маслинесто-зелена 3" 0191 0192 #, kde-format 0193 msgctxt "color" 0194 msgid "DarkOliveGreen4" 0195 msgstr "Темна маслинесто-зелена 4" 0196 0197 #, kde-format 0198 msgctxt "color" 0199 msgid "DarkOrange" 0200 msgstr "Темнопортокалова" 0201 0202 #, kde-format 0203 msgctxt "color" 0204 msgid "DarkOrange1" 0205 msgstr "Темнопортокалова 1" 0206 0207 #, kde-format 0208 msgctxt "color" 0209 msgid "DarkOrange2" 0210 msgstr "Темнопортокалова 2" 0211 0212 #, kde-format 0213 msgctxt "color" 0214 msgid "DarkOrange3" 0215 msgstr "Темнопортокалова 3" 0216 0217 #, kde-format 0218 msgctxt "color" 0219 msgid "DarkOrange4" 0220 msgstr "Темнопортокалова 4" 0221 0222 #, kde-format 0223 msgctxt "color" 0224 msgid "DarkOrchid" 0225 msgstr "Темна орхидеја" 0226 0227 #, kde-format 0228 msgctxt "color" 0229 msgid "DarkOrchid1" 0230 msgstr "Темна орхидеја 1" 0231 0232 #, kde-format 0233 msgctxt "color" 0234 msgid "DarkOrchid2" 0235 msgstr "Темна орхидеја 2" 0236 0237 #, kde-format 0238 msgctxt "color" 0239 msgid "DarkOrchid3" 0240 msgstr "Темна орхидеја 3" 0241 0242 #, kde-format 0243 msgctxt "color" 0244 msgid "DarkOrchid4" 0245 msgstr "Темна орхидеја 4" 0246 0247 #, kde-format 0248 msgctxt "color" 0249 msgid "DarkRed" 0250 msgstr "Темноцрвена" 0251 0252 #, kde-format 0253 msgctxt "color" 0254 msgid "DarkSalmon" 0255 msgstr "Темен лосос" 0256 0257 #, kde-format 0258 msgctxt "color" 0259 msgid "DarkSeaGreen" 0260 msgstr "Темна морско-зелена" 0261 0262 #, kde-format 0263 msgctxt "color" 0264 msgid "DarkSeaGreen1" 0265 msgstr "Темна морско-зелена 1" 0266 0267 #, kde-format 0268 msgctxt "color" 0269 msgid "DarkSeaGreen2" 0270 msgstr "Темна морско-зелена 2" 0271 0272 #, kde-format 0273 msgctxt "color" 0274 msgid "DarkSeaGreen3" 0275 msgstr "Темна морско-зелена 3" 0276 0277 #, kde-format 0278 msgctxt "color" 0279 msgid "DarkSeaGreen4" 0280 msgstr "Темна морско-зелена 4" 0281 0282 #, kde-format 0283 msgctxt "color" 0284 msgid "DarkSlateBlue" 0285 msgstr "Темна темносина" 0286 0287 #, kde-format 0288 msgctxt "color" 0289 msgid "DarkSlateGray" 0290 msgstr "Темна темносива" 0291 0292 #, kde-format 0293 msgctxt "color" 0294 msgid "DarkSlateGray1" 0295 msgstr "Темна темносива 1" 0296 0297 #, kde-format 0298 msgctxt "color" 0299 msgid "DarkSlateGray2" 0300 msgstr "Темна темносива 2" 0301 0302 #, kde-format 0303 msgctxt "color" 0304 msgid "DarkSlateGray3" 0305 msgstr "Темна темносива 3" 0306 0307 #, kde-format 0308 msgctxt "color" 0309 msgid "DarkSlateGray4" 0310 msgstr "Темна темносива 4" 0311 0312 #, kde-format 0313 msgctxt "color" 0314 msgid "DarkSlateGrey" 0315 msgstr "Темна темносива" 0316 0317 #, kde-format 0318 msgctxt "color" 0319 msgid "DarkTurquoise" 0320 msgstr "Темнотиркизна" 0321 0322 #, kde-format 0323 msgctxt "color" 0324 msgid "DarkViolet" 0325 msgstr "Темновиолетова" 0326 0327 #, kde-format 0328 msgctxt "color" 0329 msgid "DeepPink" 0330 msgstr "Јака розова" 0331 0332 #, kde-format 0333 msgctxt "color" 0334 msgid "DeepPink1" 0335 msgstr "Јака розова 1" 0336 0337 #, kde-format 0338 msgctxt "color" 0339 msgid "DeepPink2" 0340 msgstr "Јака розова 2" 0341 0342 #, kde-format 0343 msgctxt "color" 0344 msgid "DeepPink3" 0345 msgstr "Јака розова 3" 0346 0347 #, kde-format 0348 msgctxt "color" 0349 msgid "DeepPink4" 0350 msgstr "Јака розова 4" 0351 0352 #, kde-format 0353 msgctxt "color" 0354 msgid "DeepSkyBlue" 0355 msgstr "Јака небесносина" 0356 0357 #, kde-format 0358 msgctxt "color" 0359 msgid "DeepSkyBlue1" 0360 msgstr "Јака небесносина 1" 0361 0362 #, kde-format 0363 msgctxt "color" 0364 msgid "DeepSkyBlue2" 0365 msgstr "Јака небесносина 2" 0366 0367 #, kde-format 0368 msgctxt "color" 0369 msgid "DeepSkyBlue3" 0370 msgstr "Јака небесносина 3" 0371 0372 #, kde-format 0373 msgctxt "color" 0374 msgid "DeepSkyBlue4" 0375 msgstr "Јака небесносина 4" 0376 0377 #, kde-format 0378 msgctxt "color" 0379 msgid "DimGray" 0380 msgstr "Пригушена сива" 0381 0382 #, kde-format 0383 msgctxt "color" 0384 msgid "DimGrey" 0385 msgstr "Пригушена сива" 0386 0387 #, kde-format 0388 msgctxt "color" 0389 msgid "DodgerBlue" 0390 msgstr "" 0391 0392 #, kde-format 0393 msgctxt "color" 0394 msgid "DodgerBlue1" 0395 msgstr "" 0396 0397 #, kde-format 0398 msgctxt "color" 0399 msgid "DodgerBlue2" 0400 msgstr "" 0401 0402 #, kde-format 0403 msgctxt "color" 0404 msgid "DodgerBlue3" 0405 msgstr "" 0406 0407 #, kde-format 0408 msgctxt "color" 0409 msgid "DodgerBlue4" 0410 msgstr "" 0411 0412 #, kde-format 0413 msgctxt "color" 0414 msgid "FloralWhite" 0415 msgstr "Цветно бела" 0416 0417 #, kde-format 0418 msgctxt "color" 0419 msgid "ForestGreen" 0420 msgstr "Шумска зелена" 0421 0422 #, kde-format 0423 msgctxt "color" 0424 msgid "GhostWhite" 0425 msgstr "Бел дух" 0426 0427 #, kde-format 0428 msgctxt "color" 0429 msgid "GreenYellow" 0430 msgstr "Зелено-жолта" 0431 0432 #, kde-format 0433 msgctxt "color" 0434 msgid "HotPink" 0435 msgstr "Жешка розова" 0436 0437 #, kde-format 0438 msgctxt "color" 0439 msgid "HotPink1" 0440 msgstr "Жешка розова 1" 0441 0442 #, kde-format 0443 msgctxt "color" 0444 msgid "HotPink2" 0445 msgstr "Жешка розова 2" 0446 0447 #, kde-format 0448 msgctxt "color" 0449 msgid "HotPink3" 0450 msgstr "Жешка розова 3" 0451 0452 #, kde-format 0453 msgctxt "color" 0454 msgid "HotPink4" 0455 msgstr "Жешка розова 4" 0456 0457 #, kde-format 0458 msgctxt "color" 0459 msgid "IndianRed" 0460 msgstr "Индијанска црвена" 0461 0462 #, kde-format 0463 msgctxt "color" 0464 msgid "IndianRed1" 0465 msgstr "Индијанска црвена 1" 0466 0467 #, kde-format 0468 msgctxt "color" 0469 msgid "IndianRed2" 0470 msgstr "Индијанска црвена 2" 0471 0472 #, kde-format 0473 msgctxt "color" 0474 msgid "IndianRed3" 0475 msgstr "Индијанска црвена 3" 0476 0477 #, kde-format 0478 msgctxt "color" 0479 msgid "IndianRed4" 0480 msgstr "Индијанска црвена 4" 0481 0482 #, kde-format 0483 msgctxt "color" 0484 msgid "LavenderBlush" 0485 msgstr "Лаванда-црвенило" 0486 0487 #, kde-format 0488 msgctxt "color" 0489 msgid "LavenderBlush1" 0490 msgstr "Лаванда-црвенило 1" 0491 0492 #, kde-format 0493 msgctxt "color" 0494 msgid "LavenderBlush2" 0495 msgstr "Лаванда-црвенило 2" 0496 0497 #, kde-format 0498 msgctxt "color" 0499 msgid "LavenderBlush3" 0500 msgstr "Лаванда-црвенило 3" 0501 0502 #, kde-format 0503 msgctxt "color" 0504 msgid "LavenderBlush4" 0505 msgstr "Лаванда-црвенило 4" 0506 0507 #, kde-format 0508 msgctxt "color" 0509 msgid "LawnGreen" 0510 msgstr "Тревник-зелена" 0511 0512 #, kde-format 0513 msgctxt "color" 0514 msgid "LemonChiffon" 0515 msgstr "Лимон-шифон" 0516 0517 #, kde-format 0518 msgctxt "color" 0519 msgid "LemonChiffon1" 0520 msgstr "Лимон-шифон 1" 0521 0522 #, kde-format 0523 msgctxt "color" 0524 msgid "LemonChiffon2" 0525 msgstr "Лимон-шифон 2" 0526 0527 #, kde-format 0528 msgctxt "color" 0529 msgid "LemonChiffon3" 0530 msgstr "Лимон-шифон 3" 0531 0532 #, kde-format 0533 msgctxt "color" 0534 msgid "LemonChiffon4" 0535 msgstr "Лимон-шифон 4" 0536 0537 #, kde-format 0538 msgctxt "color" 0539 msgid "LightBlue" 0540 msgstr "Светлосина" 0541 0542 #, kde-format 0543 msgctxt "color" 0544 msgid "LightBlue1" 0545 msgstr "Светлосина 1" 0546 0547 #, kde-format 0548 msgctxt "color" 0549 msgid "LightBlue2" 0550 msgstr "Светлосина 2" 0551 0552 #, kde-format 0553 msgctxt "color" 0554 msgid "LightBlue3" 0555 msgstr "Светлосина 3" 0556 0557 #, kde-format 0558 msgctxt "color" 0559 msgid "LightBlue4" 0560 msgstr "Светлосина 4" 0561 0562 #, kde-format 0563 msgctxt "color" 0564 msgid "LightCoral" 0565 msgstr "Светол корал" 0566 0567 #, kde-format 0568 msgctxt "color" 0569 msgid "LightCyan" 0570 msgstr "Светла цијан" 0571 0572 #, kde-format 0573 msgctxt "color" 0574 msgid "LightCyan1" 0575 msgstr "Светла цијан 1" 0576 0577 #, kde-format 0578 msgctxt "color" 0579 msgid "LightCyan2" 0580 msgstr "Светла цијан 2" 0581 0582 #, kde-format 0583 msgctxt "color" 0584 msgid "LightCyan3" 0585 msgstr "Светла цијан 3" 0586 0587 #, kde-format 0588 msgctxt "color" 0589 msgid "LightCyan4" 0590 msgstr "Светла цијан 4" 0591 0592 #, kde-format 0593 msgctxt "color" 0594 msgid "LightGoldenrod" 0595 msgstr "Светла златица" 0596 0597 #, kde-format 0598 msgctxt "color" 0599 msgid "LightGoldenrod1" 0600 msgstr "Светла златица 1" 0601 0602 #, kde-format 0603 msgctxt "color" 0604 msgid "LightGoldenrod2" 0605 msgstr "Светла златица 2" 0606 0607 #, kde-format 0608 msgctxt "color" 0609 msgid "LightGoldenrod3" 0610 msgstr "Светла златица 3" 0611 0612 #, kde-format 0613 msgctxt "color" 0614 msgid "LightGoldenrod4" 0615 msgstr "Светла златица 4" 0616 0617 #, kde-format 0618 msgctxt "color" 0619 msgid "LightGoldenrodYellow" 0620 msgstr "Светложолта златица" 0621 0622 #, kde-format 0623 msgctxt "color" 0624 msgid "LightGray" 0625 msgstr "Светлосива" 0626 0627 #, kde-format 0628 msgctxt "color" 0629 msgid "LightGreen" 0630 msgstr "Светлозелена" 0631 0632 #, kde-format 0633 msgctxt "color" 0634 msgid "LightGrey" 0635 msgstr "Светлосива" 0636 0637 #, kde-format 0638 msgctxt "color" 0639 msgid "LightPink" 0640 msgstr "Светлорозова" 0641 0642 #, kde-format 0643 msgctxt "color" 0644 msgid "LightPink1" 0645 msgstr "Светлорозова 1" 0646 0647 #, kde-format 0648 msgctxt "color" 0649 msgid "LightPink2" 0650 msgstr "Светлорозова 2" 0651 0652 #, kde-format 0653 msgctxt "color" 0654 msgid "LightPink3" 0655 msgstr "Светлорозова 3" 0656 0657 #, kde-format 0658 msgctxt "color" 0659 msgid "LightPink4" 0660 msgstr "Светлорозова 4" 0661 0662 #, kde-format 0663 msgctxt "color" 0664 msgid "LightSalmon" 0665 msgstr "Светла лосос" 0666 0667 #, kde-format 0668 msgctxt "color" 0669 msgid "LightSalmon1" 0670 msgstr "Светла лосос 1" 0671 0672 #, kde-format 0673 msgctxt "color" 0674 msgid "LightSalmon2" 0675 msgstr "Светла лосос 2" 0676 0677 #, kde-format 0678 msgctxt "color" 0679 msgid "LightSalmon3" 0680 msgstr "Светла лосос 3" 0681 0682 #, kde-format 0683 msgctxt "color" 0684 msgid "LightSalmon4" 0685 msgstr "Светла лосос 4" 0686 0687 #, kde-format 0688 msgctxt "color" 0689 msgid "LightSeaGreen" 0690 msgstr "Светла морско-зелена" 0691 0692 #, kde-format 0693 msgctxt "color" 0694 msgid "LightSkyBlue" 0695 msgstr "Светла небесносина" 0696 0697 #, kde-format 0698 msgctxt "color" 0699 msgid "LightSkyBlue1" 0700 msgstr "Светла небесносина 1" 0701 0702 #, kde-format 0703 msgctxt "color" 0704 msgid "LightSkyBlue2" 0705 msgstr "Светла небесносина 2" 0706 0707 #, kde-format 0708 msgctxt "color" 0709 msgid "LightSkyBlue3" 0710 msgstr "Светла небесносина 3" 0711 0712 #, kde-format 0713 msgctxt "color" 0714 msgid "LightSkyBlue4" 0715 msgstr "Светла небесносина 4" 0716 0717 #, kde-format 0718 msgctxt "color" 0719 msgid "LightSlateBlue" 0720 msgstr "Светла темносина" 0721 0722 #, kde-format 0723 msgctxt "color" 0724 msgid "LightSlateGray" 0725 msgstr "Светла темносива" 0726 0727 #, kde-format 0728 msgctxt "color" 0729 msgid "LightSlateGrey" 0730 msgstr "Светла темносива" 0731 0732 #, kde-format 0733 msgctxt "color" 0734 msgid "LightSteelBlue" 0735 msgstr "Светла челично сина" 0736 0737 #, kde-format 0738 msgctxt "color" 0739 msgid "LightSteelBlue1" 0740 msgstr "Светла челично сина 1" 0741 0742 #, kde-format 0743 msgctxt "color" 0744 msgid "LightSteelBlue2" 0745 msgstr "Светла челично сина 2" 0746 0747 #, kde-format 0748 msgctxt "color" 0749 msgid "LightSteelBlue3" 0750 msgstr "Светла челично сина 3" 0751 0752 #, kde-format 0753 msgctxt "color" 0754 msgid "LightSteelBlue4" 0755 msgstr "Светла челично сина 4" 0756 0757 #, kde-format 0758 msgctxt "color" 0759 msgid "LightYellow" 0760 msgstr "Светложолта" 0761 0762 #, kde-format 0763 msgctxt "color" 0764 msgid "LightYellow1" 0765 msgstr "Светложолта 1" 0766 0767 #, kde-format 0768 msgctxt "color" 0769 msgid "LightYellow2" 0770 msgstr "Светложолта 2" 0771 0772 #, kde-format 0773 msgctxt "color" 0774 msgid "LightYellow3" 0775 msgstr "Светложолта 3" 0776 0777 #, kde-format 0778 msgctxt "color" 0779 msgid "LightYellow4" 0780 msgstr "Светложолта 4" 0781 0782 #, kde-format 0783 msgctxt "color" 0784 msgid "LimeGreen" 0785 msgstr "Лимон-зелена" 0786 0787 #, kde-format 0788 msgctxt "color" 0789 msgid "MediumAquamarine" 0790 msgstr "Средна аквамарин" 0791 0792 #, kde-format 0793 msgctxt "color" 0794 msgid "MediumBlue" 0795 msgstr "Средна сина" 0796 0797 #, kde-format 0798 msgctxt "color" 0799 msgid "MediumOrchid" 0800 msgstr "Средна орхидеја" 0801 0802 #, kde-format 0803 msgctxt "color" 0804 msgid "MediumOrchid1" 0805 msgstr "Средна орхидеја 1" 0806 0807 #, kde-format 0808 msgctxt "color" 0809 msgid "MediumOrchid2" 0810 msgstr "Средна орхидеја 2" 0811 0812 #, kde-format 0813 msgctxt "color" 0814 msgid "MediumOrchid3" 0815 msgstr "Средна орхидеја 3" 0816 0817 #, kde-format 0818 msgctxt "color" 0819 msgid "MediumOrchid4" 0820 msgstr "Средна орхидеја 4" 0821 0822 #, kde-format 0823 msgctxt "color" 0824 msgid "MediumPurple" 0825 msgstr "Средна пурпурна" 0826 0827 #, kde-format 0828 msgctxt "color" 0829 msgid "MediumPurple1" 0830 msgstr "Средна пурпурна 1" 0831 0832 #, kde-format 0833 msgctxt "color" 0834 msgid "MediumPurple2" 0835 msgstr "Средна пурпурна 2" 0836 0837 #, kde-format 0838 msgctxt "color" 0839 msgid "MediumPurple3" 0840 msgstr "Средна пурпурна 3" 0841 0842 #, kde-format 0843 msgctxt "color" 0844 msgid "MediumPurple4" 0845 msgstr "Средна пурпурна 4" 0846 0847 #, kde-format 0848 msgctxt "color" 0849 msgid "MediumSeaGreen" 0850 msgstr "Средна морско-зелена" 0851 0852 #, kde-format 0853 msgctxt "color" 0854 msgid "MediumSlateBlue" 0855 msgstr "Средна темносина" 0856 0857 #, kde-format 0858 msgctxt "color" 0859 msgid "MediumSpringGreen" 0860 msgstr "Средна пролетно-зелена" 0861 0862 #, kde-format 0863 msgctxt "color" 0864 msgid "MediumTurquoise" 0865 msgstr "Средна тиркизна" 0866 0867 #, kde-format 0868 msgctxt "color" 0869 msgid "MediumVioletRed" 0870 msgstr "Средна виолетово-црвена" 0871 0872 #, kde-format 0873 msgctxt "color" 0874 msgid "MidnightBlue" 0875 msgstr "Полноќно-сина" 0876 0877 #, kde-format 0878 msgctxt "color" 0879 msgid "MintCream" 0880 msgstr "Ментол-крем" 0881 0882 #, kde-format 0883 msgctxt "color" 0884 msgid "MistyRose" 0885 msgstr "Замаглена роза" 0886 0887 #, kde-format 0888 msgctxt "color" 0889 msgid "MistyRose1" 0890 msgstr "Замаглена роза 1" 0891 0892 #, kde-format 0893 msgctxt "color" 0894 msgid "MistyRose2" 0895 msgstr "Замаглена роза 2" 0896 0897 #, kde-format 0898 msgctxt "color" 0899 msgid "MistyRose3" 0900 msgstr "Замаглена роза 3" 0901 0902 #, kde-format 0903 msgctxt "color" 0904 msgid "MistyRose4" 0905 msgstr "Замаглена роза 4" 0906 0907 #, kde-format 0908 msgctxt "color" 0909 msgid "NavajoWhite" 0910 msgstr "Навахо-бела" 0911 0912 #, kde-format 0913 msgctxt "color" 0914 msgid "NavajoWhite1" 0915 msgstr "Навахо-бела 1" 0916 0917 #, kde-format 0918 msgctxt "color" 0919 msgid "NavajoWhite2" 0920 msgstr "Навахо-бела 2" 0921 0922 #, kde-format 0923 msgctxt "color" 0924 msgid "NavajoWhite3" 0925 msgstr "Навахо-бела 3" 0926 0927 #, kde-format 0928 msgctxt "color" 0929 msgid "NavajoWhite4" 0930 msgstr "Навахо-бела 4" 0931 0932 #, kde-format 0933 msgctxt "color" 0934 msgid "NavyBlue" 0935 msgstr "Маринско-сина" 0936 0937 #, kde-format 0938 msgctxt "color" 0939 msgid "OldLace" 0940 msgstr "Стара тантела" 0941 0942 #, kde-format 0943 msgctxt "color" 0944 msgid "OliveDrab" 0945 msgstr "Маслинесто-сива" 0946 0947 #, kde-format 0948 msgctxt "color" 0949 msgid "OliveDrab1" 0950 msgstr "Маслинесто-сива 1" 0951 0952 #, kde-format 0953 msgctxt "color" 0954 msgid "OliveDrab2" 0955 msgstr "Маслинесто-сива 2" 0956 0957 #, kde-format 0958 msgctxt "color" 0959 msgid "OliveDrab3" 0960 msgstr "Маслинесто-сива 3" 0961 0962 #, kde-format 0963 msgctxt "color" 0964 msgid "OliveDrab4" 0965 msgstr "Маслинесто-сива 4" 0966 0967 #, kde-format 0968 msgctxt "color" 0969 msgid "OrangeRed" 0970 msgstr "Портокалово-црвена" 0971 0972 #, kde-format 0973 msgctxt "color" 0974 msgid "OrangeRed1" 0975 msgstr "Портокалово-црвена 1" 0976 0977 #, kde-format 0978 msgctxt "color" 0979 msgid "OrangeRed2" 0980 msgstr "Портокалово-црвена 2" 0981 0982 #, kde-format 0983 msgctxt "color" 0984 msgid "OrangeRed3" 0985 msgstr "Портокалово-црвена 3" 0986 0987 #, kde-format 0988 msgctxt "color" 0989 msgid "OrangeRed4" 0990 msgstr "Портокалово-црвена 4" 0991 0992 #, kde-format 0993 msgctxt "color" 0994 msgid "PaleGoldenrod" 0995 msgstr "Бледа златица" 0996 0997 #, kde-format 0998 msgctxt "color" 0999 msgid "PaleGreen" 1000 msgstr "Бледозелена" 1001 1002 #, kde-format 1003 msgctxt "color" 1004 msgid "PaleGreen1" 1005 msgstr "Бледозелена 1" 1006 1007 #, kde-format 1008 msgctxt "color" 1009 msgid "PaleGreen2" 1010 msgstr "Бледозелена 2" 1011 1012 #, kde-format 1013 msgctxt "color" 1014 msgid "PaleGreen3" 1015 msgstr "Бледозелена 3" 1016 1017 #, kde-format 1018 msgctxt "color" 1019 msgid "PaleGreen4" 1020 msgstr "Бледозелена 4" 1021 1022 #, kde-format 1023 msgctxt "color" 1024 msgid "PaleTurquoise" 1025 msgstr "Бледотиркизна" 1026 1027 #, kde-format 1028 msgctxt "color" 1029 msgid "PaleTurquoise1" 1030 msgstr "Бледотиркизна 1" 1031 1032 #, kde-format 1033 msgctxt "color" 1034 msgid "PaleTurquoise2" 1035 msgstr "Бледотиркизна 2" 1036 1037 #, kde-format 1038 msgctxt "color" 1039 msgid "PaleTurquoise3" 1040 msgstr "Бледотиркизна 3" 1041 1042 #, kde-format 1043 msgctxt "color" 1044 msgid "PaleTurquoise4" 1045 msgstr "Бледотиркизна 4" 1046 1047 #, kde-format 1048 msgctxt "color" 1049 msgid "PaleVioletRed" 1050 msgstr "Бледа виолетово-црвена" 1051 1052 #, kde-format 1053 msgctxt "color" 1054 msgid "PaleVioletRed1" 1055 msgstr "Бледа виолетово-црвена 1" 1056 1057 #, kde-format 1058 msgctxt "color" 1059 msgid "PaleVioletRed2" 1060 msgstr "Бледа виолетово-црвена 2" 1061 1062 #, kde-format 1063 msgctxt "color" 1064 msgid "PaleVioletRed3" 1065 msgstr "Бледа виолетово-црвена 3" 1066 1067 #, kde-format 1068 msgctxt "color" 1069 msgid "PaleVioletRed4" 1070 msgstr "Бледа виолетово-црвена 4" 1071 1072 #, kde-format 1073 msgctxt "color" 1074 msgid "PapayaWhip" 1075 msgstr "Папаја-крем" 1076 1077 #, kde-format 1078 msgctxt "color" 1079 msgid "PeachPuff" 1080 msgstr "Бледа праска" 1081 1082 #, kde-format 1083 msgctxt "color" 1084 msgid "PeachPuff1" 1085 msgstr "Бледа праска 1" 1086 1087 #, kde-format 1088 msgctxt "color" 1089 msgid "PeachPuff2" 1090 msgstr "Бледа праска 2" 1091 1092 #, kde-format 1093 msgctxt "color" 1094 msgid "PeachPuff3" 1095 msgstr "Бледа праска 3" 1096 1097 #, kde-format 1098 msgctxt "color" 1099 msgid "PeachPuff4" 1100 msgstr "Бледа праска 4" 1101 1102 #, kde-format 1103 msgctxt "color" 1104 msgid "PowderBlue" 1105 msgstr "Прашкаста сина" 1106 1107 #, kde-format 1108 msgctxt "color" 1109 msgid "RosyBrown" 1110 msgstr "Розово-кафеава" 1111 1112 #, kde-format 1113 msgctxt "color" 1114 msgid "RosyBrown1" 1115 msgstr "Розово-кафеава 1" 1116 1117 #, kde-format 1118 msgctxt "color" 1119 msgid "RosyBrown2" 1120 msgstr "Розово-кафеава 2" 1121 1122 #, kde-format 1123 msgctxt "color" 1124 msgid "RosyBrown3" 1125 msgstr "Розово-кафеава 3" 1126 1127 #, kde-format 1128 msgctxt "color" 1129 msgid "RosyBrown4" 1130 msgstr "Розово-кафеава 4" 1131 1132 #, kde-format 1133 msgctxt "color" 1134 msgid "RoyalBlue" 1135 msgstr "Кралска сина" 1136 1137 #, kde-format 1138 msgctxt "color" 1139 msgid "RoyalBlue1" 1140 msgstr "Кралска сина 1" 1141 1142 #, kde-format 1143 msgctxt "color" 1144 msgid "RoyalBlue2" 1145 msgstr "Кралска сина 2" 1146 1147 #, kde-format 1148 msgctxt "color" 1149 msgid "RoyalBlue3" 1150 msgstr "Кралска сина 3" 1151 1152 #, kde-format 1153 msgctxt "color" 1154 msgid "RoyalBlue4" 1155 msgstr "Кралска сина 4" 1156 1157 #, kde-format 1158 msgctxt "color" 1159 msgid "SaddleBrown" 1160 msgstr "Седло-кафеава" 1161 1162 #, kde-format 1163 msgctxt "color" 1164 msgid "SandyBrown" 1165 msgstr "Песочно-кафеава" 1166 1167 #, kde-format 1168 msgctxt "color" 1169 msgid "SeaGreen" 1170 msgstr "Морска зелена" 1171 1172 #, kde-format 1173 msgctxt "color" 1174 msgid "SeaGreen1" 1175 msgstr "Морска зелена 1" 1176 1177 #, kde-format 1178 msgctxt "color" 1179 msgid "SeaGreen2" 1180 msgstr "Морска зелена 2" 1181 1182 #, kde-format 1183 msgctxt "color" 1184 msgid "SeaGreen3" 1185 msgstr "Морска зелена 3" 1186 1187 #, kde-format 1188 msgctxt "color" 1189 msgid "SeaGreen4" 1190 msgstr "Морска зелена 4" 1191 1192 #, kde-format 1193 msgctxt "color" 1194 msgid "SkyBlue" 1195 msgstr "Небесносина" 1196 1197 #, kde-format 1198 msgctxt "color" 1199 msgid "SkyBlue1" 1200 msgstr "Небесносина 1" 1201 1202 #, kde-format 1203 msgctxt "color" 1204 msgid "SkyBlue2" 1205 msgstr "Небесносина 2" 1206 1207 #, kde-format 1208 msgctxt "color" 1209 msgid "SkyBlue3" 1210 msgstr "Небесносина 3" 1211 1212 #, kde-format 1213 msgctxt "color" 1214 msgid "SkyBlue4" 1215 msgstr "Небесносина 4" 1216 1217 #, kde-format 1218 msgctxt "color" 1219 msgid "SlateBlue" 1220 msgstr "Темносина" 1221 1222 #, kde-format 1223 msgctxt "color" 1224 msgid "SlateBlue1" 1225 msgstr "Темносина 1" 1226 1227 #, kde-format 1228 msgctxt "color" 1229 msgid "SlateBlue2" 1230 msgstr "Темносина 2" 1231 1232 #, kde-format 1233 msgctxt "color" 1234 msgid "SlateBlue3" 1235 msgstr "Темносина 3" 1236 1237 #, kde-format 1238 msgctxt "color" 1239 msgid "SlateBlue4" 1240 msgstr "Темносина 4" 1241 1242 #, kde-format 1243 msgctxt "color" 1244 msgid "SlateGray" 1245 msgstr "Темносива" 1246 1247 #, kde-format 1248 msgctxt "color" 1249 msgid "SlateGray1" 1250 msgstr "Темносива 1" 1251 1252 #, kde-format 1253 msgctxt "color" 1254 msgid "SlateGray2" 1255 msgstr "Темносива 2" 1256 1257 #, kde-format 1258 msgctxt "color" 1259 msgid "SlateGray3" 1260 msgstr "Темносива 3" 1261 1262 #, kde-format 1263 msgctxt "color" 1264 msgid "SlateGray4" 1265 msgstr "Темносива 4" 1266 1267 #, kde-format 1268 msgctxt "color" 1269 msgid "SlateGrey" 1270 msgstr "Темносива" 1271 1272 #, kde-format 1273 msgctxt "color" 1274 msgid "SpringGreen" 1275 msgstr "Пролетно-зелена" 1276 1277 #, kde-format 1278 msgctxt "color" 1279 msgid "SpringGreen1" 1280 msgstr "Пролетно-зелена 1" 1281 1282 #, kde-format 1283 msgctxt "color" 1284 msgid "SpringGreen2" 1285 msgstr "Пролетно-зелена 2" 1286 1287 #, kde-format 1288 msgctxt "color" 1289 msgid "SpringGreen3" 1290 msgstr "Пролетно-зелена 3" 1291 1292 #, kde-format 1293 msgctxt "color" 1294 msgid "SpringGreen4" 1295 msgstr "Пролетно-зелена 4" 1296 1297 #, kde-format 1298 msgctxt "color" 1299 msgid "SteelBlue" 1300 msgstr "Челично сина" 1301 1302 #, kde-format 1303 msgctxt "color" 1304 msgid "SteelBlue1" 1305 msgstr "Челично сина 1" 1306 1307 #, kde-format 1308 msgctxt "color" 1309 msgid "SteelBlue2" 1310 msgstr "Челично сина 2" 1311 1312 #, kde-format 1313 msgctxt "color" 1314 msgid "SteelBlue3" 1315 msgstr "Челично сина 3" 1316 1317 #, kde-format 1318 msgctxt "color" 1319 msgid "SteelBlue4" 1320 msgstr "Челично сина 4" 1321 1322 #, kde-format 1323 msgctxt "color" 1324 msgid "VioletRed" 1325 msgstr "Виолетово-црвена" 1326 1327 #, kde-format 1328 msgctxt "color" 1329 msgid "VioletRed1" 1330 msgstr "Виолетово-црвена 1" 1331 1332 #, kde-format 1333 msgctxt "color" 1334 msgid "VioletRed2" 1335 msgstr "Виолетово-црвена 2" 1336 1337 #, kde-format 1338 msgctxt "color" 1339 msgid "VioletRed3" 1340 msgstr "Виолетово-црвена 3" 1341 1342 #, kde-format 1343 msgctxt "color" 1344 msgid "VioletRed4" 1345 msgstr "Виолетово-црвена 4" 1346 1347 #, kde-format 1348 msgctxt "color" 1349 msgid "WhiteSmoke" 1350 msgstr "Бел чад" 1351 1352 #, kde-format 1353 msgctxt "color" 1354 msgid "YellowGreen" 1355 msgstr "Жолто-зелена" 1356 1357 #, kde-format 1358 msgctxt "color" 1359 msgid "aquamarine" 1360 msgstr "аквамарин" 1361 1362 #, kde-format 1363 msgctxt "color" 1364 msgid "aquamarine1" 1365 msgstr "аквамарин 1" 1366 1367 #, kde-format 1368 msgctxt "color" 1369 msgid "aquamarine2" 1370 msgstr "аквамарин 2" 1371 1372 #, kde-format 1373 msgctxt "color" 1374 msgid "aquamarine3" 1375 msgstr "аквамарин 3" 1376 1377 #, kde-format 1378 msgctxt "color" 1379 msgid "aquamarine4" 1380 msgstr "аквамарин 4" 1381 1382 #, kde-format 1383 msgctxt "color" 1384 msgid "azure" 1385 msgstr "азурна" 1386 1387 #, kde-format 1388 msgctxt "color" 1389 msgid "azure1" 1390 msgstr "азурна 1" 1391 1392 #, kde-format 1393 msgctxt "color" 1394 msgid "azure2" 1395 msgstr "азурна 2" 1396 1397 #, kde-format 1398 msgctxt "color" 1399 msgid "azure3" 1400 msgstr "азурна 3" 1401 1402 #, kde-format 1403 msgctxt "color" 1404 msgid "azure4" 1405 msgstr "азурна 4" 1406 1407 #, kde-format 1408 msgctxt "color" 1409 msgid "beige" 1410 msgstr "беж" 1411 1412 #, kde-format 1413 msgctxt "color" 1414 msgid "bisque" 1415 msgstr "порцелан" 1416 1417 #, kde-format 1418 msgctxt "color" 1419 msgid "bisque1" 1420 msgstr "порцелан 1" 1421 1422 #, kde-format 1423 msgctxt "color" 1424 msgid "bisque2" 1425 msgstr "порцелан 2" 1426 1427 #, kde-format 1428 msgctxt "color" 1429 msgid "bisque3" 1430 msgstr "порцелан 3" 1431 1432 #, kde-format 1433 msgctxt "color" 1434 msgid "bisque4" 1435 msgstr "порцелан 4" 1436 1437 #, kde-format 1438 msgctxt "color" 1439 msgid "black" 1440 msgstr "црна" 1441 1442 #, kde-format 1443 msgctxt "color" 1444 msgid "blue" 1445 msgstr "сина" 1446 1447 #, kde-format 1448 msgctxt "color" 1449 msgid "blue1" 1450 msgstr "сина 1" 1451 1452 #, kde-format 1453 msgctxt "color" 1454 msgid "blue2" 1455 msgstr "сина 2" 1456 1457 #, kde-format 1458 msgctxt "color" 1459 msgid "blue3" 1460 msgstr "сина 3" 1461 1462 #, kde-format 1463 msgctxt "color" 1464 msgid "blue4" 1465 msgstr "сина 4" 1466 1467 #, kde-format 1468 msgctxt "color" 1469 msgid "brown" 1470 msgstr "кафеава" 1471 1472 #, kde-format 1473 msgctxt "color" 1474 msgid "brown1" 1475 msgstr "кафеава 1" 1476 1477 #, kde-format 1478 msgctxt "color" 1479 msgid "brown2" 1480 msgstr "кафеава 2" 1481 1482 #, kde-format 1483 msgctxt "color" 1484 msgid "brown3" 1485 msgstr "кафеава 3" 1486 1487 #, kde-format 1488 msgctxt "color" 1489 msgid "brown4" 1490 msgstr "кафеава 4" 1491 1492 #, kde-format 1493 msgctxt "color" 1494 msgid "burlywood" 1495 msgstr "" 1496 1497 #, kde-format 1498 msgctxt "color" 1499 msgid "burlywood1" 1500 msgstr "" 1501 1502 #, kde-format 1503 msgctxt "color" 1504 msgid "burlywood2" 1505 msgstr "" 1506 1507 #, kde-format 1508 msgctxt "color" 1509 msgid "burlywood3" 1510 msgstr "" 1511 1512 #, kde-format 1513 msgctxt "color" 1514 msgid "burlywood4" 1515 msgstr "" 1516 1517 #, kde-format 1518 msgctxt "color" 1519 msgid "chartreuse" 1520 msgstr "шартруз-зелена" 1521 1522 #, kde-format 1523 msgctxt "color" 1524 msgid "chartreuse1" 1525 msgstr "шартруз-зелена 1" 1526 1527 #, kde-format 1528 msgctxt "color" 1529 msgid "chartreuse2" 1530 msgstr "шартруз-зелена 2" 1531 1532 #, kde-format 1533 msgctxt "color" 1534 msgid "chartreuse3" 1535 msgstr "шартруз-зелена 3" 1536 1537 #, kde-format 1538 msgctxt "color" 1539 msgid "chartreuse4" 1540 msgstr "шартруз-зелена 4" 1541 1542 #, kde-format 1543 msgctxt "color" 1544 msgid "chocolate" 1545 msgstr "чоколадна" 1546 1547 #, kde-format 1548 msgctxt "color" 1549 msgid "chocolate1" 1550 msgstr "чоколадна 1" 1551 1552 #, kde-format 1553 msgctxt "color" 1554 msgid "chocolate2" 1555 msgstr "чоколадна 2" 1556 1557 #, kde-format 1558 msgctxt "color" 1559 msgid "chocolate3" 1560 msgstr "чоколадна 3" 1561 1562 #, kde-format 1563 msgctxt "color" 1564 msgid "chocolate4" 1565 msgstr "чоколадна 4" 1566 1567 #, kde-format 1568 msgctxt "color" 1569 msgid "coral" 1570 msgstr "корална" 1571 1572 #, kde-format 1573 msgctxt "color" 1574 msgid "coral1" 1575 msgstr "корална 1" 1576 1577 #, kde-format 1578 msgctxt "color" 1579 msgid "coral2" 1580 msgstr "корална 2" 1581 1582 #, kde-format 1583 msgctxt "color" 1584 msgid "coral3" 1585 msgstr "корална 3" 1586 1587 #, kde-format 1588 msgctxt "color" 1589 msgid "coral4" 1590 msgstr "корална 4" 1591 1592 #, kde-format 1593 msgctxt "color" 1594 msgid "cornsilk" 1595 msgstr "" 1596 1597 #, kde-format 1598 msgctxt "color" 1599 msgid "cornsilk1" 1600 msgstr "" 1601 1602 #, kde-format 1603 msgctxt "color" 1604 msgid "cornsilk2" 1605 msgstr "" 1606 1607 #, kde-format 1608 msgctxt "color" 1609 msgid "cornsilk3" 1610 msgstr "" 1611 1612 #, kde-format 1613 msgctxt "color" 1614 msgid "cornsilk4" 1615 msgstr "" 1616 1617 #, kde-format 1618 msgctxt "color" 1619 msgid "cyan" 1620 msgstr "цијан" 1621 1622 #, kde-format 1623 msgctxt "color" 1624 msgid "cyan1" 1625 msgstr "цијан 1" 1626 1627 #, kde-format 1628 msgctxt "color" 1629 msgid "cyan2" 1630 msgstr "цијан 2" 1631 1632 #, kde-format 1633 msgctxt "color" 1634 msgid "cyan3" 1635 msgstr "цијан 3" 1636 1637 #, kde-format 1638 msgctxt "color" 1639 msgid "cyan4" 1640 msgstr "цијан 4" 1641 1642 #, kde-format 1643 msgctxt "color" 1644 msgid "firebrick" 1645 msgstr "огноотпорна тула" 1646 1647 #, kde-format 1648 msgctxt "color" 1649 msgid "firebrick1" 1650 msgstr "огноотпорна тула 1" 1651 1652 #, kde-format 1653 msgctxt "color" 1654 msgid "firebrick2" 1655 msgstr "огноотпорна тула 2" 1656 1657 #, kde-format 1658 msgctxt "color" 1659 msgid "firebrick3" 1660 msgstr "огноотпорна тула 3" 1661 1662 #, kde-format 1663 msgctxt "color" 1664 msgid "firebrick4" 1665 msgstr "огноотпорна тула 4" 1666 1667 #, kde-format 1668 msgctxt "color" 1669 msgid "gainsboro" 1670 msgstr "" 1671 1672 #, kde-format 1673 msgctxt "color" 1674 msgid "gold" 1675 msgstr "златна" 1676 1677 #, kde-format 1678 msgctxt "color" 1679 msgid "gold1" 1680 msgstr "златна 1" 1681 1682 #, kde-format 1683 msgctxt "color" 1684 msgid "gold2" 1685 msgstr "златна 2" 1686 1687 #, kde-format 1688 msgctxt "color" 1689 msgid "gold3" 1690 msgstr "златна 3" 1691 1692 #, kde-format 1693 msgctxt "color" 1694 msgid "gold4" 1695 msgstr "златна 4" 1696 1697 #, kde-format 1698 msgctxt "color" 1699 msgid "goldenrod" 1700 msgstr "златица" 1701 1702 #, kde-format 1703 msgctxt "color" 1704 msgid "goldenrod1" 1705 msgstr "златица 1" 1706 1707 #, kde-format 1708 msgctxt "color" 1709 msgid "goldenrod2" 1710 msgstr "златица 2" 1711 1712 #, kde-format 1713 msgctxt "color" 1714 msgid "goldenrod3" 1715 msgstr "златица 3" 1716 1717 #, kde-format 1718 msgctxt "color" 1719 msgid "goldenrod4" 1720 msgstr "златица 4" 1721 1722 #, kde-format 1723 msgctxt "color" 1724 msgid "green" 1725 msgstr "зелена" 1726 1727 #, kde-format 1728 msgctxt "color" 1729 msgid "green1" 1730 msgstr "зелена 1" 1731 1732 #, kde-format 1733 msgctxt "color" 1734 msgid "green2" 1735 msgstr "зелена 2" 1736 1737 #, kde-format 1738 msgctxt "color" 1739 msgid "green3" 1740 msgstr "зелена 3" 1741 1742 #, kde-format 1743 msgctxt "color" 1744 msgid "green4" 1745 msgstr "зелена 4" 1746 1747 #, kde-format 1748 msgctxt "color" 1749 msgid "honeydew" 1750 msgstr "медовина" 1751 1752 #, kde-format 1753 msgctxt "color" 1754 msgid "honeydew1" 1755 msgstr "медовина 1" 1756 1757 #, kde-format 1758 msgctxt "color" 1759 msgid "honeydew2" 1760 msgstr "медовина 2" 1761 1762 #, kde-format 1763 msgctxt "color" 1764 msgid "honeydew3" 1765 msgstr "медовина 3" 1766 1767 #, kde-format 1768 msgctxt "color" 1769 msgid "honeydew4" 1770 msgstr "медовина 4" 1771 1772 #, kde-format 1773 msgctxt "color" 1774 msgid "ivory" 1775 msgstr "слонова коска" 1776 1777 #, kde-format 1778 msgctxt "color" 1779 msgid "ivory1" 1780 msgstr "слонова коска 1" 1781 1782 #, kde-format 1783 msgctxt "color" 1784 msgid "ivory2" 1785 msgstr "слонова коска 2" 1786 1787 #, kde-format 1788 msgctxt "color" 1789 msgid "ivory3" 1790 msgstr "слонова коска 3" 1791 1792 #, kde-format 1793 msgctxt "color" 1794 msgid "ivory4" 1795 msgstr "слонова коска 4" 1796 1797 #, kde-format 1798 msgctxt "color" 1799 msgid "khaki" 1800 msgstr "каки" 1801 1802 #, kde-format 1803 msgctxt "color" 1804 msgid "khaki1" 1805 msgstr "каки 1" 1806 1807 #, kde-format 1808 msgctxt "color" 1809 msgid "khaki2" 1810 msgstr "каки 2" 1811 1812 #, kde-format 1813 msgctxt "color" 1814 msgid "khaki3" 1815 msgstr "каки 3" 1816 1817 #, kde-format 1818 msgctxt "color" 1819 msgid "khaki4" 1820 msgstr "каки 4" 1821 1822 #, kde-format 1823 msgctxt "color" 1824 msgid "lavender" 1825 msgstr "лаванда" 1826 1827 #, kde-format 1828 msgctxt "color" 1829 msgid "linen" 1830 msgstr "лен" 1831 1832 #, kde-format 1833 msgctxt "color" 1834 msgid "magenta" 1835 msgstr "магента" 1836 1837 #, kde-format 1838 msgctxt "color" 1839 msgid "magenta1" 1840 msgstr "магента 1" 1841 1842 #, kde-format 1843 msgctxt "color" 1844 msgid "magenta2" 1845 msgstr "магента 2" 1846 1847 #, kde-format 1848 msgctxt "color" 1849 msgid "magenta3" 1850 msgstr "магента 3" 1851 1852 #, kde-format 1853 msgctxt "color" 1854 msgid "magenta4" 1855 msgstr "магента 4" 1856 1857 #, kde-format 1858 msgctxt "color" 1859 msgid "maroon" 1860 msgstr "костенлива" 1861 1862 #, kde-format 1863 msgctxt "color" 1864 msgid "maroon1" 1865 msgstr "костенлива 1" 1866 1867 #, kde-format 1868 msgctxt "color" 1869 msgid "maroon2" 1870 msgstr "костенлива 2" 1871 1872 #, kde-format 1873 msgctxt "color" 1874 msgid "maroon3" 1875 msgstr "костенлива 3" 1876 1877 #, kde-format 1878 msgctxt "color" 1879 msgid "maroon4" 1880 msgstr "костенлива 4" 1881 1882 #, kde-format 1883 msgctxt "color" 1884 msgid "moccasin" 1885 msgstr "мокасина" 1886 1887 #, kde-format 1888 msgctxt "color" 1889 msgid "navy" 1890 msgstr "морнаричка" 1891 1892 #, kde-format 1893 msgctxt "color" 1894 msgid "orange" 1895 msgstr "портокалова" 1896 1897 #, kde-format 1898 msgctxt "color" 1899 msgid "orange1" 1900 msgstr "портокалова 1" 1901 1902 #, kde-format 1903 msgctxt "color" 1904 msgid "orange2" 1905 msgstr "портокалова 2" 1906 1907 #, kde-format 1908 msgctxt "color" 1909 msgid "orange3" 1910 msgstr "портокалова 3" 1911 1912 #, kde-format 1913 msgctxt "color" 1914 msgid "orange4" 1915 msgstr "портокалова 4" 1916 1917 #, kde-format 1918 msgctxt "color" 1919 msgid "orchid" 1920 msgstr "орхидеја" 1921 1922 #, kde-format 1923 msgctxt "color" 1924 msgid "orchid1" 1925 msgstr "орхидеја 1" 1926 1927 #, kde-format 1928 msgctxt "color" 1929 msgid "orchid2" 1930 msgstr "орхидеја 2" 1931 1932 #, kde-format 1933 msgctxt "color" 1934 msgid "orchid3" 1935 msgstr "орхидеја 3" 1936 1937 #, kde-format 1938 msgctxt "color" 1939 msgid "orchid4" 1940 msgstr "орхидеја 4" 1941 1942 #, kde-format 1943 msgctxt "color" 1944 msgid "peru" 1945 msgstr "перу" 1946 1947 #, kde-format 1948 msgctxt "color" 1949 msgid "pink" 1950 msgstr "розова" 1951 1952 #, kde-format 1953 msgctxt "color" 1954 msgid "pink1" 1955 msgstr "розова 1" 1956 1957 #, kde-format 1958 msgctxt "color" 1959 msgid "pink2" 1960 msgstr "розова 2" 1961 1962 #, kde-format 1963 msgctxt "color" 1964 msgid "pink3" 1965 msgstr "розова 3" 1966 1967 #, kde-format 1968 msgctxt "color" 1969 msgid "pink4" 1970 msgstr "розова 4" 1971 1972 #, kde-format 1973 msgctxt "color" 1974 msgid "plum" 1975 msgstr "слива" 1976 1977 #, kde-format 1978 msgctxt "color" 1979 msgid "plum1" 1980 msgstr "слива 1" 1981 1982 #, kde-format 1983 msgctxt "color" 1984 msgid "plum2" 1985 msgstr "слива 2" 1986 1987 #, kde-format 1988 msgctxt "color" 1989 msgid "plum3" 1990 msgstr "слива 3" 1991 1992 #, kde-format 1993 msgctxt "color" 1994 msgid "plum4" 1995 msgstr "слива 4" 1996 1997 #, kde-format 1998 msgctxt "color" 1999 msgid "purple" 2000 msgstr "пурпурна" 2001 2002 #, kde-format 2003 msgctxt "color" 2004 msgid "purple1" 2005 msgstr "пурпурна 1" 2006 2007 #, kde-format 2008 msgctxt "color" 2009 msgid "purple2" 2010 msgstr "пурпурна 2" 2011 2012 #, kde-format 2013 msgctxt "color" 2014 msgid "purple3" 2015 msgstr "пурпурна 3" 2016 2017 #, kde-format 2018 msgctxt "color" 2019 msgid "purple4" 2020 msgstr "пурпурна 4" 2021 2022 #, fuzzy, kde-format 2023 msgctxt "color" 2024 msgid "red" 2025 msgstr "сре" 2026 2027 #, kde-format 2028 msgctxt "color" 2029 msgid "red1" 2030 msgstr "црвена 1" 2031 2032 #, kde-format 2033 msgctxt "color" 2034 msgid "red2" 2035 msgstr "црвена 2" 2036 2037 #, kde-format 2038 msgctxt "color" 2039 msgid "red3" 2040 msgstr "црвена 3" 2041 2042 #, kde-format 2043 msgctxt "color" 2044 msgid "red4" 2045 msgstr "црвена 4" 2046 2047 #, kde-format 2048 msgctxt "color" 2049 msgid "salmon" 2050 msgstr "лосос" 2051 2052 #, kde-format 2053 msgctxt "color" 2054 msgid "salmon1" 2055 msgstr "лосос 1" 2056 2057 #, kde-format 2058 msgctxt "color" 2059 msgid "salmon2" 2060 msgstr "лосос 2" 2061 2062 #, kde-format 2063 msgctxt "color" 2064 msgid "salmon3" 2065 msgstr "лосос 3" 2066 2067 #, kde-format 2068 msgctxt "color" 2069 msgid "salmon4" 2070 msgstr "лосос 4" 2071 2072 #, kde-format 2073 msgctxt "color" 2074 msgid "seashell" 2075 msgstr "морска школка" 2076 2077 #, kde-format 2078 msgctxt "color" 2079 msgid "seashell1" 2080 msgstr "морска школка 1" 2081 2082 #, kde-format 2083 msgctxt "color" 2084 msgid "seashell2" 2085 msgstr "морска школка 2" 2086 2087 #, kde-format 2088 msgctxt "color" 2089 msgid "seashell3" 2090 msgstr "морска школка 3" 2091 2092 #, kde-format 2093 msgctxt "color" 2094 msgid "seashell4" 2095 msgstr "морска школка 4" 2096 2097 #, kde-format 2098 msgctxt "color" 2099 msgid "sienna" 2100 msgstr "сиена" 2101 2102 #, kde-format 2103 msgctxt "color" 2104 msgid "sienna1" 2105 msgstr "сиена 1" 2106 2107 #, kde-format 2108 msgctxt "color" 2109 msgid "sienna2" 2110 msgstr "сиена 2" 2111 2112 #, kde-format 2113 msgctxt "color" 2114 msgid "sienna3" 2115 msgstr "сиена 3" 2116 2117 #, kde-format 2118 msgctxt "color" 2119 msgid "sienna4" 2120 msgstr "сиена 4" 2121 2122 #, kde-format 2123 msgctxt "color" 2124 msgid "snow" 2125 msgstr "снежна" 2126 2127 #, kde-format 2128 msgctxt "color" 2129 msgid "snow1" 2130 msgstr "снежна 1" 2131 2132 #, kde-format 2133 msgctxt "color" 2134 msgid "snow2" 2135 msgstr "снежна 2" 2136 2137 #, kde-format 2138 msgctxt "color" 2139 msgid "snow3" 2140 msgstr "снежна 3" 2141 2142 #, kde-format 2143 msgctxt "color" 2144 msgid "snow4" 2145 msgstr "снежна 4" 2146 2147 #, fuzzy, kde-format 2148 msgctxt "color" 2149 msgid "tan" 2150 msgstr "јан" 2151 2152 #, kde-format 2153 msgctxt "color" 2154 msgid "tan1" 2155 msgstr "тен 1" 2156 2157 #, kde-format 2158 msgctxt "color" 2159 msgid "tan2" 2160 msgstr "тен 2" 2161 2162 #, kde-format 2163 msgctxt "color" 2164 msgid "tan3" 2165 msgstr "тен 3" 2166 2167 #, kde-format 2168 msgctxt "color" 2169 msgid "tan4" 2170 msgstr "тен 4" 2171 2172 #, kde-format 2173 msgctxt "color" 2174 msgid "thistle" 2175 msgstr "црн трн" 2176 2177 #, kde-format 2178 msgctxt "color" 2179 msgid "thistle1" 2180 msgstr "црн трн 1" 2181 2182 #, kde-format 2183 msgctxt "color" 2184 msgid "thistle2" 2185 msgstr "црн трн 2" 2186 2187 #, kde-format 2188 msgctxt "color" 2189 msgid "thistle3" 2190 msgstr "црн трн 3" 2191 2192 #, kde-format 2193 msgctxt "color" 2194 msgid "thistle4" 2195 msgstr "црн трн 4" 2196 2197 #, kde-format 2198 msgctxt "color" 2199 msgid "tomato" 2200 msgstr "домат" 2201 2202 #, kde-format 2203 msgctxt "color" 2204 msgid "tomato1" 2205 msgstr "домат 1" 2206 2207 #, kde-format 2208 msgctxt "color" 2209 msgid "tomato2" 2210 msgstr "домат 2" 2211 2212 #, kde-format 2213 msgctxt "color" 2214 msgid "tomato3" 2215 msgstr "домат 3" 2216 2217 #, kde-format 2218 msgctxt "color" 2219 msgid "tomato4" 2220 msgstr "домат 4" 2221 2222 #, kde-format 2223 msgctxt "color" 2224 msgid "turquoise" 2225 msgstr "тиркизна" 2226 2227 #, kde-format 2228 msgctxt "color" 2229 msgid "turquoise1" 2230 msgstr "тиркизна 1" 2231 2232 #, kde-format 2233 msgctxt "color" 2234 msgid "turquoise2" 2235 msgstr "тиркизна 2" 2236 2237 #, kde-format 2238 msgctxt "color" 2239 msgid "turquoise3" 2240 msgstr "тиркизна 3" 2241 2242 #, kde-format 2243 msgctxt "color" 2244 msgid "turquoise4" 2245 msgstr "тиркизна 4" 2246 2247 #, kde-format 2248 msgctxt "color" 2249 msgid "violet" 2250 msgstr "виолетова" 2251 2252 #, kde-format 2253 msgctxt "color" 2254 msgid "wheat" 2255 msgstr "жито" 2256 2257 #, kde-format 2258 msgctxt "color" 2259 msgid "wheat1" 2260 msgstr "жито 1" 2261 2262 #, kde-format 2263 msgctxt "color" 2264 msgid "wheat2" 2265 msgstr "жито 2" 2266 2267 #, kde-format 2268 msgctxt "color" 2269 msgid "wheat3" 2270 msgstr "жито 3" 2271 2272 #, kde-format 2273 msgctxt "color" 2274 msgid "wheat4" 2275 msgstr "жито 4" 2276 2277 #, kde-format 2278 msgctxt "color" 2279 msgid "white" 2280 msgstr "бела" 2281 2282 #, kde-format 2283 msgctxt "color" 2284 msgid "yellow" 2285 msgstr "жолта" 2286 2287 #, kde-format 2288 msgctxt "color" 2289 msgid "yellow1" 2290 msgstr "жолта 1" 2291 2292 #, kde-format 2293 msgctxt "color" 2294 msgid "yellow2" 2295 msgstr "жолта 2" 2296 2297 #, kde-format 2298 msgctxt "color" 2299 msgid "yellow3" 2300 msgstr "жолта 3" 2301 2302 #, kde-format 2303 msgctxt "color" 2304 msgid "yellow4" 2305 msgstr "жолта 4" 2306 2307 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2308 #, kde-format 2309 msgid "Debug Settings" 2310 msgstr "Поставувања за чистење од бубачки" 2311 2312 #: kdebugdialog/kdebugdialog.cpp:59 2313 #, kde-format 2314 msgid "File" 2315 msgstr "Датотека" 2316 2317 #: kdebugdialog/kdebugdialog.cpp:60 2318 #, kde-format 2319 msgid "Message Box" 2320 msgstr "Порака" 2321 2322 #: kdebugdialog/kdebugdialog.cpp:61 2323 #, kde-format 2324 msgid "Shell" 2325 msgstr "Школка" 2326 2327 #: kdebugdialog/kdebugdialog.cpp:62 2328 #, kde-format 2329 msgid "Syslog" 2330 msgstr "Системски дневник" 2331 2332 #: kdebugdialog/kdebugdialog.cpp:63 2333 #, kde-format 2334 msgid "None" 2335 msgstr "Нема" 2336 2337 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2338 #: kdebugdialog/kdebugdialog.ui:48 2339 #, kde-format 2340 msgid "Information" 2341 msgstr "Информација" 2342 2343 #. i18n: ectx: property (text), widget (QLabel, label_2) 2344 #. i18n: ectx: property (text), widget (QLabel, label_8) 2345 #. i18n: ectx: property (text), widget (QLabel, label_4) 2346 #. i18n: ectx: property (text), widget (QLabel, label_6) 2347 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2348 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2349 #, kde-format 2350 msgid "Output to:" 2351 msgstr "Излез во:" 2352 2353 #. i18n: ectx: property (text), widget (QLabel, label_3) 2354 #. i18n: ectx: property (text), widget (QLabel, label_9) 2355 #. i18n: ectx: property (text), widget (QLabel, label_5) 2356 #. i18n: ectx: property (text), widget (QLabel, label_7) 2357 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2358 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2359 #, kde-format 2360 msgid "Filename:" 2361 msgstr "Име на датотека:" 2362 2363 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2364 #: kdebugdialog/kdebugdialog.ui:83 2365 #, kde-format 2366 msgid "Error" 2367 msgstr "Грешка" 2368 2369 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2370 #: kdebugdialog/kdebugdialog.ui:118 2371 #, kde-format 2372 msgid "Abort on fatal errors" 2373 msgstr "Прекини при фатални грешки" 2374 2375 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2376 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2377 #, kde-format 2378 msgid "Disable all debug output" 2379 msgstr "" 2380 2381 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2382 #: kdebugdialog/kdebugdialog.ui:145 2383 #, kde-format 2384 msgid "Warning" 2385 msgstr "Внимание" 2386 2387 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2388 #: kdebugdialog/kdebugdialog.ui:180 2389 #, kde-format 2390 msgid "Fatal Error" 2391 msgstr "Фатална грешка" 2392 2393 #: kdebugdialog/klistdebugdialog.cpp:69 2394 #, kde-format 2395 msgid "&Select All" 2396 msgstr "&Избери ги сите" 2397 2398 #: kdebugdialog/klistdebugdialog.cpp:70 2399 #, kde-format 2400 msgid "&Deselect All" 2401 msgstr "О&дизбери ги сите" 2402 2403 #: kdebugdialog/main.cpp:100 2404 #, kde-format 2405 msgid "KDebugDialog" 2406 msgstr "KDebugDialog" 2407 2408 #: kdebugdialog/main.cpp:101 2409 #, kde-format 2410 msgid "A dialog box for setting preferences for debug output" 2411 msgstr "" 2412 "Дијалог за поставување на својствата на излезот од чистењето од бубачки" 2413 2414 #: kdebugdialog/main.cpp:102 2415 #, fuzzy, kde-format 2416 #| msgid "Copyright 1999-2000, David Faure <email>faure@kde.org</email>" 2417 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2418 msgstr "Авторски права 1999-2000, David Faure <email>faure@kde.org</email>" 2419 2420 #: kdebugdialog/main.cpp:103 2421 #, kde-format 2422 msgid "David Faure" 2423 msgstr "David Faure" 2424 2425 #: kdebugdialog/main.cpp:103 2426 #, kde-format 2427 msgid "Maintainer" 2428 msgstr "Одржувач" 2429 2430 #: kdebugdialog/main.cpp:108 2431 #, kde-format 2432 msgid "Show the fully-fledged dialog instead of the default list dialog" 2433 msgstr "Прикажи го комплетниот дијалог, наместо стандардниот дијалог со листа" 2434 2435 #: kdebugdialog/main.cpp:109 2436 #, kde-format 2437 msgid "Turn area on" 2438 msgstr "Вклучи област" 2439 2440 #: kdebugdialog/main.cpp:110 2441 #, kde-format 2442 msgid "Turn area off" 2443 msgstr "Исклучи област" 2444 2445 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2446 #, kde-format 2447 msgid "no error" 2448 msgstr "нема грешка" 2449 2450 #: kdecore/k3resolver.cpp:534 2451 #, kde-format 2452 msgid "requested family not supported for this host name" 2453 msgstr "бараната фамилија не е поддржана за компјутерот со ова име" 2454 2455 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2456 #, kde-format 2457 msgid "temporary failure in name resolution" 2458 msgstr "привремен неуспех при разрешување на име" 2459 2460 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2461 #, kde-format 2462 msgid "non-recoverable failure in name resolution" 2463 msgstr "неповратен неуспех при разрешување на име" 2464 2465 #: kdecore/k3resolver.cpp:537 2466 #, kde-format 2467 msgid "invalid flags" 2468 msgstr "невалидни знаменца" 2469 2470 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2471 #, kde-format 2472 msgid "memory allocation failure" 2473 msgstr "неуспех при доделување меморија" 2474 2475 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2476 #, kde-format 2477 msgid "name or service not known" 2478 msgstr "непознато име или сервис" 2479 2480 #: kdecore/k3resolver.cpp:540 2481 #, kde-format 2482 msgid "requested family not supported" 2483 msgstr "бараната фамилија не е поддржана" 2484 2485 #: kdecore/k3resolver.cpp:541 2486 #, kde-format 2487 msgid "requested service not supported for this socket type" 2488 msgstr "бараниот сервис не е поддржан за овој тип socket" 2489 2490 #: kdecore/k3resolver.cpp:542 2491 #, kde-format 2492 msgid "requested socket type not supported" 2493 msgstr "бараниот тип socket не е поддржан" 2494 2495 #: kdecore/k3resolver.cpp:543 2496 #, kde-format 2497 msgid "unknown error" 2498 msgstr "непозната грешка" 2499 2500 #: kdecore/k3resolver.cpp:545 2501 #, kde-format 2502 msgctxt "1: the i18n'ed system error code, from errno" 2503 msgid "system error: %1" 2504 msgstr "системска грешка: %1" 2505 2506 #: kdecore/k3resolver.cpp:556 2507 #, kde-format 2508 msgid "request was canceled" 2509 msgstr "барањето беше откажано" 2510 2511 #: kdecore/k3socketaddress.cpp:631 2512 #, kde-format 2513 msgctxt "1: the unknown socket address family number" 2514 msgid "Unknown family %1" 2515 msgstr "Непозната фамилија %1" 2516 2517 #: kdecore/k3socketbase.cpp:215 2518 #, kde-format 2519 msgctxt "Socket error code NoError" 2520 msgid "no error" 2521 msgstr "нема грешка" 2522 2523 #: kdecore/k3socketbase.cpp:220 2524 #, kde-format 2525 msgctxt "Socket error code LookupFailure" 2526 msgid "name lookup has failed" 2527 msgstr "барањето име не успеа" 2528 2529 #: kdecore/k3socketbase.cpp:225 2530 #, kde-format 2531 msgctxt "Socket error code AddressInUse" 2532 msgid "address already in use" 2533 msgstr "адресата веќе се користи" 2534 2535 #: kdecore/k3socketbase.cpp:230 2536 #, kde-format 2537 msgctxt "Socket error code AlreadyBound" 2538 msgid "socket is already bound" 2539 msgstr "приклучникот е веќе врзан" 2540 2541 #: kdecore/k3socketbase.cpp:235 2542 #, kde-format 2543 msgctxt "Socket error code AlreadyCreated" 2544 msgid "socket is already created" 2545 msgstr "socket е веќе создаден" 2546 2547 #: kdecore/k3socketbase.cpp:240 2548 #, kde-format 2549 msgctxt "Socket error code NotBound" 2550 msgid "socket is not bound" 2551 msgstr "приклучникот не е врзан" 2552 2553 #: kdecore/k3socketbase.cpp:245 2554 #, kde-format 2555 msgctxt "Socket error code NotCreated" 2556 msgid "socket has not been created" 2557 msgstr "socket не е создаден" 2558 2559 #: kdecore/k3socketbase.cpp:250 2560 #, kde-format 2561 msgctxt "Socket error code WouldBlock" 2562 msgid "operation would block" 2563 msgstr "операцијата ќе блокира" 2564 2565 #: kdecore/k3socketbase.cpp:255 2566 #, kde-format 2567 msgctxt "Socket error code ConnectionRefused" 2568 msgid "connection actively refused" 2569 msgstr "поврзувањето е активно одбиено" 2570 2571 #: kdecore/k3socketbase.cpp:260 2572 #, kde-format 2573 msgctxt "Socket error code ConnectionTimedOut" 2574 msgid "connection timed out" 2575 msgstr "поврзувањето го пречекори времето" 2576 2577 #: kdecore/k3socketbase.cpp:265 2578 #, kde-format 2579 msgctxt "Socket error code InProgress" 2580 msgid "operation is already in progress" 2581 msgstr "операцијата веќе напредува" 2582 2583 #: kdecore/k3socketbase.cpp:270 2584 #, kde-format 2585 msgctxt "Socket error code NetFailure" 2586 msgid "network failure occurred" 2587 msgstr "се случи пад на мрежата" 2588 2589 #: kdecore/k3socketbase.cpp:275 2590 #, kde-format 2591 msgctxt "Socket error code NotSupported" 2592 msgid "operation is not supported" 2593 msgstr "операцијата не е поддржана" 2594 2595 #: kdecore/k3socketbase.cpp:280 2596 #, kde-format 2597 msgctxt "Socket error code Timeout" 2598 msgid "timed operation timed out" 2599 msgstr "временската операција го пречекори даденото време" 2600 2601 #: kdecore/k3socketbase.cpp:285 2602 #, kde-format 2603 msgctxt "Socket error code UnknownError" 2604 msgid "an unknown/unexpected error has happened" 2605 msgstr "се случи непозната/неочекувана грешка" 2606 2607 #: kdecore/k3socketbase.cpp:290 2608 #, kde-format 2609 msgctxt "Socket error code RemotelyDisconnected" 2610 msgid "remote host closed connection" 2611 msgstr "Оддалечениот компјутер ја затвори врската" 2612 2613 #: kdecore/k4aboutdata.cpp:267 2614 #, kde-format 2615 msgid "" 2616 "No licensing terms for this program have been specified.\n" 2617 "Please check the documentation or the source for any\n" 2618 "licensing terms.\n" 2619 msgstr "" 2620 2621 #: kdecore/k4aboutdata.cpp:273 2622 #, kde-format 2623 msgid "This program is distributed under the terms of the %1." 2624 msgstr "" 2625 2626 #: kdecore/k4aboutdata.cpp:297 2627 #, kde-format 2628 msgctxt "@item license (short name)" 2629 msgid "GPL v2" 2630 msgstr "GPL v2" 2631 2632 #: kdecore/k4aboutdata.cpp:298 2633 #, kde-format 2634 msgctxt "@item license" 2635 msgid "GNU General Public License Version 2" 2636 msgstr "" 2637 2638 #: kdecore/k4aboutdata.cpp:301 2639 #, kde-format 2640 msgctxt "@item license (short name)" 2641 msgid "LGPL v2" 2642 msgstr "LGPL v2" 2643 2644 #: kdecore/k4aboutdata.cpp:302 2645 #, kde-format 2646 msgctxt "@item license" 2647 msgid "GNU Lesser General Public License Version 2" 2648 msgstr "" 2649 2650 #: kdecore/k4aboutdata.cpp:305 2651 #, kde-format 2652 msgctxt "@item license (short name)" 2653 msgid "BSD License" 2654 msgstr "Лиценцата BSD" 2655 2656 #: kdecore/k4aboutdata.cpp:306 2657 #, kde-format 2658 msgctxt "@item license" 2659 msgid "BSD License" 2660 msgstr "Лиценцата BSD" 2661 2662 #: kdecore/k4aboutdata.cpp:309 2663 #, kde-format 2664 msgctxt "@item license (short name)" 2665 msgid "Artistic License" 2666 msgstr "Лиценцата Artistic" 2667 2668 #: kdecore/k4aboutdata.cpp:310 2669 #, kde-format 2670 msgctxt "@item license" 2671 msgid "Artistic License" 2672 msgstr "Лиценцата Artistic" 2673 2674 #: kdecore/k4aboutdata.cpp:313 2675 #, kde-format 2676 msgctxt "@item license (short name)" 2677 msgid "QPL v1.0" 2678 msgstr "QPL v1.0" 2679 2680 #: kdecore/k4aboutdata.cpp:314 2681 #, kde-format 2682 msgctxt "@item license" 2683 msgid "Q Public License" 2684 msgstr "Лиценцата Q Public License" 2685 2686 #: kdecore/k4aboutdata.cpp:317 2687 #, kde-format 2688 msgctxt "@item license (short name)" 2689 msgid "GPL v3" 2690 msgstr "GPL v3" 2691 2692 #: kdecore/k4aboutdata.cpp:318 2693 #, kde-format 2694 msgctxt "@item license" 2695 msgid "GNU General Public License Version 3" 2696 msgstr "" 2697 2698 #: kdecore/k4aboutdata.cpp:321 2699 #, kde-format 2700 msgctxt "@item license (short name)" 2701 msgid "LGPL v3" 2702 msgstr "LGPL v3" 2703 2704 #: kdecore/k4aboutdata.cpp:322 2705 #, kde-format 2706 msgctxt "@item license" 2707 msgid "GNU Lesser General Public License Version 3" 2708 msgstr "" 2709 2710 #: kdecore/k4aboutdata.cpp:326 2711 #, kde-format 2712 msgctxt "@item license" 2713 msgid "Custom" 2714 msgstr "Сопствено" 2715 2716 #: kdecore/k4aboutdata.cpp:329 2717 #, kde-format 2718 msgctxt "@item license" 2719 msgid "Not specified" 2720 msgstr "Не е зададено" 2721 2722 #: kdecore/k4aboutdata.cpp:891 2723 #, kde-format 2724 msgctxt "replace this with information about your translation team" 2725 msgid "" 2726 "<p>KDE is translated into many languages thanks to the work of the " 2727 "translation teams all over the world.</p><p>For more information on KDE " 2728 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2729 "org</a></p>" 2730 msgstr "" 2731 "<p>KDE е преведен на повеќе светски јазици благодарение на работата на " 2732 "повеќе преведувачки тимови низ целиот свет.</p><p>За повеќе информации " 2733 "посетете ја Интернет-страницата http://i18n.kde.org</p><p>Информации за " 2734 "нашата работа може да добиете на страницата http://mkde.sourceforge.net</p>" 2735 2736 #: kdecore/kcalendarsystem.cpp:108 2737 #, kde-format 2738 msgctxt "@item Calendar system" 2739 msgid "Gregorian" 2740 msgstr "Грегоријански" 2741 2742 #: kdecore/kcalendarsystem.cpp:110 2743 #, fuzzy, kde-format 2744 msgctxt "@item Calendar system" 2745 msgid "Coptic" 2746 msgstr "Коптски" 2747 2748 #: kdecore/kcalendarsystem.cpp:112 2749 #, fuzzy, kde-format 2750 msgctxt "@item Calendar system" 2751 msgid "Ethiopian" 2752 msgstr "Етиопски" 2753 2754 #: kdecore/kcalendarsystem.cpp:114 2755 #, kde-format 2756 msgctxt "@item Calendar system" 2757 msgid "Hebrew" 2758 msgstr "Еврејски" 2759 2760 #: kdecore/kcalendarsystem.cpp:116 2761 #, kde-format 2762 msgctxt "@item Calendar system" 2763 msgid "Islamic / Hijri (Civil)" 2764 msgstr "" 2765 2766 #: kdecore/kcalendarsystem.cpp:118 2767 #, kde-format 2768 msgctxt "@item Calendar system" 2769 msgid "Indian National" 2770 msgstr "" 2771 2772 #: kdecore/kcalendarsystem.cpp:120 2773 #, kde-format 2774 msgctxt "@item Calendar system" 2775 msgid "Jalali" 2776 msgstr "Џалали" 2777 2778 #: kdecore/kcalendarsystem.cpp:122 2779 #, kde-format 2780 msgctxt "@item Calendar system" 2781 msgid "Japanese" 2782 msgstr "" 2783 2784 #: kdecore/kcalendarsystem.cpp:124 2785 #, fuzzy, kde-format 2786 msgctxt "@item Calendar system" 2787 msgid "Julian" 2788 msgstr "јан" 2789 2790 #: kdecore/kcalendarsystem.cpp:126 2791 #, kde-format 2792 msgctxt "@item Calendar system" 2793 msgid "Taiwanese" 2794 msgstr "" 2795 2796 #: kdecore/kcalendarsystem.cpp:128 2797 #, fuzzy, kde-format 2798 #| msgid "R. Thaani" 2799 msgctxt "@item Calendar system" 2800 msgid "Thai" 2801 msgstr "R. Thaani" 2802 2803 #: kdecore/kcalendarsystem.cpp:131 2804 #, kde-format 2805 msgctxt "@item Calendar system" 2806 msgid "Invalid Calendar Type" 2807 msgstr "Невалиден тип на календар" 2808 2809 #: kdecore/kcalendarsystem.cpp:1495 2810 #, kde-format 2811 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2812 msgid "-" 2813 msgstr "" 2814 2815 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2816 #: kio/kfilemetadataprovider.cpp:199 2817 #, kde-format 2818 msgid "Today" 2819 msgstr "Денес" 2820 2821 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2822 #: kio/kfilemetadataprovider.cpp:202 2823 #, kde-format 2824 msgid "Yesterday" 2825 msgstr "Вчера" 2826 2827 #: kdecore/kcalendarsystemcoptic.cpp:45 2828 #, kde-format 2829 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2830 msgid "Anno Martyrum" 2831 msgstr "" 2832 2833 #: kdecore/kcalendarsystemcoptic.cpp:46 2834 #, kde-format 2835 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2836 msgid "AM" 2837 msgstr "" 2838 2839 #: kdecore/kcalendarsystemcoptic.cpp:47 2840 #, kde-format 2841 msgctxt "" 2842 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2843 msgid "%Ey %EC" 2844 msgstr "" 2845 2846 #: kdecore/kcalendarsystemcoptic.cpp:153 2847 #, kde-format 2848 msgctxt "Coptic month 1 - KLocale::NarrowName" 2849 msgid "T" 2850 msgstr "" 2851 2852 #: kdecore/kcalendarsystemcoptic.cpp:155 2853 #, kde-format 2854 msgctxt "Coptic month 2 - KLocale::NarrowName" 2855 msgid "P" 2856 msgstr "" 2857 2858 #: kdecore/kcalendarsystemcoptic.cpp:157 2859 #, kde-format 2860 msgctxt "Coptic month 3 - KLocale::NarrowName" 2861 msgid "H" 2862 msgstr "" 2863 2864 #: kdecore/kcalendarsystemcoptic.cpp:159 2865 #, kde-format 2866 msgctxt "Coptic month 4 - KLocale::NarrowName" 2867 msgid "K" 2868 msgstr "" 2869 2870 #: kdecore/kcalendarsystemcoptic.cpp:161 2871 #, kde-format 2872 msgctxt "Coptic month 5 - KLocale::NarrowName" 2873 msgid "T" 2874 msgstr "" 2875 2876 #: kdecore/kcalendarsystemcoptic.cpp:163 2877 #, kde-format 2878 msgctxt "Coptic month 6 - KLocale::NarrowName" 2879 msgid "M" 2880 msgstr "" 2881 2882 #: kdecore/kcalendarsystemcoptic.cpp:165 2883 #, kde-format 2884 msgctxt "Coptic month 7 - KLocale::NarrowName" 2885 msgid "P" 2886 msgstr "" 2887 2888 #: kdecore/kcalendarsystemcoptic.cpp:167 2889 #, kde-format 2890 msgctxt "Coptic month 8 - KLocale::NarrowName" 2891 msgid "P" 2892 msgstr "" 2893 2894 #: kdecore/kcalendarsystemcoptic.cpp:169 2895 #, kde-format 2896 msgctxt "Coptic month 9 - KLocale::NarrowName" 2897 msgid "P" 2898 msgstr "" 2899 2900 #: kdecore/kcalendarsystemcoptic.cpp:171 2901 #, kde-format 2902 msgctxt "Coptic month 10 - KLocale::NarrowName" 2903 msgid "P" 2904 msgstr "" 2905 2906 #: kdecore/kcalendarsystemcoptic.cpp:173 2907 #, kde-format 2908 msgctxt "Coptic month 11 - KLocale::NarrowName" 2909 msgid "E" 2910 msgstr "" 2911 2912 #: kdecore/kcalendarsystemcoptic.cpp:175 2913 #, kde-format 2914 msgctxt "Coptic month 12 - KLocale::NarrowName" 2915 msgid "M" 2916 msgstr "" 2917 2918 #: kdecore/kcalendarsystemcoptic.cpp:177 2919 #, kde-format 2920 msgctxt "Coptic month 13 - KLocale::NarrowName" 2921 msgid "K" 2922 msgstr "" 2923 2924 #: kdecore/kcalendarsystemcoptic.cpp:186 2925 #, fuzzy, kde-format 2926 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2927 msgid "of Tho" 2928 msgstr "од Kho" 2929 2930 #: kdecore/kcalendarsystemcoptic.cpp:188 2931 #, fuzzy, kde-format 2932 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2933 msgid "of Pao" 2934 msgstr "од Tamuz" 2935 2936 #: kdecore/kcalendarsystemcoptic.cpp:190 2937 #, fuzzy, kde-format 2938 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2939 msgid "of Hat" 2940 msgstr "од Shvat" 2941 2942 #: kdecore/kcalendarsystemcoptic.cpp:192 2943 #, fuzzy, kde-format 2944 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2945 msgid "of Kia" 2946 msgstr "од Nisan" 2947 2948 #: kdecore/kcalendarsystemcoptic.cpp:194 2949 #, fuzzy, kde-format 2950 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2951 msgid "of Tob" 2952 msgstr "од фев" 2953 2954 #: kdecore/kcalendarsystemcoptic.cpp:196 2955 #, fuzzy, kde-format 2956 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2957 msgid "of Mes" 2958 msgstr "од Meh" 2959 2960 #: kdecore/kcalendarsystemcoptic.cpp:198 2961 #, fuzzy, kde-format 2962 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2963 msgid "of Par" 2964 msgstr "од мар" 2965 2966 #: kdecore/kcalendarsystemcoptic.cpp:200 2967 #, fuzzy, kde-format 2968 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2969 msgid "of Pam" 2970 msgstr "од Tamuz" 2971 2972 #: kdecore/kcalendarsystemcoptic.cpp:202 2973 #, fuzzy, kde-format 2974 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2975 msgid "of Pas" 2976 msgstr "од Bah" 2977 2978 #: kdecore/kcalendarsystemcoptic.cpp:204 2979 #, fuzzy, kde-format 2980 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2981 msgid "of Pan" 2982 msgstr "од јан" 2983 2984 #: kdecore/kcalendarsystemcoptic.cpp:206 2985 #, fuzzy, kde-format 2986 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2987 msgid "of Epe" 2988 msgstr "од фев" 2989 2990 #: kdecore/kcalendarsystemcoptic.cpp:208 2991 #, fuzzy, kde-format 2992 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2993 msgid "of Meo" 2994 msgstr "од Mor" 2995 2996 #: kdecore/kcalendarsystemcoptic.cpp:210 2997 #, fuzzy, kde-format 2998 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 2999 msgid "of Kou" 3000 msgstr "од Kho" 3001 3002 #: kdecore/kcalendarsystemcoptic.cpp:219 3003 #, fuzzy, kde-format 3004 msgctxt "Coptic month 1 - KLocale::ShortName" 3005 msgid "Tho" 3006 msgstr "Thl" 3007 3008 #: kdecore/kcalendarsystemcoptic.cpp:221 3009 #, fuzzy, kde-format 3010 msgctxt "Coptic month 2 - KLocale::ShortName" 3011 msgid "Pao" 3012 msgstr "Пауза" 3013 3014 #: kdecore/kcalendarsystemcoptic.cpp:223 3015 #, fuzzy, kde-format 3016 msgctxt "Coptic month 3 - KLocale::ShortName" 3017 msgid "Hat" 3018 msgstr "саб" 3019 3020 #: kdecore/kcalendarsystemcoptic.cpp:225 3021 #, fuzzy, kde-format 3022 msgctxt "Coptic month 4 - KLocale::ShortName" 3023 msgid "Kia" 3024 msgstr "Kha" 3025 3026 #: kdecore/kcalendarsystemcoptic.cpp:227 3027 #, fuzzy, kde-format 3028 msgctxt "Coptic month 5 - KLocale::ShortName" 3029 msgid "Tob" 3030 msgstr "Задача" 3031 3032 #: kdecore/kcalendarsystemcoptic.cpp:229 3033 #, fuzzy, kde-format 3034 msgctxt "Coptic month 6 - KLocale::ShortName" 3035 msgid "Mes" 3036 msgstr "Да" 3037 3038 #: kdecore/kcalendarsystemcoptic.cpp:231 3039 #, fuzzy, kde-format 3040 msgctxt "Coptic month 7 - KLocale::ShortName" 3041 msgid "Par" 3042 msgstr "мар" 3043 3044 #: kdecore/kcalendarsystemcoptic.cpp:233 3045 #, fuzzy, kde-format 3046 msgctxt "Coptic month 8 - KLocale::ShortName" 3047 msgid "Pam" 3048 msgstr "am" 3049 3050 #: kdecore/kcalendarsystemcoptic.cpp:235 3051 #, fuzzy, kde-format 3052 msgctxt "Coptic month 9 - KLocale::ShortName" 3053 msgid "Pas" 3054 msgstr "Страници" 3055 3056 #: kdecore/kcalendarsystemcoptic.cpp:237 3057 #, fuzzy, kde-format 3058 msgctxt "Coptic month 10 - KLocale::ShortName" 3059 msgid "Pan" 3060 msgstr "јан" 3061 3062 #: kdecore/kcalendarsystemcoptic.cpp:239 3063 #, fuzzy, kde-format 3064 msgctxt "Coptic month 11 - KLocale::ShortName" 3065 msgid "Epe" 3066 msgstr "Escape" 3067 3068 #: kdecore/kcalendarsystemcoptic.cpp:241 3069 #, fuzzy, kde-format 3070 msgctxt "Coptic month 12 - KLocale::ShortName" 3071 msgid "Meo" 3072 msgstr "пон" 3073 3074 #: kdecore/kcalendarsystemcoptic.cpp:243 3075 #, fuzzy, kde-format 3076 msgctxt "Coptic month 12 - KLocale::ShortName" 3077 msgid "Kou" 3078 msgstr "Kho" 3079 3080 #: kdecore/kcalendarsystemcoptic.cpp:252 3081 #, fuzzy, kde-format 3082 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3083 msgid "of Thoout" 3084 msgstr "од Kho" 3085 3086 #: kdecore/kcalendarsystemcoptic.cpp:254 3087 #, fuzzy, kde-format 3088 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3089 msgid "of Paope" 3090 msgstr "од Tamuz" 3091 3092 #: kdecore/kcalendarsystemcoptic.cpp:256 3093 #, fuzzy, kde-format 3094 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3095 msgid "of Hathor" 3096 msgstr "од Hijjah" 3097 3098 #: kdecore/kcalendarsystemcoptic.cpp:258 3099 #, fuzzy, kde-format 3100 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3101 msgid "of Kiahk" 3102 msgstr "од Kho" 3103 3104 #: kdecore/kcalendarsystemcoptic.cpp:260 3105 #, fuzzy, kde-format 3106 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3107 msgid "of Tobe" 3108 msgstr "од октомври" 3109 3110 #: kdecore/kcalendarsystemcoptic.cpp:262 3111 #, fuzzy, kde-format 3112 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3113 msgid "of Meshir" 3114 msgstr "од Mehr" 3115 3116 #: kdecore/kcalendarsystemcoptic.cpp:264 3117 #, fuzzy, kde-format 3118 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3119 msgid "of Paremhotep" 3120 msgstr "Параметар" 3121 3122 #: kdecore/kcalendarsystemcoptic.cpp:266 3123 #, fuzzy, kde-format 3124 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3125 msgid "of Parmoute" 3126 msgstr "од Tamuz" 3127 3128 #: kdecore/kcalendarsystemcoptic.cpp:268 3129 #, fuzzy, kde-format 3130 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3131 msgid "of Pashons" 3132 msgstr "од Bah" 3133 3134 #: kdecore/kcalendarsystemcoptic.cpp:270 3135 #, fuzzy, kde-format 3136 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3137 msgid "of Paone" 3138 msgstr "од јан" 3139 3140 #: kdecore/kcalendarsystemcoptic.cpp:272 3141 #, fuzzy, kde-format 3142 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3143 msgid "of Epep" 3144 msgstr "од сеп" 3145 3146 #: kdecore/kcalendarsystemcoptic.cpp:274 3147 #, fuzzy, kde-format 3148 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3149 msgid "of Mesore" 3150 msgstr "од Mor" 3151 3152 #: kdecore/kcalendarsystemcoptic.cpp:276 3153 #, fuzzy, kde-format 3154 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3155 msgid "of Kouji nabot" 3156 msgstr "од фев" 3157 3158 #: kdecore/kcalendarsystemcoptic.cpp:285 3159 #, fuzzy, kde-format 3160 msgctxt "Coptic month 1 - KLocale::LongName" 3161 msgid "Thoout" 3162 msgstr "чет" 3163 3164 #: kdecore/kcalendarsystemcoptic.cpp:287 3165 #, fuzzy, kde-format 3166 msgctxt "Coptic month 2 - KLocale::LongName" 3167 msgid "Paope" 3168 msgstr "Својство" 3169 3170 #: kdecore/kcalendarsystemcoptic.cpp:289 3171 #, fuzzy, kde-format 3172 msgctxt "Coptic month 3 - KLocale::LongName" 3173 msgid "Hathor" 3174 msgstr "Автор" 3175 3176 #: kdecore/kcalendarsystemcoptic.cpp:291 3177 #, fuzzy, kde-format 3178 msgctxt "Coptic month 4 - KLocale::LongName" 3179 msgid "Kiahk" 3180 msgstr "од Kho" 3181 3182 #: kdecore/kcalendarsystemcoptic.cpp:293 3183 #, fuzzy, kde-format 3184 msgctxt "Coptic month 5 - KLocale::LongName" 3185 msgid "Tobe" 3186 msgstr "Задача" 3187 3188 #: kdecore/kcalendarsystemcoptic.cpp:295 3189 #, fuzzy, kde-format 3190 msgctxt "Coptic month 6 - KLocale::LongName" 3191 msgid "Meshir" 3192 msgstr "Mehr" 3193 3194 #: kdecore/kcalendarsystemcoptic.cpp:297 3195 #, fuzzy, kde-format 3196 msgctxt "Coptic month 7 - KLocale::LongName" 3197 msgid "Paremhotep" 3198 msgstr "Параметар" 3199 3200 #: kdecore/kcalendarsystemcoptic.cpp:299 3201 #, fuzzy, kde-format 3202 msgctxt "Coptic month 8 - KLocale::LongName" 3203 msgid "Parmoute" 3204 msgstr "Параметар" 3205 3206 #: kdecore/kcalendarsystemcoptic.cpp:301 3207 #, fuzzy, kde-format 3208 msgctxt "Coptic month 9 - KLocale::LongName" 3209 msgid "Pashons" 3210 msgstr "Пауза" 3211 3212 #: kdecore/kcalendarsystemcoptic.cpp:303 3213 #, fuzzy, kde-format 3214 msgctxt "Coptic month 10 - KLocale::LongName" 3215 msgid "Paone" 3216 msgstr "Нема" 3217 3218 #: kdecore/kcalendarsystemcoptic.cpp:305 3219 #, fuzzy, kde-format 3220 msgctxt "Coptic month 11 - KLocale::LongName" 3221 msgid "Epep" 3222 msgstr "Escape" 3223 3224 #: kdecore/kcalendarsystemcoptic.cpp:307 3225 #, fuzzy, kde-format 3226 msgctxt "Coptic month 12 - KLocale::LongName" 3227 msgid "Mesore" 3228 msgstr "&Врати" 3229 3230 #: kdecore/kcalendarsystemcoptic.cpp:309 3231 #, fuzzy, kde-format 3232 msgctxt "Coptic month 12 - KLocale::LongName" 3233 msgid "Kouji nabot" 3234 msgstr "од фев" 3235 3236 #: kdecore/kcalendarsystemcoptic.cpp:324 3237 #, kde-format 3238 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3239 msgid "P" 3240 msgstr "" 3241 3242 #: kdecore/kcalendarsystemcoptic.cpp:326 3243 #, kde-format 3244 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3245 msgid "P" 3246 msgstr "" 3247 3248 #: kdecore/kcalendarsystemcoptic.cpp:328 3249 #, kde-format 3250 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3251 msgid "P" 3252 msgstr "" 3253 3254 #: kdecore/kcalendarsystemcoptic.cpp:330 3255 #, kde-format 3256 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3257 msgid "P" 3258 msgstr "" 3259 3260 #: kdecore/kcalendarsystemcoptic.cpp:332 3261 #, kde-format 3262 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3263 msgid "P" 3264 msgstr "" 3265 3266 #: kdecore/kcalendarsystemcoptic.cpp:334 3267 #, kde-format 3268 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3269 msgid "P" 3270 msgstr "" 3271 3272 #: kdecore/kcalendarsystemcoptic.cpp:336 3273 #, kde-format 3274 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3275 msgid "T" 3276 msgstr "" 3277 3278 #: kdecore/kcalendarsystemcoptic.cpp:345 3279 #, fuzzy, kde-format 3280 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3281 msgid "Pes" 3282 msgstr "Страници" 3283 3284 #: kdecore/kcalendarsystemcoptic.cpp:347 3285 #, fuzzy, kde-format 3286 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3287 msgid "Psh" 3288 msgstr "Пауза" 3289 3290 #: kdecore/kcalendarsystemcoptic.cpp:349 3291 #, fuzzy, kde-format 3292 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3293 msgid "Pef" 3294 msgstr "Страници" 3295 3296 #: kdecore/kcalendarsystemcoptic.cpp:351 3297 #, kde-format 3298 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3299 msgid "Pti" 3300 msgstr "" 3301 3302 #: kdecore/kcalendarsystemcoptic.cpp:353 3303 #, fuzzy, kde-format 3304 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3305 msgid "Pso" 3306 msgstr "Пауза" 3307 3308 #: kdecore/kcalendarsystemcoptic.cpp:355 3309 #, fuzzy, kde-format 3310 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3311 msgid "Psa" 3312 msgstr "Пауза" 3313 3314 #: kdecore/kcalendarsystemcoptic.cpp:357 3315 #, kde-format 3316 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3317 msgid "Tky" 3318 msgstr "" 3319 3320 #: kdecore/kcalendarsystemcoptic.cpp:365 3321 #, fuzzy, kde-format 3322 msgctxt "Coptic weekday 1 - KLocale::LongName" 3323 msgid "Pesnau" 3324 msgstr "Пауза" 3325 3326 #: kdecore/kcalendarsystemcoptic.cpp:367 3327 #, fuzzy, kde-format 3328 msgctxt "Coptic weekday 2 - KLocale::LongName" 3329 msgid "Pshoment" 3330 msgstr "Коментар" 3331 3332 #: kdecore/kcalendarsystemcoptic.cpp:369 3333 #, kde-format 3334 msgctxt "Coptic weekday 3 - KLocale::LongName" 3335 msgid "Peftoou" 3336 msgstr "" 3337 3338 #: kdecore/kcalendarsystemcoptic.cpp:371 3339 #, kde-format 3340 msgctxt "Coptic weekday 4 - KLocale::LongName" 3341 msgid "Ptiou" 3342 msgstr "" 3343 3344 #: kdecore/kcalendarsystemcoptic.cpp:373 3345 #, fuzzy, kde-format 3346 msgctxt "Coptic weekday 5 - KLocale::LongName" 3347 msgid "Psoou" 3348 msgstr "Пауза" 3349 3350 #: kdecore/kcalendarsystemcoptic.cpp:375 3351 #, kde-format 3352 msgctxt "Coptic weekday 6 - KLocale::LongName" 3353 msgid "Psabbaton" 3354 msgstr "" 3355 3356 #: kdecore/kcalendarsystemcoptic.cpp:377 3357 #, kde-format 3358 msgctxt "Coptic weekday 7 - KLocale::LongName" 3359 msgid "Tkyriakē" 3360 msgstr "" 3361 3362 #: kdecore/kcalendarsystemethiopian.cpp:50 3363 #, kde-format 3364 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3365 msgid "Amata Mehrat" 3366 msgstr "" 3367 3368 #: kdecore/kcalendarsystemethiopian.cpp:51 3369 #, kde-format 3370 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3371 msgid "AM" 3372 msgstr "" 3373 3374 #: kdecore/kcalendarsystemethiopian.cpp:52 3375 #, kde-format 3376 msgctxt "" 3377 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3378 msgid "%Ey %EC" 3379 msgstr "" 3380 3381 #: kdecore/kcalendarsystemethiopian.cpp:66 3382 #, kde-format 3383 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3384 msgid "M" 3385 msgstr "" 3386 3387 #: kdecore/kcalendarsystemethiopian.cpp:68 3388 #, kde-format 3389 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3390 msgid "T" 3391 msgstr "" 3392 3393 #: kdecore/kcalendarsystemethiopian.cpp:70 3394 #, kde-format 3395 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3396 msgid "H" 3397 msgstr "" 3398 3399 #: kdecore/kcalendarsystemethiopian.cpp:72 3400 #, kde-format 3401 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3402 msgid "T" 3403 msgstr "" 3404 3405 #: kdecore/kcalendarsystemethiopian.cpp:74 3406 #, kde-format 3407 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3408 msgid "T" 3409 msgstr "" 3410 3411 #: kdecore/kcalendarsystemethiopian.cpp:76 3412 #, kde-format 3413 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3414 msgid "Y" 3415 msgstr "" 3416 3417 #: kdecore/kcalendarsystemethiopian.cpp:78 3418 #, kde-format 3419 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3420 msgid "M" 3421 msgstr "" 3422 3423 #: kdecore/kcalendarsystemethiopian.cpp:80 3424 #, kde-format 3425 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3426 msgid "M" 3427 msgstr "" 3428 3429 #: kdecore/kcalendarsystemethiopian.cpp:82 3430 #, kde-format 3431 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3432 msgid "G" 3433 msgstr "" 3434 3435 #: kdecore/kcalendarsystemethiopian.cpp:84 3436 #, kde-format 3437 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3438 msgid "S" 3439 msgstr "" 3440 3441 #: kdecore/kcalendarsystemethiopian.cpp:86 3442 #, kde-format 3443 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3444 msgid "H" 3445 msgstr "" 3446 3447 #: kdecore/kcalendarsystemethiopian.cpp:88 3448 #, kde-format 3449 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3450 msgid "N" 3451 msgstr "" 3452 3453 #: kdecore/kcalendarsystemethiopian.cpp:90 3454 #, kde-format 3455 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3456 msgid "P" 3457 msgstr "" 3458 3459 #: kdecore/kcalendarsystemethiopian.cpp:99 3460 #, fuzzy, kde-format 3461 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3462 msgid "of Mes" 3463 msgstr "од Meh" 3464 3465 #: kdecore/kcalendarsystemethiopian.cpp:101 3466 #, fuzzy, kde-format 3467 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3468 msgid "of Teq" 3469 msgstr "од Tevet" 3470 3471 #: kdecore/kcalendarsystemethiopian.cpp:103 3472 #, fuzzy, kde-format 3473 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3474 msgid "of Hed" 3475 msgstr "од фев" 3476 3477 #: kdecore/kcalendarsystemethiopian.cpp:105 3478 #, fuzzy, kde-format 3479 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3480 msgid "of Tah" 3481 msgstr "од Bah" 3482 3483 #: kdecore/kcalendarsystemethiopian.cpp:107 3484 #, fuzzy, kde-format 3485 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3486 msgid "of Ter" 3487 msgstr "од Tir" 3488 3489 #: kdecore/kcalendarsystemethiopian.cpp:109 3490 #, fuzzy, kde-format 3491 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3492 msgid "of Yak" 3493 msgstr "од јан" 3494 3495 #: kdecore/kcalendarsystemethiopian.cpp:111 3496 #, fuzzy, kde-format 3497 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3498 msgid "of Mag" 3499 msgstr "од мар" 3500 3501 #: kdecore/kcalendarsystemethiopian.cpp:113 3502 #, fuzzy, kde-format 3503 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3504 msgid "of Miy" 3505 msgstr "од мај" 3506 3507 #: kdecore/kcalendarsystemethiopian.cpp:115 3508 #, fuzzy, kde-format 3509 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3510 msgid "of Gen" 3511 msgstr "од јан" 3512 3513 #: kdecore/kcalendarsystemethiopian.cpp:117 3514 #, fuzzy, kde-format 3515 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3516 msgid "of Sen" 3517 msgstr "од сеп" 3518 3519 #: kdecore/kcalendarsystemethiopian.cpp:119 3520 #, fuzzy, kde-format 3521 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3522 msgid "of Ham" 3523 msgstr "од Tamuz" 3524 3525 #: kdecore/kcalendarsystemethiopian.cpp:121 3526 #, fuzzy, kde-format 3527 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3528 msgid "of Neh" 3529 msgstr "од Meh" 3530 3531 #: kdecore/kcalendarsystemethiopian.cpp:123 3532 #, fuzzy, kde-format 3533 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3534 msgid "of Pag" 3535 msgstr "од Tamuz" 3536 3537 #: kdecore/kcalendarsystemethiopian.cpp:132 3538 #, fuzzy, kde-format 3539 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3540 msgid "Mes" 3541 msgstr "Да" 3542 3543 #: kdecore/kcalendarsystemethiopian.cpp:134 3544 #, fuzzy, kde-format 3545 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3546 msgid "Teq" 3547 msgstr "вто" 3548 3549 #: kdecore/kcalendarsystemethiopian.cpp:136 3550 #, fuzzy, kde-format 3551 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3552 msgid "Hed" 3553 msgstr "сре" 3554 3555 #: kdecore/kcalendarsystemethiopian.cpp:138 3556 #, fuzzy, kde-format 3557 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3558 msgid "Tah" 3559 msgstr "Thl" 3560 3561 #: kdecore/kcalendarsystemethiopian.cpp:140 3562 #, fuzzy, kde-format 3563 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3564 msgid "Ter" 3565 msgstr "вто" 3566 3567 #: kdecore/kcalendarsystemethiopian.cpp:142 3568 #, fuzzy, kde-format 3569 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3570 msgid "Yak" 3571 msgstr "од јан" 3572 3573 #: kdecore/kcalendarsystemethiopian.cpp:144 3574 #, fuzzy, kde-format 3575 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3576 msgid "Mag" 3577 msgstr "мар" 3578 3579 #: kdecore/kcalendarsystemethiopian.cpp:146 3580 #, fuzzy, kde-format 3581 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3582 msgid "Miy" 3583 msgstr "мај" 3584 3585 #: kdecore/kcalendarsystemethiopian.cpp:148 3586 #, fuzzy, kde-format 3587 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3588 msgid "Gen" 3589 msgstr "Зелена:" 3590 3591 #: kdecore/kcalendarsystemethiopian.cpp:150 3592 #, fuzzy, kde-format 3593 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3594 msgid "Sen" 3595 msgstr "&Испрати" 3596 3597 #: kdecore/kcalendarsystemethiopian.cpp:152 3598 #, fuzzy, kde-format 3599 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3600 msgid "Ham" 3601 msgstr "am" 3602 3603 #: kdecore/kcalendarsystemethiopian.cpp:154 3604 #, fuzzy, kde-format 3605 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3606 msgid "Neh" 3607 msgstr "Meh" 3608 3609 #: kdecore/kcalendarsystemethiopian.cpp:156 3610 #, fuzzy, kde-format 3611 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3612 msgid "Pag" 3613 msgstr "Страници" 3614 3615 #: kdecore/kcalendarsystemethiopian.cpp:165 3616 #, fuzzy, kde-format 3617 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3618 msgid "of Meskerem" 3619 msgstr "од Mehr" 3620 3621 #: kdecore/kcalendarsystemethiopian.cpp:167 3622 #, fuzzy, kde-format 3623 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3624 msgid "of Tequemt" 3625 msgstr "од Tevet" 3626 3627 #: kdecore/kcalendarsystemethiopian.cpp:169 3628 #, fuzzy, kde-format 3629 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3630 msgid "of Hedar" 3631 msgstr "од Adar" 3632 3633 #: kdecore/kcalendarsystemethiopian.cpp:171 3634 #, fuzzy, kde-format 3635 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3636 msgid "of Tahsas" 3637 msgstr "од Bahman" 3638 3639 #: kdecore/kcalendarsystemethiopian.cpp:173 3640 #, fuzzy, kde-format 3641 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3642 msgid "of Ter" 3643 msgstr "од Tir" 3644 3645 #: kdecore/kcalendarsystemethiopian.cpp:175 3646 #, fuzzy, kde-format 3647 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3648 msgid "of Yakatit" 3649 msgstr "од Far" 3650 3651 #: kdecore/kcalendarsystemethiopian.cpp:177 3652 #, fuzzy, kde-format 3653 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3654 msgid "of Magabit" 3655 msgstr "од Rajab" 3656 3657 #: kdecore/kcalendarsystemethiopian.cpp:179 3658 #, fuzzy, kde-format 3659 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3660 msgid "of Miyazya" 3661 msgstr "од мај" 3662 3663 #: kdecore/kcalendarsystemethiopian.cpp:181 3664 #, fuzzy, kde-format 3665 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3666 msgid "of Genbot" 3667 msgstr "од фев" 3668 3669 #: kdecore/kcalendarsystemethiopian.cpp:183 3670 #, fuzzy, kde-format 3671 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3672 msgid "of Sene" 3673 msgstr "од сеп" 3674 3675 #: kdecore/kcalendarsystemethiopian.cpp:185 3676 #, fuzzy, kde-format 3677 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3678 msgid "of Hamle" 3679 msgstr "од Tamuz" 3680 3681 #: kdecore/kcalendarsystemethiopian.cpp:187 3682 #, fuzzy, kde-format 3683 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3684 msgid "of Nehase" 3685 msgstr "од Sha" 3686 3687 #: kdecore/kcalendarsystemethiopian.cpp:189 3688 #, fuzzy, kde-format 3689 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3690 msgid "of Pagumen" 3691 msgstr "од Tamuz" 3692 3693 #: kdecore/kcalendarsystemethiopian.cpp:198 3694 #, fuzzy, kde-format 3695 msgctxt "Ethiopian month 1 - KLocale::LongName" 3696 msgid "Meskerem" 3697 msgstr "од Mehr" 3698 3699 #: kdecore/kcalendarsystemethiopian.cpp:200 3700 #, fuzzy, kde-format 3701 msgctxt "Ethiopian month 2 - KLocale::LongName" 3702 msgid "Tequemt" 3703 msgstr "Tevet" 3704 3705 #: kdecore/kcalendarsystemethiopian.cpp:202 3706 #, fuzzy, kde-format 3707 msgctxt "Ethiopian month 3 - KLocale::LongName" 3708 msgid "Hedar" 3709 msgstr "Adar" 3710 3711 #: kdecore/kcalendarsystemethiopian.cpp:204 3712 #, fuzzy, kde-format 3713 msgctxt "Ethiopian month 4 - KLocale::LongName" 3714 msgid "Tahsas" 3715 msgstr "Задача" 3716 3717 #: kdecore/kcalendarsystemethiopian.cpp:206 3718 #, fuzzy, kde-format 3719 msgctxt "Ethiopian month 5 - KLocale::LongName" 3720 msgid "Ter" 3721 msgstr "вто" 3722 3723 #: kdecore/kcalendarsystemethiopian.cpp:208 3724 #, fuzzy, kde-format 3725 msgctxt "Ethiopian month 6 - KLocale::LongName" 3726 msgid "Yakatit" 3727 msgstr "од Far" 3728 3729 #: kdecore/kcalendarsystemethiopian.cpp:210 3730 #, fuzzy, kde-format 3731 msgctxt "Ethiopian month 7 - KLocale::LongName" 3732 msgid "Magabit" 3733 msgstr "од Rajab" 3734 3735 #: kdecore/kcalendarsystemethiopian.cpp:212 3736 #, fuzzy, kde-format 3737 msgctxt "Ethiopian month 8 - KLocale::LongName" 3738 msgid "Miyazya" 3739 msgstr "од мај" 3740 3741 #: kdecore/kcalendarsystemethiopian.cpp:214 3742 #, fuzzy, kde-format 3743 msgctxt "Ethiopian month 9 - KLocale::LongName" 3744 msgid "Genbot" 3745 msgstr "од фев" 3746 3747 #: kdecore/kcalendarsystemethiopian.cpp:216 3748 #, fuzzy, kde-format 3749 msgctxt "Ethiopian month 10 - KLocale::LongName" 3750 msgid "Sene" 3751 msgstr "&Испрати" 3752 3753 #: kdecore/kcalendarsystemethiopian.cpp:218 3754 #, fuzzy, kde-format 3755 msgctxt "Ethiopian month 11 - KLocale::LongName" 3756 msgid "Hamle" 3757 msgstr "Име" 3758 3759 #: kdecore/kcalendarsystemethiopian.cpp:220 3760 #, fuzzy, kde-format 3761 msgctxt "Ethiopian month 12 - KLocale::LongName" 3762 msgid "Nehase" 3763 msgstr "Име" 3764 3765 #: kdecore/kcalendarsystemethiopian.cpp:222 3766 #, fuzzy, kde-format 3767 msgctxt "Ethiopian month 13 - KLocale::LongName" 3768 msgid "Pagumen" 3769 msgstr "Страници" 3770 3771 #: kdecore/kcalendarsystemethiopian.cpp:236 3772 #, kde-format 3773 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3774 msgid "S" 3775 msgstr "" 3776 3777 #: kdecore/kcalendarsystemethiopian.cpp:238 3778 #, kde-format 3779 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3780 msgid "M" 3781 msgstr "" 3782 3783 #: kdecore/kcalendarsystemethiopian.cpp:240 3784 #, kde-format 3785 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3786 msgid "R" 3787 msgstr "" 3788 3789 #: kdecore/kcalendarsystemethiopian.cpp:242 3790 #, kde-format 3791 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3792 msgid "H" 3793 msgstr "" 3794 3795 #: kdecore/kcalendarsystemethiopian.cpp:244 3796 #, fuzzy, kde-format 3797 #| msgid "Av" 3798 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3799 msgid "A" 3800 msgstr "Av" 3801 3802 #: kdecore/kcalendarsystemethiopian.cpp:246 3803 #, kde-format 3804 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3805 msgid "Q" 3806 msgstr "" 3807 3808 #: kdecore/kcalendarsystemethiopian.cpp:248 3809 #, kde-format 3810 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3811 msgid "E" 3812 msgstr "" 3813 3814 #: kdecore/kcalendarsystemethiopian.cpp:257 3815 #, fuzzy, kde-format 3816 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3817 msgid "Seg" 3818 msgstr "сеп" 3819 3820 #: kdecore/kcalendarsystemethiopian.cpp:259 3821 #, fuzzy, kde-format 3822 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3823 msgid "Mak" 3824 msgstr "мар" 3825 3826 #: kdecore/kcalendarsystemethiopian.cpp:261 3827 #, fuzzy, kde-format 3828 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3829 msgid "Rob" 3830 msgstr "Задача" 3831 3832 #: kdecore/kcalendarsystemethiopian.cpp:263 3833 #, fuzzy, kde-format 3834 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3835 msgid "Ham" 3836 msgstr "am" 3837 3838 #: kdecore/kcalendarsystemethiopian.cpp:265 3839 #, fuzzy, kde-format 3840 #| msgid "Arb" 3841 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3842 msgid "Arb" 3843 msgstr "Arb" 3844 3845 #: kdecore/kcalendarsystemethiopian.cpp:267 3846 #, fuzzy, kde-format 3847 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3848 msgid "Qed" 3849 msgstr "сре" 3850 3851 #: kdecore/kcalendarsystemethiopian.cpp:269 3852 #, fuzzy, kde-format 3853 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3854 msgid "Ehu" 3855 msgstr "чет" 3856 3857 #: kdecore/kcalendarsystemethiopian.cpp:276 3858 #, fuzzy, kde-format 3859 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3860 msgid "Segno" 3861 msgstr "&Испрати" 3862 3863 #: kdecore/kcalendarsystemethiopian.cpp:278 3864 #, fuzzy, kde-format 3865 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3866 msgid "Maksegno" 3867 msgstr "&Испрати" 3868 3869 #: kdecore/kcalendarsystemethiopian.cpp:280 3870 #, fuzzy, kde-format 3871 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3872 msgid "Rob" 3873 msgstr "Задача" 3874 3875 #: kdecore/kcalendarsystemethiopian.cpp:282 3876 #, fuzzy, kde-format 3877 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3878 msgid "Hamus" 3879 msgstr "Пауза" 3880 3881 #: kdecore/kcalendarsystemethiopian.cpp:284 3882 #, fuzzy, kde-format 3883 #| msgid "Arb" 3884 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3885 msgid "Arb" 3886 msgstr "Arb" 3887 3888 #: kdecore/kcalendarsystemethiopian.cpp:286 3889 #, fuzzy, kde-format 3890 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3891 msgid "Qedame" 3892 msgstr "Име" 3893 3894 #: kdecore/kcalendarsystemethiopian.cpp:288 3895 #, fuzzy, kde-format 3896 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3897 msgid "Ehud" 3898 msgstr "чет" 3899 3900 #: kdecore/kcalendarsystemgregorian.cpp:53 3901 #, kde-format 3902 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3903 msgid "Before Common Era" 3904 msgstr "" 3905 3906 #: kdecore/kcalendarsystemgregorian.cpp:54 3907 #, kde-format 3908 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3909 msgid "BCE" 3910 msgstr "" 3911 3912 #: kdecore/kcalendarsystemgregorian.cpp:56 3913 #, kde-format 3914 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3915 msgid "Before Christ" 3916 msgstr "" 3917 3918 #: kdecore/kcalendarsystemgregorian.cpp:57 3919 #, kde-format 3920 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3921 msgid "BC" 3922 msgstr "" 3923 3924 #: kdecore/kcalendarsystemgregorian.cpp:59 3925 #, kde-format 3926 msgctxt "" 3927 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3928 msgid "%Ey %EC" 3929 msgstr "" 3930 3931 #: kdecore/kcalendarsystemgregorian.cpp:63 3932 #, kde-format 3933 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3934 msgid "Common Era" 3935 msgstr "" 3936 3937 #: kdecore/kcalendarsystemgregorian.cpp:64 3938 #, kde-format 3939 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3940 msgid "CE" 3941 msgstr "" 3942 3943 #: kdecore/kcalendarsystemgregorian.cpp:66 3944 #: kdecore/kcalendarsystemjapanese.cpp:57 3945 #, kde-format 3946 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3947 msgid "Anno Domini" 3948 msgstr "" 3949 3950 #: kdecore/kcalendarsystemgregorian.cpp:67 3951 #: kdecore/kcalendarsystemjapanese.cpp:58 3952 #, kde-format 3953 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3954 msgid "AD" 3955 msgstr "" 3956 3957 #: kdecore/kcalendarsystemgregorian.cpp:69 3958 #: kdecore/kcalendarsystemjapanese.cpp:59 3959 #, kde-format 3960 msgctxt "" 3961 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3962 msgid "%Ey %EC" 3963 msgstr "" 3964 3965 #: kdecore/kcalendarsystemgregorian.cpp:138 3966 #, kde-format 3967 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3968 msgid "J" 3969 msgstr "" 3970 3971 #: kdecore/kcalendarsystemgregorian.cpp:140 3972 #, kde-format 3973 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3974 msgid "F" 3975 msgstr "" 3976 3977 #: kdecore/kcalendarsystemgregorian.cpp:142 3978 #, kde-format 3979 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3980 msgid "M" 3981 msgstr "" 3982 3983 #: kdecore/kcalendarsystemgregorian.cpp:144 3984 #, fuzzy, kde-format 3985 #| msgid "Av" 3986 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3987 msgid "A" 3988 msgstr "Av" 3989 3990 #: kdecore/kcalendarsystemgregorian.cpp:146 3991 #, kde-format 3992 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3993 msgid "M" 3994 msgstr "" 3995 3996 #: kdecore/kcalendarsystemgregorian.cpp:148 3997 #, kde-format 3998 msgctxt "Gregorian month 6 - KLocale::NarrowName" 3999 msgid "J" 4000 msgstr "" 4001 4002 #: kdecore/kcalendarsystemgregorian.cpp:150 4003 #, kde-format 4004 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4005 msgid "J" 4006 msgstr "" 4007 4008 #: kdecore/kcalendarsystemgregorian.cpp:152 4009 #, fuzzy, kde-format 4010 #| msgid "Av" 4011 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4012 msgid "A" 4013 msgstr "Av" 4014 4015 #: kdecore/kcalendarsystemgregorian.cpp:154 4016 #, kde-format 4017 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4018 msgid "S" 4019 msgstr "" 4020 4021 #: kdecore/kcalendarsystemgregorian.cpp:156 4022 #, kde-format 4023 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4024 msgid "O" 4025 msgstr "" 4026 4027 #: kdecore/kcalendarsystemgregorian.cpp:158 4028 #, kde-format 4029 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4030 msgid "N" 4031 msgstr "" 4032 4033 #: kdecore/kcalendarsystemgregorian.cpp:160 4034 #, kde-format 4035 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4036 msgid "D" 4037 msgstr "" 4038 4039 #: kdecore/kcalendarsystemgregorian.cpp:169 4040 #, fuzzy, kde-format 4041 #| msgctxt "of January" 4042 #| msgid "of Jan" 4043 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4044 msgid "of Jan" 4045 msgstr "од јан" 4046 4047 #: kdecore/kcalendarsystemgregorian.cpp:171 4048 #, fuzzy, kde-format 4049 #| msgctxt "of February" 4050 #| msgid "of Feb" 4051 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4052 msgid "of Feb" 4053 msgstr "од фев" 4054 4055 #: kdecore/kcalendarsystemgregorian.cpp:173 4056 #, fuzzy, kde-format 4057 #| msgctxt "of March" 4058 #| msgid "of Mar" 4059 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4060 msgid "of Mar" 4061 msgstr "од мар" 4062 4063 #: kdecore/kcalendarsystemgregorian.cpp:175 4064 #, fuzzy, kde-format 4065 #| msgctxt "of April" 4066 #| msgid "of Apr" 4067 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4068 msgid "of Apr" 4069 msgstr "од апр" 4070 4071 #: kdecore/kcalendarsystemgregorian.cpp:177 4072 #, fuzzy, kde-format 4073 #| msgctxt "of May short" 4074 #| msgid "of May" 4075 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4076 msgid "of May" 4077 msgstr "од мај" 4078 4079 #: kdecore/kcalendarsystemgregorian.cpp:179 4080 #, fuzzy, kde-format 4081 #| msgctxt "of June" 4082 #| msgid "of Jun" 4083 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4084 msgid "of Jun" 4085 msgstr "од јун" 4086 4087 #: kdecore/kcalendarsystemgregorian.cpp:181 4088 #, fuzzy, kde-format 4089 #| msgctxt "of July" 4090 #| msgid "of Jul" 4091 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4092 msgid "of Jul" 4093 msgstr "од јул" 4094 4095 #: kdecore/kcalendarsystemgregorian.cpp:183 4096 #, fuzzy, kde-format 4097 #| msgctxt "of August" 4098 #| msgid "of Aug" 4099 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4100 msgid "of Aug" 4101 msgstr "од авг" 4102 4103 #: kdecore/kcalendarsystemgregorian.cpp:185 4104 #, fuzzy, kde-format 4105 #| msgctxt "of September" 4106 #| msgid "of Sep" 4107 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4108 msgid "of Sep" 4109 msgstr "од сеп" 4110 4111 #: kdecore/kcalendarsystemgregorian.cpp:187 4112 #, fuzzy, kde-format 4113 #| msgctxt "of October" 4114 #| msgid "of Oct" 4115 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4116 msgid "of Oct" 4117 msgstr "од окт" 4118 4119 #: kdecore/kcalendarsystemgregorian.cpp:189 4120 #, fuzzy, kde-format 4121 #| msgctxt "of November" 4122 #| msgid "of Nov" 4123 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4124 msgid "of Nov" 4125 msgstr "од ное" 4126 4127 #: kdecore/kcalendarsystemgregorian.cpp:191 4128 #, fuzzy, kde-format 4129 #| msgctxt "of December" 4130 #| msgid "of Dec" 4131 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4132 msgid "of Dec" 4133 msgstr "од дек" 4134 4135 #: kdecore/kcalendarsystemgregorian.cpp:200 4136 #, fuzzy, kde-format 4137 #| msgctxt "January" 4138 #| msgid "Jan" 4139 msgctxt "Gregorian month 1 - KLocale::ShortName" 4140 msgid "Jan" 4141 msgstr "јан" 4142 4143 #: kdecore/kcalendarsystemgregorian.cpp:202 4144 #, fuzzy, kde-format 4145 #| msgctxt "February" 4146 #| msgid "Feb" 4147 msgctxt "Gregorian month 2 - KLocale::ShortName" 4148 msgid "Feb" 4149 msgstr "фев" 4150 4151 #: kdecore/kcalendarsystemgregorian.cpp:204 4152 #, fuzzy, kde-format 4153 #| msgctxt "March" 4154 #| msgid "Mar" 4155 msgctxt "Gregorian month 3 - KLocale::ShortName" 4156 msgid "Mar" 4157 msgstr "мар" 4158 4159 #: kdecore/kcalendarsystemgregorian.cpp:206 4160 #, fuzzy, kde-format 4161 #| msgctxt "April" 4162 #| msgid "Apr" 4163 msgctxt "Gregorian month 4 - KLocale::ShortName" 4164 msgid "Apr" 4165 msgstr "апр" 4166 4167 #: kdecore/kcalendarsystemgregorian.cpp:208 4168 #, fuzzy, kde-format 4169 #| msgctxt "May short" 4170 #| msgid "May" 4171 msgctxt "Gregorian month 5 - KLocale::ShortName" 4172 msgid "May" 4173 msgstr "мај" 4174 4175 #: kdecore/kcalendarsystemgregorian.cpp:210 4176 #, fuzzy, kde-format 4177 #| msgctxt "June" 4178 #| msgid "Jun" 4179 msgctxt "Gregorian month 6 - KLocale::ShortName" 4180 msgid "Jun" 4181 msgstr "јун" 4182 4183 #: kdecore/kcalendarsystemgregorian.cpp:212 4184 #, fuzzy, kde-format 4185 #| msgctxt "July" 4186 #| msgid "Jul" 4187 msgctxt "Gregorian month 7 - KLocale::ShortName" 4188 msgid "Jul" 4189 msgstr "јул" 4190 4191 #: kdecore/kcalendarsystemgregorian.cpp:214 4192 #, fuzzy, kde-format 4193 #| msgctxt "August" 4194 #| msgid "Aug" 4195 msgctxt "Gregorian month 8 - KLocale::ShortName" 4196 msgid "Aug" 4197 msgstr "авг" 4198 4199 #: kdecore/kcalendarsystemgregorian.cpp:216 4200 #, fuzzy, kde-format 4201 #| msgctxt "September" 4202 #| msgid "Sep" 4203 msgctxt "Gregorian month 9 - KLocale::ShortName" 4204 msgid "Sep" 4205 msgstr "сеп" 4206 4207 #: kdecore/kcalendarsystemgregorian.cpp:218 4208 #, fuzzy, kde-format 4209 #| msgctxt "October" 4210 #| msgid "Oct" 4211 msgctxt "Gregorian month 10 - KLocale::ShortName" 4212 msgid "Oct" 4213 msgstr "окт" 4214 4215 #: kdecore/kcalendarsystemgregorian.cpp:220 4216 #, fuzzy, kde-format 4217 #| msgctxt "November" 4218 #| msgid "Nov" 4219 msgctxt "Gregorian month 11 - KLocale::ShortName" 4220 msgid "Nov" 4221 msgstr "ное" 4222 4223 #: kdecore/kcalendarsystemgregorian.cpp:222 4224 #, fuzzy, kde-format 4225 #| msgctxt "December" 4226 #| msgid "Dec" 4227 msgctxt "Gregorian month 12 - KLocale::ShortName" 4228 msgid "Dec" 4229 msgstr "дек" 4230 4231 #: kdecore/kcalendarsystemgregorian.cpp:231 4232 #, fuzzy, kde-format 4233 #| msgid "of January" 4234 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4235 msgid "of January" 4236 msgstr "од јануари" 4237 4238 #: kdecore/kcalendarsystemgregorian.cpp:233 4239 #, fuzzy, kde-format 4240 #| msgid "of February" 4241 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4242 msgid "of February" 4243 msgstr "од февруари" 4244 4245 #: kdecore/kcalendarsystemgregorian.cpp:235 4246 #, fuzzy, kde-format 4247 #| msgid "of March" 4248 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4249 msgid "of March" 4250 msgstr "од март" 4251 4252 #: kdecore/kcalendarsystemgregorian.cpp:237 4253 #, fuzzy, kde-format 4254 #| msgid "of April" 4255 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4256 msgid "of April" 4257 msgstr "од април" 4258 4259 #: kdecore/kcalendarsystemgregorian.cpp:239 4260 #, fuzzy, kde-format 4261 #| msgctxt "of May short" 4262 #| msgid "of May" 4263 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4264 msgid "of May" 4265 msgstr "од мај" 4266 4267 #: kdecore/kcalendarsystemgregorian.cpp:241 4268 #, fuzzy, kde-format 4269 #| msgid "of June" 4270 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4271 msgid "of June" 4272 msgstr "од јуни" 4273 4274 #: kdecore/kcalendarsystemgregorian.cpp:243 4275 #, fuzzy, kde-format 4276 #| msgid "of July" 4277 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4278 msgid "of July" 4279 msgstr "од јули" 4280 4281 #: kdecore/kcalendarsystemgregorian.cpp:245 4282 #, fuzzy, kde-format 4283 #| msgid "of August" 4284 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4285 msgid "of August" 4286 msgstr "од август" 4287 4288 #: kdecore/kcalendarsystemgregorian.cpp:247 4289 #, fuzzy, kde-format 4290 #| msgid "of September" 4291 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4292 msgid "of September" 4293 msgstr "од септември" 4294 4295 #: kdecore/kcalendarsystemgregorian.cpp:249 4296 #, fuzzy, kde-format 4297 #| msgid "of October" 4298 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4299 msgid "of October" 4300 msgstr "од октомври" 4301 4302 #: kdecore/kcalendarsystemgregorian.cpp:251 4303 #, fuzzy, kde-format 4304 #| msgid "of November" 4305 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4306 msgid "of November" 4307 msgstr "од ноември" 4308 4309 #: kdecore/kcalendarsystemgregorian.cpp:253 4310 #, fuzzy, kde-format 4311 #| msgid "of December" 4312 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4313 msgid "of December" 4314 msgstr "од декември" 4315 4316 #: kdecore/kcalendarsystemgregorian.cpp:262 4317 #, fuzzy, kde-format 4318 #| msgid "January" 4319 msgctxt "Gregorian month 1 - KLocale::LongName" 4320 msgid "January" 4321 msgstr "јануари" 4322 4323 #: kdecore/kcalendarsystemgregorian.cpp:264 4324 #, fuzzy, kde-format 4325 #| msgid "February" 4326 msgctxt "Gregorian month 2 - KLocale::LongName" 4327 msgid "February" 4328 msgstr "февруари" 4329 4330 #: kdecore/kcalendarsystemgregorian.cpp:266 4331 #, fuzzy, kde-format 4332 #| msgctxt "March long" 4333 #| msgid "March" 4334 msgctxt "Gregorian month 3 - KLocale::LongName" 4335 msgid "March" 4336 msgstr "март" 4337 4338 #: kdecore/kcalendarsystemgregorian.cpp:268 4339 #, fuzzy, kde-format 4340 #| msgid "April" 4341 msgctxt "Gregorian month 4 - KLocale::LongName" 4342 msgid "April" 4343 msgstr "април" 4344 4345 #: kdecore/kcalendarsystemgregorian.cpp:270 4346 #, fuzzy, kde-format 4347 #| msgctxt "May short" 4348 #| msgid "May" 4349 msgctxt "Gregorian month 5 - KLocale::LongName" 4350 msgid "May" 4351 msgstr "мај" 4352 4353 #: kdecore/kcalendarsystemgregorian.cpp:272 4354 #, fuzzy, kde-format 4355 #| msgid "June" 4356 msgctxt "Gregorian month 6 - KLocale::LongName" 4357 msgid "June" 4358 msgstr "јуни" 4359 4360 #: kdecore/kcalendarsystemgregorian.cpp:274 4361 #, fuzzy, kde-format 4362 #| msgid "July" 4363 msgctxt "Gregorian month 7 - KLocale::LongName" 4364 msgid "July" 4365 msgstr "јули" 4366 4367 #: kdecore/kcalendarsystemgregorian.cpp:276 4368 #, fuzzy, kde-format 4369 #| msgctxt "August long" 4370 #| msgid "August" 4371 msgctxt "Gregorian month 8 - KLocale::LongName" 4372 msgid "August" 4373 msgstr "август" 4374 4375 #: kdecore/kcalendarsystemgregorian.cpp:278 4376 #, fuzzy, kde-format 4377 #| msgid "September" 4378 msgctxt "Gregorian month 9 - KLocale::LongName" 4379 msgid "September" 4380 msgstr "септември" 4381 4382 #: kdecore/kcalendarsystemgregorian.cpp:280 4383 #, fuzzy, kde-format 4384 #| msgid "October" 4385 msgctxt "Gregorian month 10 - KLocale::LongName" 4386 msgid "October" 4387 msgstr "октомври" 4388 4389 #: kdecore/kcalendarsystemgregorian.cpp:282 4390 #, fuzzy, kde-format 4391 #| msgid "November" 4392 msgctxt "Gregorian month 11 - KLocale::LongName" 4393 msgid "November" 4394 msgstr "ноември" 4395 4396 #: kdecore/kcalendarsystemgregorian.cpp:284 4397 #, fuzzy, kde-format 4398 #| msgid "December" 4399 msgctxt "Gregorian month 12 - KLocale::LongName" 4400 msgid "December" 4401 msgstr "декември" 4402 4403 #: kdecore/kcalendarsystemgregorian.cpp:297 4404 #: kdecore/kcalendarsystemhebrew.cpp:807 4405 #, kde-format 4406 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4407 msgid "M" 4408 msgstr "" 4409 4410 #: kdecore/kcalendarsystemgregorian.cpp:299 4411 #: kdecore/kcalendarsystemhebrew.cpp:809 4412 #, kde-format 4413 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4414 msgid "T" 4415 msgstr "" 4416 4417 #: kdecore/kcalendarsystemgregorian.cpp:301 4418 #: kdecore/kcalendarsystemhebrew.cpp:811 4419 #, kde-format 4420 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4421 msgid "W" 4422 msgstr "" 4423 4424 #: kdecore/kcalendarsystemgregorian.cpp:303 4425 #: kdecore/kcalendarsystemhebrew.cpp:813 4426 #, kde-format 4427 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4428 msgid "T" 4429 msgstr "" 4430 4431 #: kdecore/kcalendarsystemgregorian.cpp:305 4432 #: kdecore/kcalendarsystemhebrew.cpp:815 4433 #, kde-format 4434 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4435 msgid "F" 4436 msgstr "" 4437 4438 #: kdecore/kcalendarsystemgregorian.cpp:307 4439 #: kdecore/kcalendarsystemhebrew.cpp:817 4440 #, kde-format 4441 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4442 msgid "S" 4443 msgstr "" 4444 4445 #: kdecore/kcalendarsystemgregorian.cpp:309 4446 #: kdecore/kcalendarsystemhebrew.cpp:819 4447 #, kde-format 4448 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4449 msgid "S" 4450 msgstr "" 4451 4452 #: kdecore/kcalendarsystemgregorian.cpp:318 4453 #: kdecore/kcalendarsystemhebrew.cpp:828 4454 #, fuzzy, kde-format 4455 #| msgctxt "Monday" 4456 #| msgid "Mon" 4457 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4458 msgid "Mon" 4459 msgstr "пон" 4460 4461 #: kdecore/kcalendarsystemgregorian.cpp:320 4462 #: kdecore/kcalendarsystemhebrew.cpp:830 4463 #, fuzzy, kde-format 4464 #| msgctxt "Tuesday" 4465 #| msgid "Tue" 4466 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4467 msgid "Tue" 4468 msgstr "вто" 4469 4470 #: kdecore/kcalendarsystemgregorian.cpp:322 4471 #: kdecore/kcalendarsystemhebrew.cpp:832 4472 #, fuzzy, kde-format 4473 #| msgctxt "Wednesday" 4474 #| msgid "Wed" 4475 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4476 msgid "Wed" 4477 msgstr "сре" 4478 4479 #: kdecore/kcalendarsystemgregorian.cpp:324 4480 #: kdecore/kcalendarsystemhebrew.cpp:834 4481 #, fuzzy, kde-format 4482 #| msgctxt "Thursday" 4483 #| msgid "Thu" 4484 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4485 msgid "Thu" 4486 msgstr "чет" 4487 4488 #: kdecore/kcalendarsystemgregorian.cpp:326 4489 #: kdecore/kcalendarsystemhebrew.cpp:836 4490 #, fuzzy, kde-format 4491 #| msgctxt "Friday" 4492 #| msgid "Fri" 4493 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4494 msgid "Fri" 4495 msgstr "пет" 4496 4497 #: kdecore/kcalendarsystemgregorian.cpp:328 4498 #: kdecore/kcalendarsystemhebrew.cpp:838 4499 #, fuzzy, kde-format 4500 #| msgctxt "Saturday" 4501 #| msgid "Sat" 4502 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4503 msgid "Sat" 4504 msgstr "саб" 4505 4506 #: kdecore/kcalendarsystemgregorian.cpp:330 4507 #: kdecore/kcalendarsystemhebrew.cpp:840 4508 #, fuzzy, kde-format 4509 #| msgctxt "Sunday" 4510 #| msgid "Sun" 4511 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4512 msgid "Sun" 4513 msgstr "нед" 4514 4515 #: kdecore/kcalendarsystemgregorian.cpp:337 4516 #: kdecore/kcalendarsystemhebrew.cpp:847 4517 #, fuzzy, kde-format 4518 #| msgid "Monday" 4519 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4520 msgid "Monday" 4521 msgstr "понеделник" 4522 4523 #: kdecore/kcalendarsystemgregorian.cpp:339 4524 #: kdecore/kcalendarsystemhebrew.cpp:849 4525 #, fuzzy, kde-format 4526 #| msgid "Tuesday" 4527 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4528 msgid "Tuesday" 4529 msgstr "вторник" 4530 4531 #: kdecore/kcalendarsystemgregorian.cpp:341 4532 #: kdecore/kcalendarsystemhebrew.cpp:851 4533 #, fuzzy, kde-format 4534 #| msgid "Wednesday" 4535 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4536 msgid "Wednesday" 4537 msgstr "среда" 4538 4539 #: kdecore/kcalendarsystemgregorian.cpp:343 4540 #: kdecore/kcalendarsystemhebrew.cpp:853 4541 #, fuzzy, kde-format 4542 #| msgid "Thursday" 4543 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4544 msgid "Thursday" 4545 msgstr "четврток" 4546 4547 #: kdecore/kcalendarsystemgregorian.cpp:345 4548 #: kdecore/kcalendarsystemhebrew.cpp:855 4549 #, fuzzy, kde-format 4550 #| msgid "Friday" 4551 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4552 msgid "Friday" 4553 msgstr "петок" 4554 4555 #: kdecore/kcalendarsystemgregorian.cpp:347 4556 #: kdecore/kcalendarsystemhebrew.cpp:857 4557 #, fuzzy, kde-format 4558 #| msgid "Saturday" 4559 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4560 msgid "Saturday" 4561 msgstr "сабота" 4562 4563 #: kdecore/kcalendarsystemgregorian.cpp:349 4564 #: kdecore/kcalendarsystemhebrew.cpp:859 4565 #, fuzzy, kde-format 4566 #| msgid "Sunday" 4567 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4568 msgid "Sunday" 4569 msgstr "недела" 4570 4571 #: kdecore/kcalendarsystemhebrew.cpp:281 4572 #, kde-format 4573 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4574 msgid "Anno Mundi" 4575 msgstr "" 4576 4577 #: kdecore/kcalendarsystemhebrew.cpp:282 4578 #, kde-format 4579 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4580 msgid "AM" 4581 msgstr "" 4582 4583 #: kdecore/kcalendarsystemhebrew.cpp:283 4584 #, kde-format 4585 msgctxt "" 4586 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4587 msgid "%Ey %EC" 4588 msgstr "" 4589 4590 #: kdecore/kcalendarsystemhebrew.cpp:625 4591 #, kde-format 4592 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4593 msgid "T" 4594 msgstr "" 4595 4596 #: kdecore/kcalendarsystemhebrew.cpp:627 4597 #, kde-format 4598 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4599 msgid "H" 4600 msgstr "" 4601 4602 #: kdecore/kcalendarsystemhebrew.cpp:629 4603 #, kde-format 4604 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4605 msgid "K" 4606 msgstr "" 4607 4608 #: kdecore/kcalendarsystemhebrew.cpp:631 4609 #, kde-format 4610 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4611 msgid "T" 4612 msgstr "" 4613 4614 #: kdecore/kcalendarsystemhebrew.cpp:633 4615 #, kde-format 4616 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4617 msgid "S" 4618 msgstr "" 4619 4620 #: kdecore/kcalendarsystemhebrew.cpp:635 4621 #, fuzzy, kde-format 4622 #| msgid "Av" 4623 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4624 msgid "A" 4625 msgstr "Av" 4626 4627 #: kdecore/kcalendarsystemhebrew.cpp:637 4628 #, kde-format 4629 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4630 msgid "N" 4631 msgstr "" 4632 4633 #: kdecore/kcalendarsystemhebrew.cpp:639 4634 #, kde-format 4635 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4636 msgid "I" 4637 msgstr "" 4638 4639 #: kdecore/kcalendarsystemhebrew.cpp:641 4640 #, kde-format 4641 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4642 msgid "S" 4643 msgstr "" 4644 4645 #: kdecore/kcalendarsystemhebrew.cpp:643 4646 #, kde-format 4647 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4648 msgid "T" 4649 msgstr "" 4650 4651 #: kdecore/kcalendarsystemhebrew.cpp:645 4652 #, fuzzy, kde-format 4653 #| msgid "Av" 4654 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4655 msgid "A" 4656 msgstr "Av" 4657 4658 #: kdecore/kcalendarsystemhebrew.cpp:647 4659 #, kde-format 4660 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4661 msgid "E" 4662 msgstr "" 4663 4664 #: kdecore/kcalendarsystemhebrew.cpp:649 4665 #, fuzzy, kde-format 4666 #| msgid "Av" 4667 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4668 msgid "A" 4669 msgstr "Av" 4670 4671 #: kdecore/kcalendarsystemhebrew.cpp:651 4672 #, fuzzy, kde-format 4673 #| msgid "Av" 4674 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4675 msgid "A" 4676 msgstr "Av" 4677 4678 #: kdecore/kcalendarsystemhebrew.cpp:660 4679 #, fuzzy, kde-format 4680 #| msgctxt "of Tir short" 4681 #| msgid "of Tir" 4682 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4683 msgid "of Tis" 4684 msgstr "од Tir" 4685 4686 #: kdecore/kcalendarsystemhebrew.cpp:662 4687 #, fuzzy, kde-format 4688 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4689 msgid "of Hes" 4690 msgstr "од Meh" 4691 4692 #: kdecore/kcalendarsystemhebrew.cpp:664 4693 #, fuzzy, kde-format 4694 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4695 msgid "of Kis" 4696 msgstr "од Nisan" 4697 4698 #: kdecore/kcalendarsystemhebrew.cpp:666 4699 #, fuzzy, kde-format 4700 #| msgid "of Tevet" 4701 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4702 msgid "of Tev" 4703 msgstr "од Tevet" 4704 4705 #: kdecore/kcalendarsystemhebrew.cpp:668 4706 #, fuzzy, kde-format 4707 #| msgid "of Shvat" 4708 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4709 msgid "of Shv" 4710 msgstr "од Shvat" 4711 4712 #: kdecore/kcalendarsystemhebrew.cpp:670 4713 #, fuzzy, kde-format 4714 #| msgid "of Adar" 4715 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4716 msgid "of Ada" 4717 msgstr "од Adar" 4718 4719 #: kdecore/kcalendarsystemhebrew.cpp:672 4720 #, fuzzy, kde-format 4721 #| msgid "of Nisan" 4722 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4723 msgid "of Nis" 4724 msgstr "од Nisan" 4725 4726 #: kdecore/kcalendarsystemhebrew.cpp:674 4727 #, fuzzy, kde-format 4728 #| msgid "of Iyar" 4729 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4730 msgid "of Iya" 4731 msgstr "од Iyar" 4732 4733 #: kdecore/kcalendarsystemhebrew.cpp:676 4734 #, fuzzy, kde-format 4735 #| msgid "of Sivan" 4736 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4737 msgid "of Siv" 4738 msgstr "од Sivan" 4739 4740 #: kdecore/kcalendarsystemhebrew.cpp:678 4741 #, fuzzy, kde-format 4742 #| msgid "of Tamuz" 4743 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4744 msgid "of Tam" 4745 msgstr "од Tamuz" 4746 4747 #: kdecore/kcalendarsystemhebrew.cpp:680 4748 #, fuzzy, kde-format 4749 #| msgid "of Av" 4750 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4751 msgid "of Av" 4752 msgstr "од Av" 4753 4754 #: kdecore/kcalendarsystemhebrew.cpp:682 4755 #, fuzzy, kde-format 4756 #| msgid "of Elul" 4757 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4758 msgid "of Elu" 4759 msgstr "од Elul" 4760 4761 #: kdecore/kcalendarsystemhebrew.cpp:684 4762 #, fuzzy, kde-format 4763 #| msgid "of Adar" 4764 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4765 msgid "of Ad1" 4766 msgstr "од Adar" 4767 4768 #: kdecore/kcalendarsystemhebrew.cpp:686 4769 #, fuzzy, kde-format 4770 #| msgid "of Adar" 4771 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4772 msgid "of Ad2" 4773 msgstr "од Adar" 4774 4775 #: kdecore/kcalendarsystemhebrew.cpp:695 4776 #, fuzzy, kde-format 4777 #| msgctxt "Tir short" 4778 #| msgid "Tir" 4779 msgctxt "Hebrew month 1 - KLocale::ShortName" 4780 msgid "Tis" 4781 msgstr "Tir" 4782 4783 #: kdecore/kcalendarsystemhebrew.cpp:697 4784 #, fuzzy, kde-format 4785 msgctxt "Hebrew month 2 - KLocale::ShortName" 4786 msgid "Hes" 4787 msgstr "Да" 4788 4789 #: kdecore/kcalendarsystemhebrew.cpp:699 4790 #, fuzzy, kde-format 4791 #| msgid "Kislev" 4792 msgctxt "Hebrew month 3 - KLocale::ShortName" 4793 msgid "Kis" 4794 msgstr "Kislev" 4795 4796 #: kdecore/kcalendarsystemhebrew.cpp:701 4797 #, fuzzy, kde-format 4798 #| msgid "Tevet" 4799 msgctxt "Hebrew month 4 - KLocale::ShortName" 4800 msgid "Tev" 4801 msgstr "Tevet" 4802 4803 #: kdecore/kcalendarsystemhebrew.cpp:703 4804 #, fuzzy, kde-format 4805 #| msgid "Shvat" 4806 msgctxt "Hebrew month 5 - KLocale::ShortName" 4807 msgid "Shv" 4808 msgstr "Shvat" 4809 4810 #: kdecore/kcalendarsystemhebrew.cpp:705 4811 #, fuzzy, kde-format 4812 #| msgid "Adar" 4813 msgctxt "Hebrew month 6 - KLocale::ShortName" 4814 msgid "Ada" 4815 msgstr "Adar" 4816 4817 #: kdecore/kcalendarsystemhebrew.cpp:707 4818 #, fuzzy, kde-format 4819 #| msgid "Nisan" 4820 msgctxt "Hebrew month 7 - KLocale::ShortName" 4821 msgid "Nis" 4822 msgstr "Nisan" 4823 4824 #: kdecore/kcalendarsystemhebrew.cpp:709 4825 #, fuzzy, kde-format 4826 #| msgid "Iyar" 4827 msgctxt "Hebrew month 8 - KLocale::ShortName" 4828 msgid "Iya" 4829 msgstr "Iyar" 4830 4831 #: kdecore/kcalendarsystemhebrew.cpp:711 4832 #, fuzzy, kde-format 4833 #| msgid "Sivan" 4834 msgctxt "Hebrew month 9 - KLocale::ShortName" 4835 msgid "Siv" 4836 msgstr "Sivan" 4837 4838 #: kdecore/kcalendarsystemhebrew.cpp:713 4839 #, fuzzy, kde-format 4840 #| msgid "Tamuz" 4841 msgctxt "Hebrew month 10 - KLocale::ShortName" 4842 msgid "Tam" 4843 msgstr "Tamuz" 4844 4845 #: kdecore/kcalendarsystemhebrew.cpp:715 4846 #, fuzzy, kde-format 4847 #| msgid "Av" 4848 msgctxt "Hebrew month 11 - KLocale::ShortName" 4849 msgid "Av" 4850 msgstr "Av" 4851 4852 #: kdecore/kcalendarsystemhebrew.cpp:717 4853 #, fuzzy, kde-format 4854 #| msgid "Elul" 4855 msgctxt "Hebrew month 12 - KLocale::ShortName" 4856 msgid "Elu" 4857 msgstr "Elul" 4858 4859 #: kdecore/kcalendarsystemhebrew.cpp:719 4860 #, fuzzy, kde-format 4861 #| msgid "Ahd" 4862 msgctxt "Hebrew month 13 - KLocale::ShortName" 4863 msgid "Ad1" 4864 msgstr "Ahd" 4865 4866 #: kdecore/kcalendarsystemhebrew.cpp:721 4867 #, fuzzy, kde-format 4868 #| msgid "Ahd" 4869 msgctxt "Hebrew month 14 - KLocale::ShortName" 4870 msgid "Ad2" 4871 msgstr "Ahd" 4872 4873 #: kdecore/kcalendarsystemhebrew.cpp:730 4874 #, fuzzy, kde-format 4875 #| msgid "of Tishrey" 4876 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4877 msgid "of Tishrey" 4878 msgstr "од Tishrey" 4879 4880 #: kdecore/kcalendarsystemhebrew.cpp:732 4881 #, fuzzy, kde-format 4882 #| msgid "of Heshvan" 4883 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4884 msgid "of Heshvan" 4885 msgstr "од Heshvan" 4886 4887 #: kdecore/kcalendarsystemhebrew.cpp:734 4888 #, fuzzy, kde-format 4889 #| msgid "of Kislev" 4890 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4891 msgid "of Kislev" 4892 msgstr "од Kislev" 4893 4894 #: kdecore/kcalendarsystemhebrew.cpp:736 4895 #, fuzzy, kde-format 4896 #| msgid "of Tevet" 4897 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4898 msgid "of Tevet" 4899 msgstr "од Tevet" 4900 4901 #: kdecore/kcalendarsystemhebrew.cpp:738 4902 #, fuzzy, kde-format 4903 #| msgid "of Shvat" 4904 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4905 msgid "of Shvat" 4906 msgstr "од Shvat" 4907 4908 #: kdecore/kcalendarsystemhebrew.cpp:740 4909 #, fuzzy, kde-format 4910 #| msgid "of Adar" 4911 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4912 msgid "of Adar" 4913 msgstr "од Adar" 4914 4915 #: kdecore/kcalendarsystemhebrew.cpp:742 4916 #, fuzzy, kde-format 4917 #| msgid "of Nisan" 4918 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4919 msgid "of Nisan" 4920 msgstr "од Nisan" 4921 4922 #: kdecore/kcalendarsystemhebrew.cpp:744 4923 #, fuzzy, kde-format 4924 #| msgid "of Iyar" 4925 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4926 msgid "of Iyar" 4927 msgstr "од Iyar" 4928 4929 #: kdecore/kcalendarsystemhebrew.cpp:746 4930 #, fuzzy, kde-format 4931 #| msgid "of Sivan" 4932 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4933 msgid "of Sivan" 4934 msgstr "од Sivan" 4935 4936 #: kdecore/kcalendarsystemhebrew.cpp:748 4937 #, fuzzy, kde-format 4938 #| msgid "of Tamuz" 4939 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4940 msgid "of Tamuz" 4941 msgstr "од Tamuz" 4942 4943 #: kdecore/kcalendarsystemhebrew.cpp:750 4944 #, fuzzy, kde-format 4945 #| msgid "of Av" 4946 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4947 msgid "of Av" 4948 msgstr "од Av" 4949 4950 #: kdecore/kcalendarsystemhebrew.cpp:752 4951 #, fuzzy, kde-format 4952 #| msgid "of Elul" 4953 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4954 msgid "of Elul" 4955 msgstr "од Elul" 4956 4957 #: kdecore/kcalendarsystemhebrew.cpp:754 4958 #, fuzzy, kde-format 4959 #| msgid "of Adar I" 4960 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4961 msgid "of Adar I" 4962 msgstr "од Adar I" 4963 4964 #: kdecore/kcalendarsystemhebrew.cpp:756 4965 #, fuzzy, kde-format 4966 #| msgid "of Adar II" 4967 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4968 msgid "of Adar II" 4969 msgstr "од Adar II" 4970 4971 #: kdecore/kcalendarsystemhebrew.cpp:765 4972 #, fuzzy, kde-format 4973 #| msgid "Tishrey" 4974 msgctxt "Hebrew month 1 - KLocale::LongName" 4975 msgid "Tishrey" 4976 msgstr "Tishrey" 4977 4978 #: kdecore/kcalendarsystemhebrew.cpp:767 4979 #, fuzzy, kde-format 4980 #| msgid "Heshvan" 4981 msgctxt "Hebrew month 2 - KLocale::LongName" 4982 msgid "Heshvan" 4983 msgstr "Heshvan" 4984 4985 #: kdecore/kcalendarsystemhebrew.cpp:769 4986 #, fuzzy, kde-format 4987 #| msgid "Kislev" 4988 msgctxt "Hebrew month 3 - KLocale::LongName" 4989 msgid "Kislev" 4990 msgstr "Kislev" 4991 4992 #: kdecore/kcalendarsystemhebrew.cpp:771 4993 #, fuzzy, kde-format 4994 #| msgid "Tevet" 4995 msgctxt "Hebrew month 4 - KLocale::LongName" 4996 msgid "Tevet" 4997 msgstr "Tevet" 4998 4999 #: kdecore/kcalendarsystemhebrew.cpp:773 5000 #, fuzzy, kde-format 5001 #| msgid "Shvat" 5002 msgctxt "Hebrew month 5 - KLocale::LongName" 5003 msgid "Shvat" 5004 msgstr "Shvat" 5005 5006 #: kdecore/kcalendarsystemhebrew.cpp:775 5007 #, fuzzy, kde-format 5008 #| msgid "Adar" 5009 msgctxt "Hebrew month 6 - KLocale::LongName" 5010 msgid "Adar" 5011 msgstr "Adar" 5012 5013 #: kdecore/kcalendarsystemhebrew.cpp:777 5014 #, fuzzy, kde-format 5015 #| msgid "Nisan" 5016 msgctxt "Hebrew month 7 - KLocale::LongName" 5017 msgid "Nisan" 5018 msgstr "Nisan" 5019 5020 #: kdecore/kcalendarsystemhebrew.cpp:779 5021 #, fuzzy, kde-format 5022 #| msgid "Iyar" 5023 msgctxt "Hebrew month 8 - KLocale::LongName" 5024 msgid "Iyar" 5025 msgstr "Iyar" 5026 5027 #: kdecore/kcalendarsystemhebrew.cpp:781 5028 #, fuzzy, kde-format 5029 #| msgid "Sivan" 5030 msgctxt "Hebrew month 9 - KLocale::LongName" 5031 msgid "Sivan" 5032 msgstr "Sivan" 5033 5034 #: kdecore/kcalendarsystemhebrew.cpp:783 5035 #, fuzzy, kde-format 5036 #| msgid "Tamuz" 5037 msgctxt "Hebrew month 10 - KLocale::LongName" 5038 msgid "Tamuz" 5039 msgstr "Tamuz" 5040 5041 #: kdecore/kcalendarsystemhebrew.cpp:785 5042 #, fuzzy, kde-format 5043 #| msgid "Av" 5044 msgctxt "Hebrew month 11 - KLocale::LongName" 5045 msgid "Av" 5046 msgstr "Av" 5047 5048 #: kdecore/kcalendarsystemhebrew.cpp:787 5049 #, fuzzy, kde-format 5050 #| msgid "Elul" 5051 msgctxt "Hebrew month 12 - KLocale::LongName" 5052 msgid "Elul" 5053 msgstr "Elul" 5054 5055 #: kdecore/kcalendarsystemhebrew.cpp:789 5056 #, fuzzy, kde-format 5057 #| msgid "Adar I" 5058 msgctxt "Hebrew month 13 - KLocale::LongName" 5059 msgid "Adar I" 5060 msgstr "Adar I" 5061 5062 #: kdecore/kcalendarsystemhebrew.cpp:791 5063 #, fuzzy, kde-format 5064 #| msgid "Adar II" 5065 msgctxt "Hebrew month 14 - KLocale::LongName" 5066 msgid "Adar II" 5067 msgstr "Adar II" 5068 5069 #: kdecore/kcalendarsystemindiannational.cpp:66 5070 #, fuzzy, kde-format 5071 #| msgid "Safar" 5072 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5073 msgid "Saka Era" 5074 msgstr "Safar" 5075 5076 #: kdecore/kcalendarsystemindiannational.cpp:67 5077 #, kde-format 5078 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5079 msgid "SE" 5080 msgstr "" 5081 5082 #: kdecore/kcalendarsystemindiannational.cpp:68 5083 #, kde-format 5084 msgctxt "" 5085 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5086 "2000 SE" 5087 msgid "%Ey %EC" 5088 msgstr "" 5089 5090 #: kdecore/kcalendarsystemindiannational.cpp:158 5091 #, kde-format 5092 msgctxt "Indian National month 1 - KLocale::NarrowName" 5093 msgid "C" 5094 msgstr "" 5095 5096 #: kdecore/kcalendarsystemindiannational.cpp:160 5097 #, kde-format 5098 msgctxt "Indian National month 2 - KLocale::NarrowName" 5099 msgid "V" 5100 msgstr "" 5101 5102 #: kdecore/kcalendarsystemindiannational.cpp:162 5103 #, kde-format 5104 msgctxt "Indian National month 3 - KLocale::NarrowName" 5105 msgid "J" 5106 msgstr "" 5107 5108 #: kdecore/kcalendarsystemindiannational.cpp:164 5109 #, fuzzy, kde-format 5110 msgctxt "Indian National month 4 - KLocale::NarrowName" 5111 msgid "Ā" 5112 msgstr "од Kho" 5113 5114 #: kdecore/kcalendarsystemindiannational.cpp:166 5115 #, kde-format 5116 msgctxt "Indian National month 5 - KLocale::NarrowName" 5117 msgid "S" 5118 msgstr "" 5119 5120 #: kdecore/kcalendarsystemindiannational.cpp:168 5121 #, kde-format 5122 msgctxt "Indian National month 6 - KLocale::NarrowName" 5123 msgid "B" 5124 msgstr "" 5125 5126 #: kdecore/kcalendarsystemindiannational.cpp:170 5127 #, fuzzy, kde-format 5128 msgctxt "Indian National month 7 - KLocale::NarrowName" 5129 msgid "Ā" 5130 msgstr "од Kho" 5131 5132 #: kdecore/kcalendarsystemindiannational.cpp:172 5133 #, kde-format 5134 msgctxt "Indian National month 8 - KLocale::NarrowName" 5135 msgid "K" 5136 msgstr "" 5137 5138 #: kdecore/kcalendarsystemindiannational.cpp:174 5139 #, fuzzy, kde-format 5140 #| msgid "Av" 5141 msgctxt "Indian National month 9 - KLocale::NarrowName" 5142 msgid "A" 5143 msgstr "Av" 5144 5145 #: kdecore/kcalendarsystemindiannational.cpp:176 5146 #, kde-format 5147 msgctxt "Indian National month 10 - KLocale::NarrowName" 5148 msgid "P" 5149 msgstr "" 5150 5151 #: kdecore/kcalendarsystemindiannational.cpp:178 5152 #, kde-format 5153 msgctxt "Indian National month 11 - KLocale::NarrowName" 5154 msgid "M" 5155 msgstr "" 5156 5157 #: kdecore/kcalendarsystemindiannational.cpp:180 5158 #, kde-format 5159 msgctxt "Indian National month 12 - KLocale::NarrowName" 5160 msgid "P" 5161 msgstr "" 5162 5163 #: kdecore/kcalendarsystemindiannational.cpp:189 5164 #, fuzzy, kde-format 5165 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5166 msgid "of Cha" 5167 msgstr "од Sha" 5168 5169 #: kdecore/kcalendarsystemindiannational.cpp:191 5170 #, fuzzy, kde-format 5171 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5172 msgid "of Vai" 5173 msgstr "од Far" 5174 5175 #: kdecore/kcalendarsystemindiannational.cpp:193 5176 #, fuzzy, kde-format 5177 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5178 msgid "of Jya" 5179 msgstr "од јан" 5180 5181 #: kdecore/kcalendarsystemindiannational.cpp:195 5182 #, fuzzy, kde-format 5183 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5184 msgid "of Āsh" 5185 msgstr "од Kho" 5186 5187 #: kdecore/kcalendarsystemindiannational.cpp:197 5188 #, fuzzy, kde-format 5189 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5190 msgid "of Shr" 5191 msgstr "од Sha" 5192 5193 #: kdecore/kcalendarsystemindiannational.cpp:199 5194 #, fuzzy, kde-format 5195 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5196 msgid "of Bhā" 5197 msgstr "од Bah" 5198 5199 #: kdecore/kcalendarsystemindiannational.cpp:201 5200 #, fuzzy, kde-format 5201 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5202 msgid "of Āsw" 5203 msgstr "од Esf" 5204 5205 #: kdecore/kcalendarsystemindiannational.cpp:203 5206 #, fuzzy, kde-format 5207 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5208 msgid "of Kār" 5209 msgstr "од Far" 5210 5211 #: kdecore/kcalendarsystemindiannational.cpp:205 5212 #, fuzzy, kde-format 5213 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5214 msgid "of Agr" 5215 msgstr "од апр" 5216 5217 #: kdecore/kcalendarsystemindiannational.cpp:207 5218 #, fuzzy, kde-format 5219 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5220 msgid "of Pau" 5221 msgstr "од Tamuz" 5222 5223 #: kdecore/kcalendarsystemindiannational.cpp:209 5224 #, fuzzy, kde-format 5225 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5226 msgid "of Māg" 5227 msgstr "од Mor" 5228 5229 #: kdecore/kcalendarsystemindiannational.cpp:211 5230 #, fuzzy, kde-format 5231 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5232 msgid "of Phā" 5233 msgstr "од Kho" 5234 5235 #: kdecore/kcalendarsystemindiannational.cpp:220 5236 #, fuzzy, kde-format 5237 msgctxt "Indian National month 1 - KLocale::ShortName" 5238 msgid "Cha" 5239 msgstr "Kha" 5240 5241 #: kdecore/kcalendarsystemindiannational.cpp:222 5242 #, fuzzy, kde-format 5243 msgctxt "Indian National month 2 - KLocale::ShortName" 5244 msgid "Vai" 5245 msgstr "од Far" 5246 5247 #: kdecore/kcalendarsystemindiannational.cpp:224 5248 #, fuzzy, kde-format 5249 msgctxt "Indian National month 3 - KLocale::ShortName" 5250 msgid "Jya" 5251 msgstr "јан" 5252 5253 #: kdecore/kcalendarsystemindiannational.cpp:226 5254 #, fuzzy, kde-format 5255 msgctxt "Indian National month 4 - KLocale::ShortName" 5256 msgid "Āsh" 5257 msgstr "од Kho" 5258 5259 #: kdecore/kcalendarsystemindiannational.cpp:228 5260 #, fuzzy, kde-format 5261 msgctxt "Indian National month 5 - KLocale::ShortName" 5262 msgid "Shr" 5263 msgstr "Sha" 5264 5265 #: kdecore/kcalendarsystemindiannational.cpp:230 5266 #, fuzzy, kde-format 5267 msgctxt "Indian National month 6 - KLocale::ShortName" 5268 msgid "Bhā" 5269 msgstr "од Bah" 5270 5271 #: kdecore/kcalendarsystemindiannational.cpp:232 5272 #, fuzzy, kde-format 5273 msgctxt "Indian National month 7 - KLocale::ShortName" 5274 msgid "Āsw" 5275 msgstr "од Esf" 5276 5277 #: kdecore/kcalendarsystemindiannational.cpp:234 5278 #, fuzzy, kde-format 5279 msgctxt "Indian National month 8 - KLocale::ShortName" 5280 msgid "Kār" 5281 msgstr "од Far" 5282 5283 #: kdecore/kcalendarsystemindiannational.cpp:236 5284 #, fuzzy, kde-format 5285 msgctxt "Indian National month 9 - KLocale::ShortName" 5286 msgid "Agr" 5287 msgstr "Arb" 5288 5289 #: kdecore/kcalendarsystemindiannational.cpp:238 5290 #, fuzzy, kde-format 5291 msgctxt "Indian National month 10 - KLocale::ShortName" 5292 msgid "Pau" 5293 msgstr "Пауза" 5294 5295 #: kdecore/kcalendarsystemindiannational.cpp:240 5296 #, fuzzy, kde-format 5297 msgctxt "Indian National month 11 - KLocale::ShortName" 5298 msgid "Māg" 5299 msgstr "од Mor" 5300 5301 #: kdecore/kcalendarsystemindiannational.cpp:242 5302 #, fuzzy, kde-format 5303 msgctxt "Indian National month 12 - KLocale::ShortName" 5304 msgid "Phā" 5305 msgstr "од Kho" 5306 5307 #: kdecore/kcalendarsystemindiannational.cpp:251 5308 #, fuzzy, kde-format 5309 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5310 msgid "of Chaitra" 5311 msgstr "од Muharram" 5312 5313 #: kdecore/kcalendarsystemindiannational.cpp:253 5314 #, fuzzy, kde-format 5315 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5316 msgid "of Vaishākh" 5317 msgstr "од Far" 5318 5319 #: kdecore/kcalendarsystemindiannational.cpp:255 5320 #, fuzzy, kde-format 5321 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5322 msgid "of Jyaishtha" 5323 msgstr "од Nisan" 5324 5325 #: kdecore/kcalendarsystemindiannational.cpp:257 5326 #, fuzzy, kde-format 5327 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5328 msgid "of Āshādha" 5329 msgstr "од Kho" 5330 5331 #: kdecore/kcalendarsystemindiannational.cpp:259 5332 #, fuzzy, kde-format 5333 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5334 msgid "of Shrāvana" 5335 msgstr "од Shvat" 5336 5337 #: kdecore/kcalendarsystemindiannational.cpp:261 5338 #, fuzzy, kde-format 5339 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5340 msgid "of Bhādrapad" 5341 msgstr "од Khordad" 5342 5343 #: kdecore/kcalendarsystemindiannational.cpp:263 5344 #, fuzzy, kde-format 5345 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5346 msgid "of Āshwin" 5347 msgstr "од Heshvan" 5348 5349 #: kdecore/kcalendarsystemindiannational.cpp:265 5350 #, fuzzy, kde-format 5351 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5352 msgid "of Kārtik" 5353 msgstr "од Far" 5354 5355 #: kdecore/kcalendarsystemindiannational.cpp:267 5356 #, fuzzy, kde-format 5357 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5358 msgid "of Agrahayana" 5359 msgstr "од Bahman" 5360 5361 #: kdecore/kcalendarsystemindiannational.cpp:269 5362 #, fuzzy, kde-format 5363 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5364 msgid "of Paush" 5365 msgstr "од Bah" 5366 5367 #: kdecore/kcalendarsystemindiannational.cpp:271 5368 #, fuzzy, kde-format 5369 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5370 msgid "of Māgh" 5371 msgstr "од Meh" 5372 5373 #: kdecore/kcalendarsystemindiannational.cpp:273 5374 #, fuzzy, kde-format 5375 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5376 msgid "of Phālgun" 5377 msgstr "од Kho" 5378 5379 #: kdecore/kcalendarsystemindiannational.cpp:282 5380 #, fuzzy, kde-format 5381 msgctxt "Indian National month 1 - KLocale::LongName" 5382 msgid "Chaitra" 5383 msgstr "од Muharram" 5384 5385 #: kdecore/kcalendarsystemindiannational.cpp:284 5386 #, fuzzy, kde-format 5387 msgctxt "Indian National month 2 - KLocale::LongName" 5388 msgid "Vaishākh" 5389 msgstr "од Far" 5390 5391 #: kdecore/kcalendarsystemindiannational.cpp:286 5392 #, fuzzy, kde-format 5393 msgctxt "Indian National month 3 - KLocale::LongName" 5394 msgid "Jyaishtha" 5395 msgstr "од Nisan" 5396 5397 #: kdecore/kcalendarsystemindiannational.cpp:288 5398 #, fuzzy, kde-format 5399 msgctxt "Indian National month 4 - KLocale::LongName" 5400 msgid "Āshādha" 5401 msgstr "од Kho" 5402 5403 #: kdecore/kcalendarsystemindiannational.cpp:290 5404 #, fuzzy, kde-format 5405 msgctxt "Indian National month 5 - KLocale::LongName" 5406 msgid "Shrāvana" 5407 msgstr "од Shvat" 5408 5409 #: kdecore/kcalendarsystemindiannational.cpp:292 5410 #, fuzzy, kde-format 5411 msgctxt "Indian National month 6 - KLocale::LongName" 5412 msgid "Bhādrapad" 5413 msgstr "од Khordad" 5414 5415 #: kdecore/kcalendarsystemindiannational.cpp:294 5416 #, fuzzy, kde-format 5417 msgctxt "Indian National month 7 - KLocale::LongName" 5418 msgid "Āshwin" 5419 msgstr "од Heshvan" 5420 5421 #: kdecore/kcalendarsystemindiannational.cpp:296 5422 #, fuzzy, kde-format 5423 msgctxt "Indian National month 8 - KLocale::LongName" 5424 msgid "Kārtik" 5425 msgstr "од Far" 5426 5427 #: kdecore/kcalendarsystemindiannational.cpp:298 5428 #, fuzzy, kde-format 5429 msgctxt "Indian National month 9 - KLocale::LongName" 5430 msgid "Agrahayana" 5431 msgstr "Таана" 5432 5433 #: kdecore/kcalendarsystemindiannational.cpp:300 5434 #, fuzzy, kde-format 5435 msgctxt "Indian National month 10 - KLocale::LongName" 5436 msgid "Paush" 5437 msgstr "Пауза" 5438 5439 #: kdecore/kcalendarsystemindiannational.cpp:302 5440 #, fuzzy, kde-format 5441 msgctxt "Indian National month 11 - KLocale::LongName" 5442 msgid "Māgh" 5443 msgstr "од Meh" 5444 5445 #: kdecore/kcalendarsystemindiannational.cpp:304 5446 #, fuzzy, kde-format 5447 msgctxt "Indian National month 12 - KLocale::LongName" 5448 msgid "Phālgun" 5449 msgstr "од Kho" 5450 5451 #: kdecore/kcalendarsystemindiannational.cpp:317 5452 #, kde-format 5453 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5454 msgid "S" 5455 msgstr "" 5456 5457 #: kdecore/kcalendarsystemindiannational.cpp:319 5458 #, kde-format 5459 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5460 msgid "M" 5461 msgstr "" 5462 5463 #: kdecore/kcalendarsystemindiannational.cpp:321 5464 #, kde-format 5465 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5466 msgid "B" 5467 msgstr "" 5468 5469 #: kdecore/kcalendarsystemindiannational.cpp:323 5470 #, kde-format 5471 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5472 msgid "G" 5473 msgstr "" 5474 5475 #: kdecore/kcalendarsystemindiannational.cpp:325 5476 #, kde-format 5477 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5478 msgid "S" 5479 msgstr "" 5480 5481 #: kdecore/kcalendarsystemindiannational.cpp:327 5482 #, kde-format 5483 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5484 msgid "S" 5485 msgstr "" 5486 5487 #: kdecore/kcalendarsystemindiannational.cpp:329 5488 #, kde-format 5489 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5490 msgid "R" 5491 msgstr "" 5492 5493 #: kdecore/kcalendarsystemindiannational.cpp:338 5494 #, fuzzy, kde-format 5495 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5496 msgid "Som" 5497 msgstr "Jom" 5498 5499 #: kdecore/kcalendarsystemindiannational.cpp:340 5500 #, kde-format 5501 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5502 msgid "Mañ" 5503 msgstr "" 5504 5505 #: kdecore/kcalendarsystemindiannational.cpp:342 5506 #, fuzzy, kde-format 5507 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5508 msgid "Bud" 5509 msgstr "Бухид" 5510 5511 #: kdecore/kcalendarsystemindiannational.cpp:344 5512 #, kde-format 5513 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5514 msgid "Gur" 5515 msgstr "" 5516 5517 #: kdecore/kcalendarsystemindiannational.cpp:346 5518 #, fuzzy, kde-format 5519 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5520 msgid "Suk" 5521 msgstr "нед" 5522 5523 #: kdecore/kcalendarsystemindiannational.cpp:348 5524 #, fuzzy, kde-format 5525 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5526 msgid "San" 5527 msgstr "Sivan" 5528 5529 #: kdecore/kcalendarsystemindiannational.cpp:350 5530 #, kde-format 5531 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5532 msgid "Rav" 5533 msgstr "" 5534 5535 #: kdecore/kcalendarsystemindiannational.cpp:357 5536 #, kde-format 5537 msgctxt "Indian National weekday 1 - KLocale::LongName" 5538 msgid "Somavãra" 5539 msgstr "" 5540 5541 #: kdecore/kcalendarsystemindiannational.cpp:359 5542 #, kde-format 5543 msgctxt "Indian National weekday 2 - KLocale::LongName" 5544 msgid "Mañgalvã" 5545 msgstr "" 5546 5547 #: kdecore/kcalendarsystemindiannational.cpp:361 5548 #, kde-format 5549 msgctxt "Indian National weekday 3 - KLocale::LongName" 5550 msgid "Budhavãra" 5551 msgstr "" 5552 5553 #: kdecore/kcalendarsystemindiannational.cpp:363 5554 #, kde-format 5555 msgctxt "Indian National weekday 4 - KLocale::LongName" 5556 msgid "Guruvãra" 5557 msgstr "" 5558 5559 #: kdecore/kcalendarsystemindiannational.cpp:365 5560 #, kde-format 5561 msgctxt "Indian National weekday 5 - KLocale::LongName" 5562 msgid "Sukravãra" 5563 msgstr "" 5564 5565 #: kdecore/kcalendarsystemindiannational.cpp:367 5566 #, kde-format 5567 msgctxt "Indian National weekday 6 - KLocale::LongName" 5568 msgid "Sanivãra" 5569 msgstr "" 5570 5571 #: kdecore/kcalendarsystemindiannational.cpp:369 5572 #, kde-format 5573 msgctxt "Indian National weekday 7 - KLocale::LongName" 5574 msgid "Raviãra" 5575 msgstr "" 5576 5577 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5578 #, kde-format 5579 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5580 msgid "Anno Hegirae" 5581 msgstr "" 5582 5583 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5584 #, kde-format 5585 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5586 msgid "AH" 5587 msgstr "" 5588 5589 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5590 #, kde-format 5591 msgctxt "" 5592 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5593 msgid "%Ey %EC" 5594 msgstr "" 5595 5596 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5597 #, kde-format 5598 msgctxt "Hijri month 1 - KLocale::NarrowName" 5599 msgid "M" 5600 msgstr "" 5601 5602 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5603 #, kde-format 5604 msgctxt "Hijri month 2 - KLocale::NarrowName" 5605 msgid "S" 5606 msgstr "" 5607 5608 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5609 #, fuzzy, kde-format 5610 #| msgid "Av" 5611 msgctxt "Hijri month 3 - KLocale::NarrowName" 5612 msgid "A" 5613 msgstr "Av" 5614 5615 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5616 #, kde-format 5617 msgctxt "Hijri month 4 - KLocale::NarrowName" 5618 msgid "T" 5619 msgstr "" 5620 5621 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5622 #, fuzzy, kde-format 5623 #| msgid "Av" 5624 msgctxt "Hijri month 5 - KLocale::NarrowName" 5625 msgid "A" 5626 msgstr "Av" 5627 5628 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5629 #, kde-format 5630 msgctxt "Hijri month 6 - KLocale::NarrowName" 5631 msgid "T" 5632 msgstr "" 5633 5634 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5635 #, kde-format 5636 msgctxt "Hijri month 7 - KLocale::NarrowName" 5637 msgid "R" 5638 msgstr "" 5639 5640 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5641 #, kde-format 5642 msgctxt "Hijri month 8 - KLocale::NarrowName" 5643 msgid "S" 5644 msgstr "" 5645 5646 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5647 #, kde-format 5648 msgctxt "Hijri month 9 - KLocale::NarrowName" 5649 msgid "R" 5650 msgstr "" 5651 5652 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5653 #, kde-format 5654 msgctxt "Hijri month 10 - KLocale::NarrowName" 5655 msgid "S" 5656 msgstr "" 5657 5658 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5659 #, kde-format 5660 msgctxt "Hijri month 11 - KLocale::NarrowName" 5661 msgid "Q" 5662 msgstr "" 5663 5664 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5665 #, kde-format 5666 msgctxt "Hijri month 12 - KLocale::NarrowName" 5667 msgid "H" 5668 msgstr "" 5669 5670 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5671 #, fuzzy, kde-format 5672 #| msgctxt "of Mehr short" 5673 #| msgid "of Meh" 5674 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5675 msgid "of Muh" 5676 msgstr "од Meh" 5677 5678 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5679 #, fuzzy, kde-format 5680 #| msgid "of Safar" 5681 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5682 msgid "of Saf" 5683 msgstr "од Safar" 5684 5685 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5686 #, fuzzy, kde-format 5687 #| msgid "of R. Awal" 5688 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5689 msgid "of R.A" 5690 msgstr "од R. Awal" 5691 5692 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5693 #, fuzzy, kde-format 5694 #| msgid "of R. Thaani" 5695 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5696 msgid "of R.T" 5697 msgstr "од R. Thaani" 5698 5699 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5700 #, fuzzy, kde-format 5701 #| msgid "of J. Awal" 5702 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5703 msgid "of J.A" 5704 msgstr "од J. Awal" 5705 5706 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5707 #, fuzzy, kde-format 5708 #| msgid "of J. Thaani" 5709 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5710 msgid "of J.T" 5711 msgstr "од J. Thaani" 5712 5713 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5714 #, fuzzy, kde-format 5715 #| msgid "of Rajab" 5716 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5717 msgid "of Raj" 5718 msgstr "од Rajab" 5719 5720 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5721 #, fuzzy, kde-format 5722 #| msgctxt "of Shahrivar short" 5723 #| msgid "of Sha" 5724 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5725 msgid "of Sha" 5726 msgstr "од Sha" 5727 5728 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5729 #, fuzzy, kde-format 5730 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5731 msgid "of Ram" 5732 msgstr "од Tamuz" 5733 5734 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5735 #, fuzzy, kde-format 5736 #| msgctxt "of Shahrivar short" 5737 #| msgid "of Sha" 5738 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5739 msgid "of Shw" 5740 msgstr "од Sha" 5741 5742 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5743 #, fuzzy, kde-format 5744 #| msgid "of Qi`dah" 5745 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5746 msgid "of Qid" 5747 msgstr "од Qi`dah" 5748 5749 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5750 #, fuzzy, kde-format 5751 #| msgid "of Hijjah" 5752 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5753 msgid "of Hij" 5754 msgstr "од Hijjah" 5755 5756 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5757 #, fuzzy, kde-format 5758 #| msgctxt "Mehr short" 5759 #| msgid "Meh" 5760 msgctxt "Hijri month 1 - KLocale::ShortName" 5761 msgid "Muh" 5762 msgstr "Meh" 5763 5764 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5765 #, fuzzy, kde-format 5766 #| msgid "Safar" 5767 msgctxt "Hijri month 2 - KLocale::ShortName" 5768 msgid "Saf" 5769 msgstr "Safar" 5770 5771 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5772 #, fuzzy, kde-format 5773 #| msgid "R. Awal" 5774 msgctxt "Hijri month 3 - KLocale::ShortName" 5775 msgid "R.A" 5776 msgstr "R. Awal" 5777 5778 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5779 #, kde-format 5780 msgctxt "Hijri month 4 - KLocale::ShortName" 5781 msgid "R.T" 5782 msgstr "" 5783 5784 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5785 #, fuzzy, kde-format 5786 #| msgid "J. Awal" 5787 msgctxt "Hijri month 5 - KLocale::ShortName" 5788 msgid "J.A" 5789 msgstr "J. Awal" 5790 5791 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5792 #, kde-format 5793 msgctxt "Hijri month 6 - KLocale::ShortName" 5794 msgid "J.T" 5795 msgstr "" 5796 5797 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5798 #, fuzzy, kde-format 5799 #| msgid "Rajab" 5800 msgctxt "Hijri month 7 - KLocale::ShortName" 5801 msgid "Raj" 5802 msgstr "Rajab" 5803 5804 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5805 #, fuzzy, kde-format 5806 #| msgctxt "Shahrivar short" 5807 #| msgid "Sha" 5808 msgctxt "Hijri month 8 - KLocale::ShortName" 5809 msgid "Sha" 5810 msgstr "Sha" 5811 5812 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5813 #, fuzzy, kde-format 5814 msgctxt "Hijri month 9 - KLocale::ShortName" 5815 msgid "Ram" 5816 msgstr "am" 5817 5818 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5819 #, fuzzy, kde-format 5820 #| msgctxt "Shahrivar short" 5821 #| msgid "Sha" 5822 msgctxt "Hijri month 10 - KLocale::ShortName" 5823 msgid "Shw" 5824 msgstr "Sha" 5825 5826 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5827 #, fuzzy, kde-format 5828 #| msgid "Qi`dah" 5829 msgctxt "Hijri month 11 - KLocale::ShortName" 5830 msgid "Qid" 5831 msgstr "Qi`dah" 5832 5833 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5834 #, fuzzy, kde-format 5835 #| msgctxt "@item Calendar system" 5836 #| msgid "Hijri" 5837 msgctxt "Hijri month 12 - KLocale::ShortName" 5838 msgid "Hij" 5839 msgstr "Хиџри" 5840 5841 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5842 #, fuzzy, kde-format 5843 #| msgid "of Muharram" 5844 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5845 msgid "of Muharram" 5846 msgstr "од Muharram" 5847 5848 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5849 #, fuzzy, kde-format 5850 #| msgid "of Safar" 5851 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5852 msgid "of Safar" 5853 msgstr "од Safar" 5854 5855 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5856 #, fuzzy, kde-format 5857 #| msgid "of Rabi` al-Awal" 5858 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5859 msgid "of Rabi` al-Awal" 5860 msgstr "од Rabi` al-Awal" 5861 5862 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5863 #, fuzzy, kde-format 5864 #| msgid "of Rabi` al-Thaani" 5865 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5866 msgid "of Rabi` al-Thaani" 5867 msgstr "од Rabi` al-Thaani" 5868 5869 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5870 #, fuzzy, kde-format 5871 #| msgid "of Jumaada al-Awal" 5872 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5873 msgid "of Jumaada al-Awal" 5874 msgstr "од Jumaada al-Awal" 5875 5876 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5877 #, fuzzy, kde-format 5878 #| msgid "of Jumaada al-Thaani" 5879 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5880 msgid "of Jumaada al-Thaani" 5881 msgstr "од Jumaada al-Thaani" 5882 5883 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5884 #, fuzzy, kde-format 5885 #| msgid "of Rajab" 5886 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5887 msgid "of Rajab" 5888 msgstr "од Rajab" 5889 5890 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5891 #, fuzzy, kde-format 5892 #| msgid "of Sha`ban" 5893 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5894 msgid "of Sha`ban" 5895 msgstr "од Sha`ban" 5896 5897 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5898 #, fuzzy, kde-format 5899 #| msgid "of Ramadan" 5900 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5901 msgid "of Ramadan" 5902 msgstr "од Ramadan" 5903 5904 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5905 #, fuzzy, kde-format 5906 #| msgid "of Shawwal" 5907 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5908 msgid "of Shawwal" 5909 msgstr "од Shawwal" 5910 5911 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5912 #, fuzzy, kde-format 5913 #| msgid "of Thu al-Qi`dah" 5914 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5915 msgid "of Thu al-Qi`dah" 5916 msgstr "од Thu al-Qi`dah" 5917 5918 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5919 #, fuzzy, kde-format 5920 #| msgid "of Thu al-Hijjah" 5921 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5922 msgid "of Thu al-Hijjah" 5923 msgstr "од Thu al-Hijjah" 5924 5925 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5926 #, fuzzy, kde-format 5927 #| msgid "Muharram" 5928 msgctxt "Hijri month 1 - KLocale::LongName" 5929 msgid "Muharram" 5930 msgstr "Muharram" 5931 5932 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5933 #, fuzzy, kde-format 5934 #| msgid "Safar" 5935 msgctxt "Hijri month 2 - KLocale::LongName" 5936 msgid "Safar" 5937 msgstr "Safar" 5938 5939 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5940 #, fuzzy, kde-format 5941 #| msgid "Rabi` al-Awal" 5942 msgctxt "Hijri month 3 - KLocale::LongName" 5943 msgid "Rabi` al-Awal" 5944 msgstr "Rabi` al-Awal" 5945 5946 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5947 #, fuzzy, kde-format 5948 #| msgid "Rabi` al-Thaani" 5949 msgctxt "Hijri month 4 - KLocale::LongName" 5950 msgid "Rabi` al-Thaani" 5951 msgstr "Rabi` al-Thaani" 5952 5953 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5954 #, fuzzy, kde-format 5955 #| msgid "Jumaada al-Awal" 5956 msgctxt "Hijri month 5 - KLocale::LongName" 5957 msgid "Jumaada al-Awal" 5958 msgstr "Jumaada al-Awal" 5959 5960 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5961 #, fuzzy, kde-format 5962 #| msgid "Jumaada al-Thaani" 5963 msgctxt "Hijri month 6 - KLocale::LongName" 5964 msgid "Jumaada al-Thaani" 5965 msgstr "Jumaada al-Thaani" 5966 5967 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5968 #, fuzzy, kde-format 5969 #| msgid "Rajab" 5970 msgctxt "Hijri month 7 - KLocale::LongName" 5971 msgid "Rajab" 5972 msgstr "Rajab" 5973 5974 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5975 #, fuzzy, kde-format 5976 #| msgid "Sha`ban" 5977 msgctxt "Hijri month 8 - KLocale::LongName" 5978 msgid "Sha`ban" 5979 msgstr "Sha`ban" 5980 5981 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5982 #, fuzzy, kde-format 5983 #| msgid "Ramadan" 5984 msgctxt "Hijri month 9 - KLocale::LongName" 5985 msgid "Ramadan" 5986 msgstr "Ramadan" 5987 5988 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5989 #, fuzzy, kde-format 5990 #| msgid "Shawwal" 5991 msgctxt "Hijri month 10 - KLocale::LongName" 5992 msgid "Shawwal" 5993 msgstr "Shawwal" 5994 5995 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5996 #, fuzzy, kde-format 5997 #| msgid "Thu al-Qi`dah" 5998 msgctxt "Hijri month 11 - KLocale::LongName" 5999 msgid "Thu al-Qi`dah" 6000 msgstr "Thu al-Qi`dah" 6001 6002 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6003 #, fuzzy, kde-format 6004 #| msgid "Thu al-Hijjah" 6005 msgctxt "Hijri month 12 - KLocale::LongName" 6006 msgid "Thu al-Hijjah" 6007 msgstr "Thu al-Hijjah" 6008 6009 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6010 #, kde-format 6011 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6012 msgid "I" 6013 msgstr "" 6014 6015 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6016 #, kde-format 6017 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6018 msgid "T" 6019 msgstr "" 6020 6021 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6022 #, fuzzy, kde-format 6023 #| msgid "Av" 6024 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6025 msgid "A" 6026 msgstr "Av" 6027 6028 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6029 #, kde-format 6030 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6031 msgid "K" 6032 msgstr "" 6033 6034 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6035 #, kde-format 6036 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6037 msgid "J" 6038 msgstr "" 6039 6040 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6041 #, kde-format 6042 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6043 msgid "S" 6044 msgstr "" 6045 6046 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6047 #, fuzzy, kde-format 6048 #| msgid "Av" 6049 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6050 msgid "A" 6051 msgstr "Av" 6052 6053 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6054 #, fuzzy, kde-format 6055 #| msgid "Ith" 6056 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6057 msgid "Ith" 6058 msgstr "Ith" 6059 6060 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6061 #, fuzzy, kde-format 6062 #| msgid "Thl" 6063 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6064 msgid "Thl" 6065 msgstr "Thl" 6066 6067 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6068 #, fuzzy, kde-format 6069 #| msgid "Arb" 6070 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6071 msgid "Arb" 6072 msgstr "Arb" 6073 6074 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6075 #, fuzzy, kde-format 6076 #| msgid "Kha" 6077 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6078 msgid "Kha" 6079 msgstr "Kha" 6080 6081 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6082 #, fuzzy, kde-format 6083 #| msgid "Jum" 6084 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6085 msgid "Jum" 6086 msgstr "Jum" 6087 6088 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6089 #, fuzzy, kde-format 6090 #| msgid "Sab" 6091 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6092 msgid "Sab" 6093 msgstr "Sab" 6094 6095 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6096 #, fuzzy, kde-format 6097 #| msgid "Ahd" 6098 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6099 msgid "Ahd" 6100 msgstr "Ahd" 6101 6102 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6103 #, fuzzy, kde-format 6104 #| msgid "Yaum al-Ithnain" 6105 msgctxt "Hijri weekday 1 - KLocale::LongName" 6106 msgid "Yaum al-Ithnain" 6107 msgstr "Yaum al-Ithnain" 6108 6109 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6110 #, fuzzy, kde-format 6111 #| msgid "Yau al-Thulatha" 6112 msgctxt "Hijri weekday 2 - KLocale::LongName" 6113 msgid "Yau al-Thulatha" 6114 msgstr "Yau al-Thulatha" 6115 6116 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6117 #, fuzzy, kde-format 6118 #| msgid "Yaum al-Arbi'a" 6119 msgctxt "Hijri weekday 3 - KLocale::LongName" 6120 msgid "Yaum al-Arbi'a" 6121 msgstr "Yaum al-Arbi'a" 6122 6123 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6124 #, fuzzy, kde-format 6125 #| msgid "Yaum al-Khamees" 6126 msgctxt "Hijri weekday 4 - KLocale::LongName" 6127 msgid "Yaum al-Khamees" 6128 msgstr "Yaum al-Khamees" 6129 6130 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6131 #, fuzzy, kde-format 6132 #| msgid "Yaum al-Jumma" 6133 msgctxt "Hijri weekday 5 - KLocale::LongName" 6134 msgid "Yaum al-Jumma" 6135 msgstr "Yaum al-Jumma" 6136 6137 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6138 #, fuzzy, kde-format 6139 #| msgid "Yaum al-Sabt" 6140 msgctxt "Hijri weekday 6 - KLocale::LongName" 6141 msgid "Yaum al-Sabt" 6142 msgstr "Yaum al-Sabt" 6143 6144 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6145 #, fuzzy, kde-format 6146 #| msgid "Yaum al-Ahad" 6147 msgctxt "Hijri weekday 7 - KLocale::LongName" 6148 msgid "Yaum al-Ahad" 6149 msgstr "Yaum al-Ahad" 6150 6151 #: kdecore/kcalendarsystemjalali.cpp:74 6152 #, kde-format 6153 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6154 msgid "Anno Persico" 6155 msgstr "" 6156 6157 #: kdecore/kcalendarsystemjalali.cpp:75 6158 #, kde-format 6159 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6160 msgid "AP" 6161 msgstr "" 6162 6163 #: kdecore/kcalendarsystemjalali.cpp:76 6164 #, kde-format 6165 msgctxt "" 6166 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6167 msgid "%Ey %EC" 6168 msgstr "" 6169 6170 #: kdecore/kcalendarsystemjalali.cpp:172 6171 #, kde-format 6172 msgctxt "Jalali month 1 - KLocale::NarrowName" 6173 msgid "F" 6174 msgstr "" 6175 6176 #: kdecore/kcalendarsystemjalali.cpp:174 6177 #, kde-format 6178 msgctxt "Jalali month 2 - KLocale::NarrowName" 6179 msgid "O" 6180 msgstr "" 6181 6182 #: kdecore/kcalendarsystemjalali.cpp:176 6183 #, kde-format 6184 msgctxt "Jalali month 3 - KLocale::NarrowName" 6185 msgid "K" 6186 msgstr "" 6187 6188 #: kdecore/kcalendarsystemjalali.cpp:178 6189 #, kde-format 6190 msgctxt "Jalali month 4 - KLocale::NarrowName" 6191 msgid "T" 6192 msgstr "" 6193 6194 #: kdecore/kcalendarsystemjalali.cpp:180 6195 #, kde-format 6196 msgctxt "Jalali month 5 - KLocale::NarrowName" 6197 msgid "M" 6198 msgstr "" 6199 6200 #: kdecore/kcalendarsystemjalali.cpp:182 6201 #, kde-format 6202 msgctxt "Jalali month 6 - KLocale::NarrowName" 6203 msgid "S" 6204 msgstr "" 6205 6206 #: kdecore/kcalendarsystemjalali.cpp:184 6207 #, kde-format 6208 msgctxt "Jalali month 7 - KLocale::NarrowName" 6209 msgid "M" 6210 msgstr "" 6211 6212 #: kdecore/kcalendarsystemjalali.cpp:186 6213 #, fuzzy, kde-format 6214 #| msgid "Av" 6215 msgctxt "Jalali month 8 - KLocale::NarrowName" 6216 msgid "A" 6217 msgstr "Av" 6218 6219 #: kdecore/kcalendarsystemjalali.cpp:188 6220 #, fuzzy, kde-format 6221 #| msgid "Av" 6222 msgctxt "Jalali month 9 - KLocale::NarrowName" 6223 msgid "A" 6224 msgstr "Av" 6225 6226 #: kdecore/kcalendarsystemjalali.cpp:190 6227 #, kde-format 6228 msgctxt "Jalali month 10 - KLocale::NarrowName" 6229 msgid "D" 6230 msgstr "" 6231 6232 #: kdecore/kcalendarsystemjalali.cpp:192 6233 #, kde-format 6234 msgctxt "Jalali month 11 - KLocale::NarrowName" 6235 msgid "B" 6236 msgstr "" 6237 6238 #: kdecore/kcalendarsystemjalali.cpp:194 6239 #, kde-format 6240 msgctxt "Jalali month 12 - KLocale::NarrowName" 6241 msgid "E" 6242 msgstr "" 6243 6244 #: kdecore/kcalendarsystemjalali.cpp:203 6245 #, fuzzy, kde-format 6246 #| msgctxt "of Farvardin short" 6247 #| msgid "of Far" 6248 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6249 msgid "of Far" 6250 msgstr "од Far" 6251 6252 #: kdecore/kcalendarsystemjalali.cpp:205 6253 #, fuzzy, kde-format 6254 #| msgctxt "of Ordibehesht short" 6255 #| msgid "of Ord" 6256 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6257 msgid "of Ord" 6258 msgstr "од Ord" 6259 6260 #: kdecore/kcalendarsystemjalali.cpp:207 6261 #, fuzzy, kde-format 6262 #| msgctxt "of Khordad short" 6263 #| msgid "of Kho" 6264 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6265 msgid "of Kho" 6266 msgstr "од Kho" 6267 6268 #: kdecore/kcalendarsystemjalali.cpp:209 6269 #, fuzzy, kde-format 6270 #| msgctxt "of Tir short" 6271 #| msgid "of Tir" 6272 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6273 msgid "of Tir" 6274 msgstr "од Tir" 6275 6276 #: kdecore/kcalendarsystemjalali.cpp:211 6277 #, fuzzy, kde-format 6278 #| msgctxt "of Mordad short" 6279 #| msgid "of Mor" 6280 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6281 msgid "of Mor" 6282 msgstr "од Mor" 6283 6284 #: kdecore/kcalendarsystemjalali.cpp:213 6285 #, fuzzy, kde-format 6286 #| msgctxt "of Shahrivar short" 6287 #| msgid "of Sha" 6288 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6289 msgid "of Sha" 6290 msgstr "од Sha" 6291 6292 #: kdecore/kcalendarsystemjalali.cpp:215 6293 #, fuzzy, kde-format 6294 #| msgctxt "of Mehr short" 6295 #| msgid "of Meh" 6296 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6297 msgid "of Meh" 6298 msgstr "од Meh" 6299 6300 #: kdecore/kcalendarsystemjalali.cpp:217 6301 #, fuzzy, kde-format 6302 #| msgctxt "of Aban short" 6303 #| msgid "of Aba" 6304 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6305 msgid "of Aba" 6306 msgstr "од Aba" 6307 6308 #: kdecore/kcalendarsystemjalali.cpp:219 6309 #, fuzzy, kde-format 6310 #| msgctxt "of Azar short" 6311 #| msgid "of Aza" 6312 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6313 msgid "of Aza" 6314 msgstr "од Aza" 6315 6316 #: kdecore/kcalendarsystemjalali.cpp:221 6317 #, fuzzy, kde-format 6318 #| msgctxt "of Dei short" 6319 #| msgid "of Dei" 6320 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6321 msgid "of Dei" 6322 msgstr "од Dei" 6323 6324 #: kdecore/kcalendarsystemjalali.cpp:223 6325 #, fuzzy, kde-format 6326 #| msgctxt "of Bahman short" 6327 #| msgid "of Bah" 6328 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6329 msgid "of Bah" 6330 msgstr "од Bah" 6331 6332 #: kdecore/kcalendarsystemjalali.cpp:225 6333 #, fuzzy, kde-format 6334 #| msgctxt "of Esfand short" 6335 #| msgid "of Esf" 6336 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6337 msgid "of Esf" 6338 msgstr "од Esf" 6339 6340 #: kdecore/kcalendarsystemjalali.cpp:234 6341 #, fuzzy, kde-format 6342 #| msgctxt "Farvardin short" 6343 #| msgid "Far" 6344 msgctxt "Jalali month 1 - KLocale::ShortName" 6345 msgid "Far" 6346 msgstr "Far" 6347 6348 #: kdecore/kcalendarsystemjalali.cpp:236 6349 #, fuzzy, kde-format 6350 #| msgctxt "Ordibehesht short" 6351 #| msgid "Ord" 6352 msgctxt "Jalali month 2 - KLocale::ShortName" 6353 msgid "Ord" 6354 msgstr "Ord" 6355 6356 #: kdecore/kcalendarsystemjalali.cpp:238 6357 #, fuzzy, kde-format 6358 #| msgctxt "Khordad short" 6359 #| msgid "Kho" 6360 msgctxt "Jalali month 3 - KLocale::ShortName" 6361 msgid "Kho" 6362 msgstr "Kho" 6363 6364 #: kdecore/kcalendarsystemjalali.cpp:240 6365 #, fuzzy, kde-format 6366 #| msgctxt "Tir short" 6367 #| msgid "Tir" 6368 msgctxt "Jalali month 4 - KLocale::ShortName" 6369 msgid "Tir" 6370 msgstr "Tir" 6371 6372 #: kdecore/kcalendarsystemjalali.cpp:242 6373 #, fuzzy, kde-format 6374 #| msgctxt "Mordad short" 6375 #| msgid "Mor" 6376 msgctxt "Jalali month 5 - KLocale::ShortName" 6377 msgid "Mor" 6378 msgstr "Mor" 6379 6380 #: kdecore/kcalendarsystemjalali.cpp:244 6381 #, fuzzy, kde-format 6382 #| msgctxt "Shahrivar short" 6383 #| msgid "Sha" 6384 msgctxt "Jalali month 6 - KLocale::ShortName" 6385 msgid "Sha" 6386 msgstr "Sha" 6387 6388 #: kdecore/kcalendarsystemjalali.cpp:246 6389 #, fuzzy, kde-format 6390 #| msgctxt "Mehr short" 6391 #| msgid "Meh" 6392 msgctxt "Jalali month 7 - KLocale::ShortName" 6393 msgid "Meh" 6394 msgstr "Meh" 6395 6396 #: kdecore/kcalendarsystemjalali.cpp:248 6397 #, fuzzy, kde-format 6398 #| msgctxt "Aban short" 6399 #| msgid "Aba" 6400 msgctxt "Jalali month 8 - KLocale::ShortName" 6401 msgid "Aba" 6402 msgstr "Aba" 6403 6404 #: kdecore/kcalendarsystemjalali.cpp:250 6405 #, fuzzy, kde-format 6406 #| msgctxt "Azar short" 6407 #| msgid "Aza" 6408 msgctxt "Jalali month 9 - KLocale::ShortName" 6409 msgid "Aza" 6410 msgstr "Aza" 6411 6412 #: kdecore/kcalendarsystemjalali.cpp:252 6413 #, fuzzy, kde-format 6414 #| msgctxt "Dei short" 6415 #| msgid "Dei" 6416 msgctxt "Jalali month 10 - KLocale::ShortName" 6417 msgid "Dei" 6418 msgstr "Dei" 6419 6420 #: kdecore/kcalendarsystemjalali.cpp:254 6421 #, fuzzy, kde-format 6422 #| msgctxt "Bahman short" 6423 #| msgid "Bah" 6424 msgctxt "Jalali month 11 - KLocale::ShortName" 6425 msgid "Bah" 6426 msgstr "Bah" 6427 6428 #: kdecore/kcalendarsystemjalali.cpp:256 6429 #, fuzzy, kde-format 6430 #| msgctxt "Esfand" 6431 #| msgid "Esf" 6432 msgctxt "Jalali month 12 - KLocale::ShortName" 6433 msgid "Esf" 6434 msgstr "Esf" 6435 6436 #: kdecore/kcalendarsystemjalali.cpp:265 6437 #, fuzzy, kde-format 6438 #| msgid "of Farvardin" 6439 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6440 msgid "of Farvardin" 6441 msgstr "од Farvardin" 6442 6443 #: kdecore/kcalendarsystemjalali.cpp:267 6444 #, fuzzy, kde-format 6445 #| msgid "of Ordibehesht" 6446 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6447 msgid "of Ordibehesht" 6448 msgstr "од Ordibehesht" 6449 6450 #: kdecore/kcalendarsystemjalali.cpp:269 6451 #, fuzzy, kde-format 6452 #| msgid "of Khordad" 6453 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6454 msgid "of Khordad" 6455 msgstr "од Khordad" 6456 6457 #: kdecore/kcalendarsystemjalali.cpp:271 6458 #, fuzzy, kde-format 6459 #| msgctxt "of Tir short" 6460 #| msgid "of Tir" 6461 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6462 msgid "of Tir" 6463 msgstr "од Tir" 6464 6465 #: kdecore/kcalendarsystemjalali.cpp:273 6466 #, fuzzy, kde-format 6467 #| msgid "of Mordad" 6468 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6469 msgid "of Mordad" 6470 msgstr "од Mordad" 6471 6472 #: kdecore/kcalendarsystemjalali.cpp:275 6473 #, fuzzy, kde-format 6474 #| msgid "of Shahrivar" 6475 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6476 msgid "of Shahrivar" 6477 msgstr "од Shahrivar" 6478 6479 #: kdecore/kcalendarsystemjalali.cpp:277 6480 #, fuzzy, kde-format 6481 #| msgid "of Mehr" 6482 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6483 msgid "of Mehr" 6484 msgstr "од Mehr" 6485 6486 #: kdecore/kcalendarsystemjalali.cpp:279 6487 #, fuzzy, kde-format 6488 #| msgid "of Aban" 6489 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6490 msgid "of Aban" 6491 msgstr "од Aban" 6492 6493 #: kdecore/kcalendarsystemjalali.cpp:281 6494 #, fuzzy, kde-format 6495 #| msgid "of Azar" 6496 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6497 msgid "of Azar" 6498 msgstr "од Azar" 6499 6500 #: kdecore/kcalendarsystemjalali.cpp:283 6501 #, fuzzy, kde-format 6502 #| msgctxt "of Dei short" 6503 #| msgid "of Dei" 6504 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6505 msgid "of Dei" 6506 msgstr "од Dei" 6507 6508 #: kdecore/kcalendarsystemjalali.cpp:285 6509 #, fuzzy, kde-format 6510 #| msgid "of Bahman" 6511 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6512 msgid "of Bahman" 6513 msgstr "од Bahman" 6514 6515 #: kdecore/kcalendarsystemjalali.cpp:287 6516 #, fuzzy, kde-format 6517 #| msgid "of Esfand" 6518 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6519 msgid "of Esfand" 6520 msgstr "од Esfand" 6521 6522 #: kdecore/kcalendarsystemjalali.cpp:296 6523 #, fuzzy, kde-format 6524 #| msgid "Farvardin" 6525 msgctxt "Jalali month 1 - KLocale::LongName" 6526 msgid "Farvardin" 6527 msgstr "Farvardin" 6528 6529 #: kdecore/kcalendarsystemjalali.cpp:298 6530 #, fuzzy, kde-format 6531 #| msgid "Ordibehesht" 6532 msgctxt "Jalali month 2 - KLocale::LongName" 6533 msgid "Ordibehesht" 6534 msgstr "Ordibehesht" 6535 6536 #: kdecore/kcalendarsystemjalali.cpp:300 6537 #, fuzzy, kde-format 6538 #| msgid "Khordad" 6539 msgctxt "Jalali month 3 - KLocale::LongName" 6540 msgid "Khordad" 6541 msgstr "Khordad" 6542 6543 #: kdecore/kcalendarsystemjalali.cpp:302 6544 #, fuzzy, kde-format 6545 #| msgctxt "Tir short" 6546 #| msgid "Tir" 6547 msgctxt "Jalali month 4 - KLocale::LongName" 6548 msgid "Tir" 6549 msgstr "Tir" 6550 6551 #: kdecore/kcalendarsystemjalali.cpp:304 6552 #, fuzzy, kde-format 6553 #| msgid "Mordad" 6554 msgctxt "Jalali month 5 - KLocale::LongName" 6555 msgid "Mordad" 6556 msgstr "Mordad" 6557 6558 #: kdecore/kcalendarsystemjalali.cpp:306 6559 #, fuzzy, kde-format 6560 #| msgid "Shahrivar" 6561 msgctxt "Jalali month 6 - KLocale::LongName" 6562 msgid "Shahrivar" 6563 msgstr "Shahrivar" 6564 6565 #: kdecore/kcalendarsystemjalali.cpp:308 6566 #, fuzzy, kde-format 6567 #| msgid "Mehr" 6568 msgctxt "Jalali month 7 - KLocale::LongName" 6569 msgid "Mehr" 6570 msgstr "Mehr" 6571 6572 #: kdecore/kcalendarsystemjalali.cpp:310 6573 #, fuzzy, kde-format 6574 #| msgid "Aban" 6575 msgctxt "Jalali month 8 - KLocale::LongName" 6576 msgid "Aban" 6577 msgstr "Aban" 6578 6579 #: kdecore/kcalendarsystemjalali.cpp:312 6580 #, fuzzy, kde-format 6581 #| msgid "Azar" 6582 msgctxt "Jalali month 9 - KLocale::LongName" 6583 msgid "Azar" 6584 msgstr "Azar" 6585 6586 #: kdecore/kcalendarsystemjalali.cpp:314 6587 #, fuzzy, kde-format 6588 #| msgctxt "Dei short" 6589 #| msgid "Dei" 6590 msgctxt "Jalali month 10 - KLocale::LongName" 6591 msgid "Dei" 6592 msgstr "Dei" 6593 6594 #: kdecore/kcalendarsystemjalali.cpp:316 6595 #, fuzzy, kde-format 6596 #| msgid "Bahman" 6597 msgctxt "Jalali month 11 - KLocale::LongName" 6598 msgid "Bahman" 6599 msgstr "Bahman" 6600 6601 #: kdecore/kcalendarsystemjalali.cpp:318 6602 #, fuzzy, kde-format 6603 #| msgid "Esfand" 6604 msgctxt "Jalali month 12 - KLocale::LongName" 6605 msgid "Esfand" 6606 msgstr "Esfand" 6607 6608 #: kdecore/kcalendarsystemjalali.cpp:331 6609 #, kde-format 6610 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6611 msgid "2" 6612 msgstr "" 6613 6614 #: kdecore/kcalendarsystemjalali.cpp:333 6615 #, kde-format 6616 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6617 msgid "3" 6618 msgstr "" 6619 6620 #: kdecore/kcalendarsystemjalali.cpp:335 6621 #, kde-format 6622 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6623 msgid "4" 6624 msgstr "" 6625 6626 #: kdecore/kcalendarsystemjalali.cpp:337 6627 #, kde-format 6628 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6629 msgid "5" 6630 msgstr "" 6631 6632 #: kdecore/kcalendarsystemjalali.cpp:339 6633 #, kde-format 6634 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6635 msgid "J" 6636 msgstr "" 6637 6638 #: kdecore/kcalendarsystemjalali.cpp:341 6639 #, kde-format 6640 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6641 msgid "S" 6642 msgstr "" 6643 6644 #: kdecore/kcalendarsystemjalali.cpp:343 6645 #, kde-format 6646 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6647 msgid "1" 6648 msgstr "" 6649 6650 #: kdecore/kcalendarsystemjalali.cpp:352 6651 #, fuzzy, kde-format 6652 #| msgctxt "Do shanbe short" 6653 #| msgid "2sh" 6654 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6655 msgid "2sh" 6656 msgstr "2sh" 6657 6658 #: kdecore/kcalendarsystemjalali.cpp:354 6659 #, fuzzy, kde-format 6660 #| msgctxt "Se shanbe short" 6661 #| msgid "3sh" 6662 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6663 msgid "3sh" 6664 msgstr "3sh" 6665 6666 #: kdecore/kcalendarsystemjalali.cpp:356 6667 #, fuzzy, kde-format 6668 #| msgctxt "Chahar shanbe short" 6669 #| msgid "4sh" 6670 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6671 msgid "4sh" 6672 msgstr "4sh" 6673 6674 #: kdecore/kcalendarsystemjalali.cpp:358 6675 #, fuzzy, kde-format 6676 #| msgctxt "Panj shanbe short" 6677 #| msgid "5sh" 6678 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6679 msgid "5sh" 6680 msgstr "5sh" 6681 6682 #: kdecore/kcalendarsystemjalali.cpp:360 6683 #, fuzzy, kde-format 6684 #| msgctxt "Jumee short" 6685 #| msgid "Jom" 6686 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6687 msgid "Jom" 6688 msgstr "Jom" 6689 6690 #: kdecore/kcalendarsystemjalali.cpp:362 6691 #, fuzzy, kde-format 6692 #| msgid "Shanbe" 6693 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6694 msgid "Shn" 6695 msgstr "Shanbe" 6696 6697 #: kdecore/kcalendarsystemjalali.cpp:364 6698 #, fuzzy, kde-format 6699 #| msgctxt "Yek-shanbe short" 6700 #| msgid "1sh" 6701 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6702 msgid "1sh" 6703 msgstr "1sh" 6704 6705 #: kdecore/kcalendarsystemjalali.cpp:371 6706 #, fuzzy, kde-format 6707 #| msgid "Do shanbe" 6708 msgctxt "Jalali weekday 1 - KLocale::LongName" 6709 msgid "Do shanbe" 6710 msgstr "Do shanbe" 6711 6712 #: kdecore/kcalendarsystemjalali.cpp:373 6713 #, fuzzy, kde-format 6714 #| msgid "Se shanbe" 6715 msgctxt "Jalali weekday 2 - KLocale::LongName" 6716 msgid "Se shanbe" 6717 msgstr "Se shanbe" 6718 6719 #: kdecore/kcalendarsystemjalali.cpp:375 6720 #, fuzzy, kde-format 6721 #| msgid "Chahar shanbe" 6722 msgctxt "Jalali weekday 3 - KLocale::LongName" 6723 msgid "Chahar shanbe" 6724 msgstr "Chahar shanbe" 6725 6726 #: kdecore/kcalendarsystemjalali.cpp:377 6727 #, fuzzy, kde-format 6728 #| msgid "Panj shanbe" 6729 msgctxt "Jalali weekday 4 - KLocale::LongName" 6730 msgid "Panj shanbe" 6731 msgstr "Panj shanbe" 6732 6733 #: kdecore/kcalendarsystemjalali.cpp:379 6734 #, fuzzy, kde-format 6735 #| msgid "Jumee" 6736 msgctxt "Jalali weekday 5 - KLocale::LongName" 6737 msgid "Jumee" 6738 msgstr "Jumee" 6739 6740 #: kdecore/kcalendarsystemjalali.cpp:381 6741 #, fuzzy, kde-format 6742 #| msgid "Shanbe" 6743 msgctxt "Jalali weekday 6 - KLocale::LongName" 6744 msgid "Shanbe" 6745 msgstr "Shanbe" 6746 6747 #: kdecore/kcalendarsystemjalali.cpp:383 6748 #, fuzzy, kde-format 6749 #| msgid "Yek-shanbe" 6750 msgctxt "Jalali weekday 7 - KLocale::LongName" 6751 msgid "Yek-shanbe" 6752 msgstr "Yek-shanbe" 6753 6754 #: kdecore/kcalendarsystemjapanese.cpp:62 6755 #, kde-format 6756 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6757 msgid "Meiji" 6758 msgstr "" 6759 6760 #: kdecore/kcalendarsystemjapanese.cpp:64 6761 #, kde-format 6762 msgctxt "" 6763 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6764 "e.g. Meiji 1" 6765 msgid "%EC Gannen" 6766 msgstr "" 6767 6768 #: kdecore/kcalendarsystemjapanese.cpp:66 6769 #, kde-format 6770 msgctxt "" 6771 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6772 "e.g. Meiji 22" 6773 msgid "%EC %Ey" 6774 msgstr "" 6775 6776 #: kdecore/kcalendarsystemjapanese.cpp:69 6777 #, kde-format 6778 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6779 msgid "Taishō" 6780 msgstr "" 6781 6782 #: kdecore/kcalendarsystemjapanese.cpp:71 6783 #, kde-format 6784 msgctxt "" 6785 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6786 "1, e.g. Taishō 1" 6787 msgid "%EC Gannen" 6788 msgstr "" 6789 6790 #: kdecore/kcalendarsystemjapanese.cpp:73 6791 #, kde-format 6792 msgctxt "" 6793 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6794 "1, e.g. Taishō 22" 6795 msgid "%EC %Ey" 6796 msgstr "" 6797 6798 #: kdecore/kcalendarsystemjapanese.cpp:76 6799 #, fuzzy, kde-format 6800 #| msgctxt "Shahrivar short" 6801 #| msgid "Sha" 6802 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6803 msgid "Shōwa" 6804 msgstr "Sha" 6805 6806 #: kdecore/kcalendarsystemjapanese.cpp:78 6807 #, kde-format 6808 msgctxt "" 6809 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6810 "e.g. Shōwa 1" 6811 msgid "%EC Gannen" 6812 msgstr "" 6813 6814 #: kdecore/kcalendarsystemjapanese.cpp:80 6815 #, kde-format 6816 msgctxt "" 6817 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6818 "e.g. Shōwa 22" 6819 msgid "%EC %Ey" 6820 msgstr "" 6821 6822 #: kdecore/kcalendarsystemjapanese.cpp:83 6823 #, kde-format 6824 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6825 msgid "Heisei" 6826 msgstr "" 6827 6828 #: kdecore/kcalendarsystemjapanese.cpp:85 6829 #, kde-format 6830 msgctxt "" 6831 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6832 "1, e.g. Heisei 1" 6833 msgid "%EC Gannen" 6834 msgstr "" 6835 6836 #: kdecore/kcalendarsystemjapanese.cpp:87 6837 #, kde-format 6838 msgctxt "" 6839 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6840 "1, e.g. Heisei 22" 6841 msgid "%EC %Ey" 6842 msgstr "" 6843 6844 #: kdecore/kcalendarsystemjapanese.cpp:164 6845 #, fuzzy, kde-format 6846 msgctxt "Japanese year 1 of era" 6847 msgid "Gannen" 6848 msgstr "Зелена:" 6849 6850 #: kdecore/kcalendarsystemjulian.cpp:73 6851 #, kde-format 6852 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6853 msgid "Before Common Era" 6854 msgstr "" 6855 6856 #: kdecore/kcalendarsystemjulian.cpp:74 6857 #, kde-format 6858 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6859 msgid "BCE" 6860 msgstr "" 6861 6862 #: kdecore/kcalendarsystemjulian.cpp:76 6863 #, kde-format 6864 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6865 msgid "Before Christ" 6866 msgstr "" 6867 6868 #: kdecore/kcalendarsystemjulian.cpp:77 6869 #, kde-format 6870 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6871 msgid "BC" 6872 msgstr "" 6873 6874 #: kdecore/kcalendarsystemjulian.cpp:79 6875 #, kde-format 6876 msgctxt "" 6877 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6878 msgid "%Ey %EC" 6879 msgstr "" 6880 6881 #: kdecore/kcalendarsystemjulian.cpp:83 6882 #, kde-format 6883 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6884 msgid "Common Era" 6885 msgstr "" 6886 6887 #: kdecore/kcalendarsystemjulian.cpp:84 6888 #, kde-format 6889 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6890 msgid "CE" 6891 msgstr "" 6892 6893 #: kdecore/kcalendarsystemjulian.cpp:86 6894 #, kde-format 6895 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6896 msgid "Anno Domini" 6897 msgstr "" 6898 6899 #: kdecore/kcalendarsystemjulian.cpp:87 6900 #, kde-format 6901 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6902 msgid "AD" 6903 msgstr "" 6904 6905 #: kdecore/kcalendarsystemjulian.cpp:89 6906 #, kde-format 6907 msgctxt "" 6908 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6909 msgid "%Ey %EC" 6910 msgstr "" 6911 6912 #: kdecore/kcalendarsystemjulian.cpp:172 6913 #, kde-format 6914 msgctxt "Julian month 1 - KLocale::NarrowName" 6915 msgid "J" 6916 msgstr "" 6917 6918 #: kdecore/kcalendarsystemjulian.cpp:174 6919 #, kde-format 6920 msgctxt "Julian month 2 - KLocale::NarrowName" 6921 msgid "F" 6922 msgstr "" 6923 6924 #: kdecore/kcalendarsystemjulian.cpp:176 6925 #, kde-format 6926 msgctxt "Julian month 3 - KLocale::NarrowName" 6927 msgid "M" 6928 msgstr "" 6929 6930 #: kdecore/kcalendarsystemjulian.cpp:178 6931 #, fuzzy, kde-format 6932 #| msgid "Av" 6933 msgctxt "Julian month 4 - KLocale::NarrowName" 6934 msgid "A" 6935 msgstr "Av" 6936 6937 #: kdecore/kcalendarsystemjulian.cpp:180 6938 #, kde-format 6939 msgctxt "Julian month 5 - KLocale::NarrowName" 6940 msgid "M" 6941 msgstr "" 6942 6943 #: kdecore/kcalendarsystemjulian.cpp:182 6944 #, kde-format 6945 msgctxt "Julian month 6 - KLocale::NarrowName" 6946 msgid "J" 6947 msgstr "" 6948 6949 #: kdecore/kcalendarsystemjulian.cpp:184 6950 #, kde-format 6951 msgctxt "Julian month 7 - KLocale::NarrowName" 6952 msgid "J" 6953 msgstr "" 6954 6955 #: kdecore/kcalendarsystemjulian.cpp:186 6956 #, fuzzy, kde-format 6957 #| msgid "Av" 6958 msgctxt "Julian month 8 - KLocale::NarrowName" 6959 msgid "A" 6960 msgstr "Av" 6961 6962 #: kdecore/kcalendarsystemjulian.cpp:188 6963 #, kde-format 6964 msgctxt "Julian month 9 - KLocale::NarrowName" 6965 msgid "S" 6966 msgstr "" 6967 6968 #: kdecore/kcalendarsystemjulian.cpp:190 6969 #, kde-format 6970 msgctxt "Julian month 10 - KLocale::NarrowName" 6971 msgid "O" 6972 msgstr "" 6973 6974 #: kdecore/kcalendarsystemjulian.cpp:192 6975 #, kde-format 6976 msgctxt "Julian month 11 - KLocale::NarrowName" 6977 msgid "N" 6978 msgstr "" 6979 6980 #: kdecore/kcalendarsystemjulian.cpp:194 6981 #, kde-format 6982 msgctxt "Julian month 12 - KLocale::NarrowName" 6983 msgid "D" 6984 msgstr "" 6985 6986 #: kdecore/kcalendarsystemjulian.cpp:203 6987 #, fuzzy, kde-format 6988 #| msgctxt "of January" 6989 #| msgid "of Jan" 6990 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6991 msgid "of Jan" 6992 msgstr "од јан" 6993 6994 #: kdecore/kcalendarsystemjulian.cpp:205 6995 #, fuzzy, kde-format 6996 #| msgctxt "of February" 6997 #| msgid "of Feb" 6998 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6999 msgid "of Feb" 7000 msgstr "од фев" 7001 7002 #: kdecore/kcalendarsystemjulian.cpp:207 7003 #, fuzzy, kde-format 7004 #| msgctxt "of March" 7005 #| msgid "of Mar" 7006 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 7007 msgid "of Mar" 7008 msgstr "од мар" 7009 7010 #: kdecore/kcalendarsystemjulian.cpp:209 7011 #, fuzzy, kde-format 7012 #| msgctxt "of April" 7013 #| msgid "of Apr" 7014 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7015 msgid "of Apr" 7016 msgstr "од апр" 7017 7018 #: kdecore/kcalendarsystemjulian.cpp:211 7019 #, fuzzy, kde-format 7020 #| msgctxt "of May short" 7021 #| msgid "of May" 7022 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7023 msgid "of May" 7024 msgstr "од мај" 7025 7026 #: kdecore/kcalendarsystemjulian.cpp:213 7027 #, fuzzy, kde-format 7028 #| msgctxt "of June" 7029 #| msgid "of Jun" 7030 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7031 msgid "of Jun" 7032 msgstr "од јун" 7033 7034 #: kdecore/kcalendarsystemjulian.cpp:215 7035 #, fuzzy, kde-format 7036 #| msgctxt "of July" 7037 #| msgid "of Jul" 7038 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7039 msgid "of Jul" 7040 msgstr "од јул" 7041 7042 #: kdecore/kcalendarsystemjulian.cpp:217 7043 #, fuzzy, kde-format 7044 #| msgctxt "of August" 7045 #| msgid "of Aug" 7046 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7047 msgid "of Aug" 7048 msgstr "од авг" 7049 7050 #: kdecore/kcalendarsystemjulian.cpp:219 7051 #, fuzzy, kde-format 7052 #| msgctxt "of September" 7053 #| msgid "of Sep" 7054 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7055 msgid "of Sep" 7056 msgstr "од сеп" 7057 7058 #: kdecore/kcalendarsystemjulian.cpp:221 7059 #, fuzzy, kde-format 7060 #| msgctxt "of October" 7061 #| msgid "of Oct" 7062 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7063 msgid "of Oct" 7064 msgstr "од окт" 7065 7066 #: kdecore/kcalendarsystemjulian.cpp:223 7067 #, fuzzy, kde-format 7068 #| msgctxt "of November" 7069 #| msgid "of Nov" 7070 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7071 msgid "of Nov" 7072 msgstr "од ное" 7073 7074 #: kdecore/kcalendarsystemjulian.cpp:225 7075 #, fuzzy, kde-format 7076 #| msgctxt "of December" 7077 #| msgid "of Dec" 7078 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7079 msgid "of Dec" 7080 msgstr "од дек" 7081 7082 #: kdecore/kcalendarsystemjulian.cpp:234 7083 #, fuzzy, kde-format 7084 #| msgctxt "January" 7085 #| msgid "Jan" 7086 msgctxt "Julian month 1 - KLocale::ShortName" 7087 msgid "Jan" 7088 msgstr "јан" 7089 7090 #: kdecore/kcalendarsystemjulian.cpp:236 7091 #, fuzzy, kde-format 7092 #| msgctxt "February" 7093 #| msgid "Feb" 7094 msgctxt "Julian month 2 - KLocale::ShortName" 7095 msgid "Feb" 7096 msgstr "фев" 7097 7098 #: kdecore/kcalendarsystemjulian.cpp:238 7099 #, fuzzy, kde-format 7100 #| msgctxt "March" 7101 #| msgid "Mar" 7102 msgctxt "Julian month 3 - KLocale::ShortName" 7103 msgid "Mar" 7104 msgstr "мар" 7105 7106 #: kdecore/kcalendarsystemjulian.cpp:240 7107 #, fuzzy, kde-format 7108 #| msgctxt "April" 7109 #| msgid "Apr" 7110 msgctxt "Julian month 4 - KLocale::ShortName" 7111 msgid "Apr" 7112 msgstr "апр" 7113 7114 #: kdecore/kcalendarsystemjulian.cpp:242 7115 #, fuzzy, kde-format 7116 #| msgctxt "May short" 7117 #| msgid "May" 7118 msgctxt "Julian month 5 - KLocale::ShortName" 7119 msgid "May" 7120 msgstr "мај" 7121 7122 #: kdecore/kcalendarsystemjulian.cpp:244 7123 #, fuzzy, kde-format 7124 #| msgctxt "June" 7125 #| msgid "Jun" 7126 msgctxt "Julian month 6 - KLocale::ShortName" 7127 msgid "Jun" 7128 msgstr "јун" 7129 7130 #: kdecore/kcalendarsystemjulian.cpp:246 7131 #, fuzzy, kde-format 7132 #| msgctxt "July" 7133 #| msgid "Jul" 7134 msgctxt "Julian month 7 - KLocale::ShortName" 7135 msgid "Jul" 7136 msgstr "јул" 7137 7138 #: kdecore/kcalendarsystemjulian.cpp:248 7139 #, fuzzy, kde-format 7140 #| msgctxt "August" 7141 #| msgid "Aug" 7142 msgctxt "Julian month 8 - KLocale::ShortName" 7143 msgid "Aug" 7144 msgstr "авг" 7145 7146 #: kdecore/kcalendarsystemjulian.cpp:250 7147 #, fuzzy, kde-format 7148 #| msgctxt "September" 7149 #| msgid "Sep" 7150 msgctxt "Julian month 9 - KLocale::ShortName" 7151 msgid "Sep" 7152 msgstr "сеп" 7153 7154 #: kdecore/kcalendarsystemjulian.cpp:252 7155 #, fuzzy, kde-format 7156 #| msgctxt "October" 7157 #| msgid "Oct" 7158 msgctxt "Julian month 10 - KLocale::ShortName" 7159 msgid "Oct" 7160 msgstr "окт" 7161 7162 #: kdecore/kcalendarsystemjulian.cpp:254 7163 #, fuzzy, kde-format 7164 #| msgctxt "November" 7165 #| msgid "Nov" 7166 msgctxt "Julian month 11 - KLocale::ShortName" 7167 msgid "Nov" 7168 msgstr "ное" 7169 7170 #: kdecore/kcalendarsystemjulian.cpp:256 7171 #, fuzzy, kde-format 7172 #| msgctxt "December" 7173 #| msgid "Dec" 7174 msgctxt "Julian month 12 - KLocale::ShortName" 7175 msgid "Dec" 7176 msgstr "дек" 7177 7178 #: kdecore/kcalendarsystemjulian.cpp:265 7179 #, fuzzy, kde-format 7180 #| msgid "of January" 7181 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7182 msgid "of January" 7183 msgstr "од јануари" 7184 7185 #: kdecore/kcalendarsystemjulian.cpp:267 7186 #, fuzzy, kde-format 7187 #| msgid "of February" 7188 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7189 msgid "of February" 7190 msgstr "од февруари" 7191 7192 #: kdecore/kcalendarsystemjulian.cpp:269 7193 #, fuzzy, kde-format 7194 #| msgid "of March" 7195 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7196 msgid "of March" 7197 msgstr "од март" 7198 7199 #: kdecore/kcalendarsystemjulian.cpp:271 7200 #, fuzzy, kde-format 7201 #| msgid "of April" 7202 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7203 msgid "of April" 7204 msgstr "од април" 7205 7206 #: kdecore/kcalendarsystemjulian.cpp:273 7207 #, fuzzy, kde-format 7208 #| msgctxt "of May short" 7209 #| msgid "of May" 7210 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7211 msgid "of May" 7212 msgstr "од мај" 7213 7214 #: kdecore/kcalendarsystemjulian.cpp:275 7215 #, fuzzy, kde-format 7216 #| msgid "of June" 7217 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7218 msgid "of June" 7219 msgstr "од јуни" 7220 7221 #: kdecore/kcalendarsystemjulian.cpp:277 7222 #, fuzzy, kde-format 7223 #| msgid "of July" 7224 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7225 msgid "of July" 7226 msgstr "од јули" 7227 7228 #: kdecore/kcalendarsystemjulian.cpp:279 7229 #, fuzzy, kde-format 7230 #| msgid "of August" 7231 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7232 msgid "of August" 7233 msgstr "од август" 7234 7235 #: kdecore/kcalendarsystemjulian.cpp:281 7236 #, fuzzy, kde-format 7237 #| msgid "of September" 7238 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7239 msgid "of September" 7240 msgstr "од септември" 7241 7242 #: kdecore/kcalendarsystemjulian.cpp:283 7243 #, fuzzy, kde-format 7244 #| msgid "of October" 7245 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7246 msgid "of October" 7247 msgstr "од октомври" 7248 7249 #: kdecore/kcalendarsystemjulian.cpp:285 7250 #, fuzzy, kde-format 7251 #| msgid "of November" 7252 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7253 msgid "of November" 7254 msgstr "од ноември" 7255 7256 #: kdecore/kcalendarsystemjulian.cpp:287 7257 #, fuzzy, kde-format 7258 #| msgid "of December" 7259 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7260 msgid "of December" 7261 msgstr "од декември" 7262 7263 #: kdecore/kcalendarsystemjulian.cpp:296 7264 #, fuzzy, kde-format 7265 #| msgid "January" 7266 msgctxt "Julian month 1 - KLocale::LongName" 7267 msgid "January" 7268 msgstr "јануари" 7269 7270 #: kdecore/kcalendarsystemjulian.cpp:298 7271 #, fuzzy, kde-format 7272 #| msgid "February" 7273 msgctxt "Julian month 2 - KLocale::LongName" 7274 msgid "February" 7275 msgstr "февруари" 7276 7277 #: kdecore/kcalendarsystemjulian.cpp:300 7278 #, fuzzy, kde-format 7279 #| msgctxt "March long" 7280 #| msgid "March" 7281 msgctxt "Julian month 3 - KLocale::LongName" 7282 msgid "March" 7283 msgstr "март" 7284 7285 #: kdecore/kcalendarsystemjulian.cpp:302 7286 #, fuzzy, kde-format 7287 #| msgid "April" 7288 msgctxt "Julian month 4 - KLocale::LongName" 7289 msgid "April" 7290 msgstr "април" 7291 7292 #: kdecore/kcalendarsystemjulian.cpp:304 7293 #, fuzzy, kde-format 7294 #| msgctxt "May short" 7295 #| msgid "May" 7296 msgctxt "Julian month 5 - KLocale::LongName" 7297 msgid "May" 7298 msgstr "мај" 7299 7300 #: kdecore/kcalendarsystemjulian.cpp:306 7301 #, fuzzy, kde-format 7302 #| msgid "June" 7303 msgctxt "Julian month 6 - KLocale::LongName" 7304 msgid "June" 7305 msgstr "јуни" 7306 7307 #: kdecore/kcalendarsystemjulian.cpp:308 7308 #, fuzzy, kde-format 7309 #| msgid "July" 7310 msgctxt "Julian month 7 - KLocale::LongName" 7311 msgid "July" 7312 msgstr "јули" 7313 7314 #: kdecore/kcalendarsystemjulian.cpp:310 7315 #, fuzzy, kde-format 7316 #| msgctxt "August long" 7317 #| msgid "August" 7318 msgctxt "Julian month 8 - KLocale::LongName" 7319 msgid "August" 7320 msgstr "август" 7321 7322 #: kdecore/kcalendarsystemjulian.cpp:312 7323 #, fuzzy, kde-format 7324 #| msgid "September" 7325 msgctxt "Julian month 9 - KLocale::LongName" 7326 msgid "September" 7327 msgstr "септември" 7328 7329 #: kdecore/kcalendarsystemjulian.cpp:314 7330 #, fuzzy, kde-format 7331 #| msgid "October" 7332 msgctxt "Julian month 10 - KLocale::LongName" 7333 msgid "October" 7334 msgstr "октомври" 7335 7336 #: kdecore/kcalendarsystemjulian.cpp:316 7337 #, fuzzy, kde-format 7338 #| msgid "November" 7339 msgctxt "Julian month 11 - KLocale::LongName" 7340 msgid "November" 7341 msgstr "ноември" 7342 7343 #: kdecore/kcalendarsystemjulian.cpp:318 7344 #, fuzzy, kde-format 7345 #| msgid "December" 7346 msgctxt "Julian month 12 - KLocale::LongName" 7347 msgid "December" 7348 msgstr "декември" 7349 7350 #: kdecore/kcalendarsystemjulian.cpp:331 7351 #, kde-format 7352 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7353 msgid "M" 7354 msgstr "" 7355 7356 #: kdecore/kcalendarsystemjulian.cpp:333 7357 #, kde-format 7358 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7359 msgid "T" 7360 msgstr "" 7361 7362 #: kdecore/kcalendarsystemjulian.cpp:335 7363 #, kde-format 7364 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7365 msgid "W" 7366 msgstr "" 7367 7368 #: kdecore/kcalendarsystemjulian.cpp:337 7369 #, kde-format 7370 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7371 msgid "T" 7372 msgstr "" 7373 7374 #: kdecore/kcalendarsystemjulian.cpp:339 7375 #, kde-format 7376 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7377 msgid "F" 7378 msgstr "" 7379 7380 #: kdecore/kcalendarsystemjulian.cpp:341 7381 #, kde-format 7382 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7383 msgid "S" 7384 msgstr "" 7385 7386 #: kdecore/kcalendarsystemjulian.cpp:343 7387 #, kde-format 7388 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7389 msgid "S" 7390 msgstr "" 7391 7392 #: kdecore/kcalendarsystemjulian.cpp:352 7393 #, fuzzy, kde-format 7394 #| msgctxt "Monday" 7395 #| msgid "Mon" 7396 msgctxt "Julian weekday 1 - KLocale::ShortName" 7397 msgid "Mon" 7398 msgstr "пон" 7399 7400 #: kdecore/kcalendarsystemjulian.cpp:354 7401 #, fuzzy, kde-format 7402 #| msgctxt "Tuesday" 7403 #| msgid "Tue" 7404 msgctxt "Julian weekday 2 - KLocale::ShortName" 7405 msgid "Tue" 7406 msgstr "вто" 7407 7408 #: kdecore/kcalendarsystemjulian.cpp:356 7409 #, fuzzy, kde-format 7410 #| msgctxt "Wednesday" 7411 #| msgid "Wed" 7412 msgctxt "Julian weekday 3 - KLocale::ShortName" 7413 msgid "Wed" 7414 msgstr "сре" 7415 7416 #: kdecore/kcalendarsystemjulian.cpp:358 7417 #, fuzzy, kde-format 7418 #| msgctxt "Thursday" 7419 #| msgid "Thu" 7420 msgctxt "Julian weekday 4 - KLocale::ShortName" 7421 msgid "Thu" 7422 msgstr "чет" 7423 7424 #: kdecore/kcalendarsystemjulian.cpp:360 7425 #, fuzzy, kde-format 7426 #| msgctxt "Friday" 7427 #| msgid "Fri" 7428 msgctxt "Julian weekday 5 - KLocale::ShortName" 7429 msgid "Fri" 7430 msgstr "пет" 7431 7432 #: kdecore/kcalendarsystemjulian.cpp:362 7433 #, fuzzy, kde-format 7434 #| msgctxt "Saturday" 7435 #| msgid "Sat" 7436 msgctxt "Julian weekday 6 - KLocale::ShortName" 7437 msgid "Sat" 7438 msgstr "саб" 7439 7440 #: kdecore/kcalendarsystemjulian.cpp:364 7441 #, fuzzy, kde-format 7442 #| msgctxt "Sunday" 7443 #| msgid "Sun" 7444 msgctxt "Julian weekday 7 - KLocale::ShortName" 7445 msgid "Sun" 7446 msgstr "нед" 7447 7448 #: kdecore/kcalendarsystemjulian.cpp:371 7449 #, fuzzy, kde-format 7450 #| msgid "Monday" 7451 msgctxt "Julian weekday 1 - KLocale::LongName" 7452 msgid "Monday" 7453 msgstr "понеделник" 7454 7455 #: kdecore/kcalendarsystemjulian.cpp:373 7456 #, fuzzy, kde-format 7457 #| msgid "Tuesday" 7458 msgctxt "Julian weekday 2 - KLocale::LongName" 7459 msgid "Tuesday" 7460 msgstr "вторник" 7461 7462 #: kdecore/kcalendarsystemjulian.cpp:375 7463 #, fuzzy, kde-format 7464 #| msgid "Wednesday" 7465 msgctxt "Julian weekday 3 - KLocale::LongName" 7466 msgid "Wednesday" 7467 msgstr "среда" 7468 7469 #: kdecore/kcalendarsystemjulian.cpp:377 7470 #, fuzzy, kde-format 7471 #| msgid "Thursday" 7472 msgctxt "Julian weekday 4 - KLocale::LongName" 7473 msgid "Thursday" 7474 msgstr "четврток" 7475 7476 #: kdecore/kcalendarsystemjulian.cpp:379 7477 #, fuzzy, kde-format 7478 #| msgid "Friday" 7479 msgctxt "Julian weekday 5 - KLocale::LongName" 7480 msgid "Friday" 7481 msgstr "петок" 7482 7483 #: kdecore/kcalendarsystemjulian.cpp:381 7484 #, fuzzy, kde-format 7485 #| msgid "Saturday" 7486 msgctxt "Julian weekday 6 - KLocale::LongName" 7487 msgid "Saturday" 7488 msgstr "сабота" 7489 7490 #: kdecore/kcalendarsystemjulian.cpp:383 7491 #, fuzzy, kde-format 7492 #| msgid "Sunday" 7493 msgctxt "Julian weekday 7 - KLocale::LongName" 7494 msgid "Sunday" 7495 msgstr "недела" 7496 7497 #: kdecore/kcalendarsystemminguo.cpp:57 7498 #, kde-format 7499 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7500 msgid "Republic of China Era" 7501 msgstr "" 7502 7503 #: kdecore/kcalendarsystemminguo.cpp:58 7504 #, kde-format 7505 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7506 msgid "ROC" 7507 msgstr "" 7508 7509 #: kdecore/kcalendarsystemminguo.cpp:59 7510 #, kde-format 7511 msgctxt "" 7512 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7513 msgid "%EC %Ey" 7514 msgstr "" 7515 7516 #: kdecore/kcalendarsystemthai.cpp:58 7517 #, kde-format 7518 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7519 msgid "Buddhist Era" 7520 msgstr "" 7521 7522 #: kdecore/kcalendarsystemthai.cpp:59 7523 #, kde-format 7524 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7525 msgid "BE" 7526 msgstr "" 7527 7528 #: kdecore/kcalendarsystemthai.cpp:60 7529 #, kde-format 7530 msgctxt "" 7531 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7532 msgid "%Ey %EC" 7533 msgstr "" 7534 7535 #: kdecore/kcmdlineargs.cpp:278 7536 #, kde-format 7537 msgid "Use the X-server display 'displayname'" 7538 msgstr "Користи го екранот „именаекран“ на X-серверот" 7539 7540 #: kdecore/kcmdlineargs.cpp:281 7541 #, kde-format 7542 msgid "Restore the application for the given 'sessionId'" 7543 msgstr "Обнови ја апликацијата за дадениот „sessionId“" 7544 7545 #: kdecore/kcmdlineargs.cpp:282 7546 #, kde-format 7547 msgid "" 7548 "Causes the application to install a private color\n" 7549 "map on an 8-bit display" 7550 msgstr "" 7551 "Предизвикува апликацијата да инсталира сопствена\n" 7552 "мапа на бои на осумбитни уреди" 7553 7554 #: kdecore/kcmdlineargs.cpp:283 7555 #, kde-format 7556 msgid "" 7557 "Limits the number of colors allocated in the color\n" 7558 "cube on an 8-bit display, if the application is\n" 7559 "using the QApplication::ManyColor color\n" 7560 "specification" 7561 msgstr "" 7562 "Го ограничува бројот на бои алоцирани на\n" 7563 "осумбитни уреди, ако ја користи апликацијата\n" 7564 "спецификацијата на бои\n" 7565 "QApplication::ManyColor" 7566 7567 #: kdecore/kcmdlineargs.cpp:284 7568 #, kde-format 7569 msgid "tells Qt to never grab the mouse or the keyboard" 7570 msgstr "му наложува на Qt никогаш да не ги зафаќа глушецот и тастатурата" 7571 7572 #: kdecore/kcmdlineargs.cpp:285 7573 #, kde-format 7574 msgid "" 7575 "running under a debugger can cause an implicit\n" 7576 "-nograb, use -dograb to override" 7577 msgstr "" 7578 "Активирањето под чистач може да предизвика\n" 7579 "имплицитен -nograb; користете -dograb за да го\n" 7580 "избегнете тоа" 7581 7582 #: kdecore/kcmdlineargs.cpp:286 7583 #, kde-format 7584 msgid "switches to synchronous mode for debugging" 7585 msgstr "се префрлува во синхронизиран режим за чистење од бубачки" 7586 7587 #: kdecore/kcmdlineargs.cpp:288 7588 #, kde-format 7589 msgid "defines the application font" 7590 msgstr "го дефинира фонтот на апликацијата" 7591 7592 #: kdecore/kcmdlineargs.cpp:290 7593 #, kde-format 7594 msgid "" 7595 "sets the default background color and an\n" 7596 "application palette (light and dark shades are\n" 7597 "calculated)" 7598 msgstr "" 7599 "ги мести стандардната боја на позадината и\n" 7600 "на палетата на апликацијата (светлите и\n" 7601 "темните сенки се пресметуваат)" 7602 7603 #: kdecore/kcmdlineargs.cpp:292 7604 #, kde-format 7605 msgid "sets the default foreground color" 7606 msgstr "ја поставува стандардната боја на испис" 7607 7608 #: kdecore/kcmdlineargs.cpp:294 7609 #, kde-format 7610 msgid "sets the default button color" 7611 msgstr "ја поставува стандардната боја на копчиња" 7612 7613 #: kdecore/kcmdlineargs.cpp:295 7614 #, kde-format 7615 msgid "sets the application name" 7616 msgstr "поставува име на апликацијата" 7617 7618 #: kdecore/kcmdlineargs.cpp:296 7619 #, kde-format 7620 msgid "sets the application title (caption)" 7621 msgstr "поставува наслов на апликацијата (заглавие)" 7622 7623 #: kdecore/kcmdlineargs.cpp:297 7624 #, kde-format 7625 msgid "load the testability framework" 7626 msgstr "" 7627 7628 #: kdecore/kcmdlineargs.cpp:299 7629 #, kde-format 7630 msgid "" 7631 "forces the application to use a TrueColor visual on\n" 7632 "an 8-bit display" 7633 msgstr "" 7634 "ја принудува апликацијата да користи TrueColor visual\n" 7635 "на осумбитни уреди" 7636 7637 #: kdecore/kcmdlineargs.cpp:300 7638 #, kde-format 7639 msgid "" 7640 "sets XIM (X Input Method) input style. Possible\n" 7641 "values are onthespot, overthespot, offthespot and\n" 7642 "root" 7643 msgstr "" 7644 "го поставува стилот на внес XIM (X Input Method). Можни\n" 7645 "вредности се onthespot, overthespot, offthespot и\n" 7646 "root" 7647 7648 #: kdecore/kcmdlineargs.cpp:301 7649 #, kde-format 7650 msgid "set XIM server" 7651 msgstr "поставува сервер XIM" 7652 7653 #: kdecore/kcmdlineargs.cpp:302 7654 #, kde-format 7655 msgid "disable XIM" 7656 msgstr "оневозможи XIM" 7657 7658 #: kdecore/kcmdlineargs.cpp:304 7659 #, kde-format 7660 msgid "mirrors the whole layout of widgets" 7661 msgstr "го превртува огледално целиот распоред на елементите" 7662 7663 #: kdecore/kcmdlineargs.cpp:305 7664 #, kde-format 7665 msgid "applies the Qt stylesheet to the application widgets" 7666 msgstr "ги применува стиловите на Qt на графичките контроли во апликацијата" 7667 7668 #: kdecore/kcmdlineargs.cpp:306 7669 #, kde-format 7670 msgid "" 7671 "use a different graphics system instead of the default one, options are " 7672 "raster and opengl (experimental)" 7673 msgstr "" 7674 "користи различен систем за графика од стандардниот, можни опции се „raster“ " 7675 "и „opengl“ (експериментално)" 7676 7677 #: kdecore/kcmdlineargs.cpp:307 7678 #, kde-format 7679 msgid "" 7680 "QML JS debugger information. Application must be\n" 7681 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7682 "enabled" 7683 msgstr "" 7684 7685 #: kdecore/kcmdlineargs.cpp:308 7686 #, kde-format 7687 msgid "The windowing system platform (e.g. xcb or wayland)" 7688 msgstr "" 7689 7690 #: kdecore/kcmdlineargs.cpp:310 7691 #, kde-format 7692 msgid "Use 'caption' as name in the titlebar" 7693 msgstr "Користи „заглавие“ за име во насловната линија" 7694 7695 #: kdecore/kcmdlineargs.cpp:311 7696 #, kde-format 7697 msgid "Use 'icon' as the application icon" 7698 msgstr "Користи „икона“ за икона на апликацијата" 7699 7700 #: kdecore/kcmdlineargs.cpp:312 7701 #, kde-format 7702 msgid "Use alternative configuration file" 7703 msgstr "Користи алтернативна конфигурациска датотека" 7704 7705 #: kdecore/kcmdlineargs.cpp:313 7706 #, kde-format 7707 msgid "Disable crash handler, to get core dumps" 7708 msgstr "Оневозможи го ракувачот со падови за да се добие исфрлување на јадрото" 7709 7710 #: kdecore/kcmdlineargs.cpp:315 7711 #, kde-format 7712 msgid "Waits for a WM_NET compatible windowmanager" 7713 msgstr "Чека на компатибилен менаџер на прозорци со WM_NET" 7714 7715 #: kdecore/kcmdlineargs.cpp:317 7716 #, kde-format 7717 msgid "sets the application GUI style" 7718 msgstr "поставува GUI-стил за апликацијата" 7719 7720 #: kdecore/kcmdlineargs.cpp:318 7721 #, kde-format 7722 msgid "" 7723 "sets the client geometry of the main widget - see man X for the argument " 7724 "format (usually WidthxHeight+XPos+YPos)" 7725 msgstr "" 7726 "поставува геометрија на клиент за главната графичка контрола - видете „man " 7727 "X“ за форматот на аргументот (вообичаено е ширинаxвисина+поз_x+поз_y, пр " 7728 "800x600+0+0)" 7729 7730 #: kdecore/kcmdlineargs.cpp:436 7731 #, kde-format 7732 msgid "KDE Application" 7733 msgstr "KDE-апликација" 7734 7735 #: kdecore/kcmdlineargs.cpp:497 7736 #, kde-format 7737 msgid "Qt" 7738 msgstr "Qt" 7739 7740 #: kdecore/kcmdlineargs.cpp:500 7741 #, kde-format 7742 msgid "KDE" 7743 msgstr "KDE" 7744 7745 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7746 #, fuzzy, kde-format 7747 #| msgid "ERROR: Unknown protocol '%1'" 7748 msgid "Unknown option '%1'." 7749 msgstr "ГРЕШКА: Непознат протокол „%1“" 7750 7751 #: kdecore/kcmdlineargs.cpp:841 7752 #, kde-format 7753 msgctxt "@info:shell %1 is cmdoption name" 7754 msgid "'%1' missing." 7755 msgstr "Недостасува „%1“." 7756 7757 #: kdecore/kcmdlineargs.cpp:895 7758 #, fuzzy, kde-format 7759 #| msgctxt "" 7760 #| "@info:shell message on appcmd --version; do not translate 'Development " 7761 #| "Platform'%3 application name, other %n version strings" 7762 #| msgid "" 7763 #| "Qt: %1\n" 7764 #| "KDE Development Platform: %2\n" 7765 #| "%3: %4\n" 7766 msgctxt "" 7767 "@info:shell message on appcmd --version; do not translate 'Development " 7768 "Platform'%3 application name, other %n version strings" 7769 msgid "" 7770 "Qt: %1\n" 7771 "KDE Frameworks: %2\n" 7772 "%3: %4\n" 7773 msgstr "" 7774 "Qt: %1\n" 7775 "KDE развојна платформа: %2\n" 7776 "%3: %4\n" 7777 7778 #: kdecore/kcmdlineargs.cpp:921 7779 #, kde-format 7780 msgctxt "the 2nd argument is a list of name+address, one on each line" 7781 msgid "" 7782 "%1 was written by\n" 7783 "%2" 7784 msgstr "" 7785 "%1 е напишано од\n" 7786 "%2" 7787 7788 #: kdecore/kcmdlineargs.cpp:924 7789 #, kde-format 7790 msgid "This application was written by somebody who wants to remain anonymous." 7791 msgstr "" 7792 7793 #: kdecore/kcmdlineargs.cpp:929 7794 #, kde-format 7795 msgid "Please use http://bugs.kde.org to report bugs.\n" 7796 msgstr "" 7797 7798 #: kdecore/kcmdlineargs.cpp:931 7799 #, kde-format 7800 msgid "Please report bugs to %1.\n" 7801 msgstr "" 7802 7803 #: kdecore/kcmdlineargs.cpp:961 7804 #, kde-format 7805 msgid "Unexpected argument '%1'." 7806 msgstr "" 7807 7808 #: kdecore/kcmdlineargs.cpp:1074 7809 #, kde-format 7810 msgid "Use --help to get a list of available command line options." 7811 msgstr "" 7812 7813 #: kdecore/kcmdlineargs.cpp:1096 7814 #, kde-format 7815 msgid "[options] " 7816 msgstr "" 7817 7818 #: kdecore/kcmdlineargs.cpp:1101 7819 #, kde-format 7820 msgid "[%1-options]" 7821 msgstr "" 7822 7823 #: kdecore/kcmdlineargs.cpp:1122 7824 #, kde-format 7825 msgid "Usage: %1 %2\n" 7826 msgstr "" 7827 7828 #: kdecore/kcmdlineargs.cpp:1125 7829 #, kde-format 7830 msgid "" 7831 "\n" 7832 "Generic options:\n" 7833 msgstr "" 7834 7835 #: kdecore/kcmdlineargs.cpp:1127 7836 #, kde-format 7837 msgid "Show help about options" 7838 msgstr "" 7839 7840 #: kdecore/kcmdlineargs.cpp:1133 7841 #, kde-format 7842 msgid "Show %1 specific options" 7843 msgstr "" 7844 7845 #: kdecore/kcmdlineargs.cpp:1140 7846 #, kde-format 7847 msgid "Show all options" 7848 msgstr "" 7849 7850 #: kdecore/kcmdlineargs.cpp:1141 7851 #, kde-format 7852 msgid "Show author information" 7853 msgstr "" 7854 7855 #: kdecore/kcmdlineargs.cpp:1142 7856 #, kde-format 7857 msgid "Show version information" 7858 msgstr "" 7859 7860 #: kdecore/kcmdlineargs.cpp:1143 7861 #, kde-format 7862 msgid "Show license information" 7863 msgstr "" 7864 7865 #: kdecore/kcmdlineargs.cpp:1144 7866 #, kde-format 7867 msgid "End of options" 7868 msgstr "" 7869 7870 #: kdecore/kcmdlineargs.cpp:1164 7871 #, kde-format 7872 msgid "" 7873 "\n" 7874 "%1 options:\n" 7875 msgstr "" 7876 7877 #: kdecore/kcmdlineargs.cpp:1166 7878 #, kde-format 7879 msgid "" 7880 "\n" 7881 "Options:\n" 7882 msgstr "" 7883 7884 #: kdecore/kcmdlineargs.cpp:1219 7885 #, kde-format 7886 msgid "" 7887 "\n" 7888 "Arguments:\n" 7889 msgstr "" 7890 7891 #: kdecore/kcmdlineargs.cpp:1580 7892 #, kde-format 7893 msgid "The files/URLs opened by the application will be deleted after use" 7894 msgstr "" 7895 "Датотеките/адресите што се отворени од апликацијата ќе бидат избришани по " 7896 "употребата" 7897 7898 #: kdecore/kcmdlineargs.cpp:1581 7899 #, kde-format 7900 msgid "KDE-tempfile" 7901 msgstr "KDE-tempfile" 7902 7903 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7904 #: kdecore/kdatetime.cpp:2985 7905 #, fuzzy, kde-format 7906 msgid "am" 7907 msgstr "am" 7908 7909 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7910 #: kdecore/kdatetime.cpp:2990 7911 #, kde-format 7912 msgid "pm" 7913 msgstr "pm" 7914 7915 #: kdecore/klibloader.cpp:100 7916 #, kde-format 7917 msgid "Library \"%1\" not found" 7918 msgstr "Библиотеката „%1“ не е пронајдена" 7919 7920 #: kdecore/klocale_kde.cpp:785 7921 #, kde-format 7922 msgctxt "digit set" 7923 msgid "Arabic-Indic" 7924 msgstr "Арапски-индиски" 7925 7926 #: kdecore/klocale_kde.cpp:788 7927 #, fuzzy, kde-format 7928 #| msgctxt "KCharselect unicode block name" 7929 #| msgid "Bengali" 7930 msgctxt "digit set" 7931 msgid "Bengali" 7932 msgstr "Бенгалски" 7933 7934 #: kdecore/klocale_kde.cpp:791 7935 #, fuzzy, kde-format 7936 #| msgctxt "KCharselect unicode block name" 7937 #| msgid "Devanagari" 7938 msgctxt "digit set" 7939 msgid "Devanagari" 7940 msgstr "Деванагари" 7941 7942 #: kdecore/klocale_kde.cpp:794 7943 #, kde-format 7944 msgctxt "digit set" 7945 msgid "Eastern Arabic-Indic" 7946 msgstr "Источен арапски-индиски" 7947 7948 #: kdecore/klocale_kde.cpp:797 7949 #, fuzzy, kde-format 7950 #| msgctxt "KCharselect unicode block name" 7951 #| msgid "Gujarati" 7952 msgctxt "digit set" 7953 msgid "Gujarati" 7954 msgstr "Гуџарати" 7955 7956 #: kdecore/klocale_kde.cpp:800 7957 #, fuzzy, kde-format 7958 #| msgctxt "KCharselect unicode block name" 7959 #| msgid "Gurmukhi" 7960 msgctxt "digit set" 7961 msgid "Gurmukhi" 7962 msgstr "Гурмуки" 7963 7964 #: kdecore/klocale_kde.cpp:803 7965 #, fuzzy, kde-format 7966 #| msgctxt "KCharselect unicode block name" 7967 #| msgid "Kannada" 7968 msgctxt "digit set" 7969 msgid "Kannada" 7970 msgstr "Каннада" 7971 7972 #: kdecore/klocale_kde.cpp:806 7973 #, fuzzy, kde-format 7974 #| msgctxt "KCharselect unicode block name" 7975 #| msgid "Khmer" 7976 msgctxt "digit set" 7977 msgid "Khmer" 7978 msgstr "Кмерски" 7979 7980 #: kdecore/klocale_kde.cpp:809 7981 #, fuzzy, kde-format 7982 #| msgctxt "KCharselect unicode block name" 7983 #| msgid "Malayalam" 7984 msgctxt "digit set" 7985 msgid "Malayalam" 7986 msgstr "Малајалам" 7987 7988 #: kdecore/klocale_kde.cpp:812 7989 #, fuzzy, kde-format 7990 #| msgctxt "KCharselect unicode block name" 7991 #| msgid "Oriya" 7992 msgctxt "digit set" 7993 msgid "Oriya" 7994 msgstr "Орија" 7995 7996 #: kdecore/klocale_kde.cpp:815 7997 #, fuzzy, kde-format 7998 #| msgctxt "KCharselect unicode block name" 7999 #| msgid "Tamil" 8000 msgctxt "digit set" 8001 msgid "Tamil" 8002 msgstr "Тамилски" 8003 8004 #: kdecore/klocale_kde.cpp:818 8005 #, fuzzy, kde-format 8006 #| msgctxt "KCharselect unicode block name" 8007 #| msgid "Telugu" 8008 msgctxt "digit set" 8009 msgid "Telugu" 8010 msgstr "Телугу" 8011 8012 #: kdecore/klocale_kde.cpp:821 8013 #, fuzzy, kde-format 8014 #| msgid "R. Thaani" 8015 msgctxt "digit set" 8016 msgid "Thai" 8017 msgstr "R. Thaani" 8018 8019 #: kdecore/klocale_kde.cpp:824 8020 #, kde-format 8021 msgctxt "digit set" 8022 msgid "Arabic" 8023 msgstr "Арапски" 8024 8025 #: kdecore/klocale_kde.cpp:829 8026 #, kde-format 8027 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8028 msgid "%1 (%2)" 8029 msgstr "%1 (%2)" 8030 8031 #. i18n: comments below, they are used by the 8032 #. translators. 8033 #. This prefix is shared by all current dialects. 8034 #. i18n: Dumb message, avoid any markup or scripting. 8035 #: kdecore/klocale_kde.cpp:1327 8036 #, kde-format 8037 msgctxt "size in bytes" 8038 msgid "%1 B" 8039 msgstr "%1 B" 8040 8041 #. i18n: Dumb message, avoid any markup or scripting. 8042 #: kdecore/klocale_kde.cpp:1332 8043 #, kde-format 8044 msgctxt "size in 1000 bytes" 8045 msgid "%1 kB" 8046 msgstr "%1 kB" 8047 8048 #. i18n: Dumb message, avoid any markup or scripting. 8049 #: kdecore/klocale_kde.cpp:1334 8050 #, kde-format 8051 msgctxt "size in 10^6 bytes" 8052 msgid "%1 MB" 8053 msgstr "%1 MB" 8054 8055 #. i18n: Dumb message, avoid any markup or scripting. 8056 #: kdecore/klocale_kde.cpp:1336 8057 #, kde-format 8058 msgctxt "size in 10^9 bytes" 8059 msgid "%1 GB" 8060 msgstr "%1 GB" 8061 8062 #. i18n: Dumb message, avoid any markup or scripting. 8063 #: kdecore/klocale_kde.cpp:1338 8064 #, kde-format 8065 msgctxt "size in 10^12 bytes" 8066 msgid "%1 TB" 8067 msgstr "%1 TB" 8068 8069 #. i18n: Dumb message, avoid any markup or scripting. 8070 #: kdecore/klocale_kde.cpp:1340 8071 #, kde-format 8072 msgctxt "size in 10^15 bytes" 8073 msgid "%1 PB" 8074 msgstr "%1 PB" 8075 8076 #. i18n: Dumb message, avoid any markup or scripting. 8077 #: kdecore/klocale_kde.cpp:1342 8078 #, kde-format 8079 msgctxt "size in 10^18 bytes" 8080 msgid "%1 EB" 8081 msgstr "%1 EB" 8082 8083 #. i18n: Dumb message, avoid any markup or scripting. 8084 #: kdecore/klocale_kde.cpp:1344 8085 #, kde-format 8086 msgctxt "size in 10^21 bytes" 8087 msgid "%1 ZB" 8088 msgstr "%1 ZB" 8089 8090 #. i18n: Dumb message, avoid any markup or scripting. 8091 #: kdecore/klocale_kde.cpp:1346 8092 #, kde-format 8093 msgctxt "size in 10^24 bytes" 8094 msgid "%1 YB" 8095 msgstr "%1 YB" 8096 8097 #. i18n: Dumb message, avoid any markup or scripting. 8098 #: kdecore/klocale_kde.cpp:1351 8099 #, kde-format 8100 msgctxt "memory size in 1024 bytes" 8101 msgid "%1 KB" 8102 msgstr "%1 KB" 8103 8104 #. i18n: Dumb message, avoid any markup or scripting. 8105 #: kdecore/klocale_kde.cpp:1353 8106 #, kde-format 8107 msgctxt "memory size in 2^20 bytes" 8108 msgid "%1 MB" 8109 msgstr "%1 MB" 8110 8111 #. i18n: Dumb message, avoid any markup or scripting. 8112 #: kdecore/klocale_kde.cpp:1355 8113 #, kde-format 8114 msgctxt "memory size in 2^30 bytes" 8115 msgid "%1 GB" 8116 msgstr "%1 GB" 8117 8118 #. i18n: Dumb message, avoid any markup or scripting. 8119 #: kdecore/klocale_kde.cpp:1357 8120 #, kde-format 8121 msgctxt "memory size in 2^40 bytes" 8122 msgid "%1 TB" 8123 msgstr "%1 TB" 8124 8125 #. i18n: Dumb message, avoid any markup or scripting. 8126 #: kdecore/klocale_kde.cpp:1359 8127 #, fuzzy, kde-format 8128 #| msgctxt "size in 10^15 bytes" 8129 #| msgid "%1 PB" 8130 msgctxt "memory size in 2^50 bytes" 8131 msgid "%1 PB" 8132 msgstr "%1 PB" 8133 8134 #. i18n: Dumb message, avoid any markup or scripting. 8135 #: kdecore/klocale_kde.cpp:1361 8136 #, fuzzy, kde-format 8137 #| msgctxt "size in 10^18 bytes" 8138 #| msgid "%1 EB" 8139 msgctxt "memory size in 2^60 bytes" 8140 msgid "%1 EB" 8141 msgstr "%1 EB" 8142 8143 #. i18n: Dumb message, avoid any markup or scripting. 8144 #: kdecore/klocale_kde.cpp:1363 8145 #, fuzzy, kde-format 8146 #| msgctxt "size in 10^21 bytes" 8147 #| msgid "%1 ZB" 8148 msgctxt "memory size in 2^70 bytes" 8149 msgid "%1 ZB" 8150 msgstr "%1 ZB" 8151 8152 #. i18n: Dumb message, avoid any markup or scripting. 8153 #: kdecore/klocale_kde.cpp:1365 8154 #, fuzzy, kde-format 8155 #| msgctxt "size in 10^24 bytes" 8156 #| msgid "%1 YB" 8157 msgctxt "memory size in 2^80 bytes" 8158 msgid "%1 YB" 8159 msgstr "%1 YB" 8160 8161 #. i18n: Dumb message, avoid any markup or scripting. 8162 #: kdecore/klocale_kde.cpp:1371 8163 #, kde-format 8164 msgctxt "size in 1024 bytes" 8165 msgid "%1 KiB" 8166 msgstr "%1 KiB" 8167 8168 #. i18n: Dumb message, avoid any markup or scripting. 8169 #: kdecore/klocale_kde.cpp:1373 8170 #, kde-format 8171 msgctxt "size in 2^20 bytes" 8172 msgid "%1 MiB" 8173 msgstr "%1 MiB" 8174 8175 #. i18n: Dumb message, avoid any markup or scripting. 8176 #: kdecore/klocale_kde.cpp:1375 8177 #, kde-format 8178 msgctxt "size in 2^30 bytes" 8179 msgid "%1 GiB" 8180 msgstr "%1 GiB" 8181 8182 #. i18n: Dumb message, avoid any markup or scripting. 8183 #: kdecore/klocale_kde.cpp:1377 8184 #, kde-format 8185 msgctxt "size in 2^40 bytes" 8186 msgid "%1 TiB" 8187 msgstr "%1 TiB" 8188 8189 #. i18n: Dumb message, avoid any markup or scripting. 8190 #: kdecore/klocale_kde.cpp:1379 8191 #, fuzzy, kde-format 8192 #| msgctxt "size in 2^40 bytes" 8193 #| msgid "%1 PiB" 8194 msgctxt "size in 2^50 bytes" 8195 msgid "%1 PiB" 8196 msgstr "%1 PiB" 8197 8198 #. i18n: Dumb message, avoid any markup or scripting. 8199 #: kdecore/klocale_kde.cpp:1381 8200 #, fuzzy, kde-format 8201 #| msgctxt "size in 2^50 bytes" 8202 #| msgid "%1 EiB" 8203 msgctxt "size in 2^60 bytes" 8204 msgid "%1 EiB" 8205 msgstr "%1 EiB" 8206 8207 #. i18n: Dumb message, avoid any markup or scripting. 8208 #: kdecore/klocale_kde.cpp:1383 8209 #, fuzzy, kde-format 8210 #| msgctxt "size in 2^60 bytes" 8211 #| msgid "%1 ZiB" 8212 msgctxt "size in 2^70 bytes" 8213 msgid "%1 ZiB" 8214 msgstr "%1 ZiB" 8215 8216 #. i18n: Dumb message, avoid any markup or scripting. 8217 #: kdecore/klocale_kde.cpp:1385 8218 #, fuzzy, kde-format 8219 #| msgctxt "size in 2^70 bytes" 8220 #| msgid "%1 YiB" 8221 msgctxt "size in 2^80 bytes" 8222 msgid "%1 YiB" 8223 msgstr "%1 YiB" 8224 8225 #: kdecore/klocale_kde.cpp:1472 8226 #, kde-format 8227 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8228 msgid "%1 days" 8229 msgstr "%1 дена" 8230 8231 #: kdecore/klocale_kde.cpp:1475 8232 #, kde-format 8233 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8234 msgid "%1 hours" 8235 msgstr "%1 часа" 8236 8237 #: kdecore/klocale_kde.cpp:1478 8238 #, kde-format 8239 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8240 msgid "%1 minutes" 8241 msgstr "%1 минути" 8242 8243 #: kdecore/klocale_kde.cpp:1481 8244 #, kde-format 8245 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8246 msgid "%1 seconds" 8247 msgstr "%1 секунди" 8248 8249 #: kdecore/klocale_kde.cpp:1484 8250 #, kde-format 8251 msgctxt "@item:intext" 8252 msgid "%1 millisecond" 8253 msgid_plural "%1 milliseconds" 8254 msgstr[0] "" 8255 msgstr[1] "" 8256 msgstr[2] "" 8257 8258 #: kdecore/klocale_kde.cpp:1491 8259 #, kde-format 8260 msgctxt "@item:intext" 8261 msgid "1 day" 8262 msgid_plural "%1 days" 8263 msgstr[0] "" 8264 msgstr[1] "" 8265 msgstr[2] "" 8266 8267 #: kdecore/klocale_kde.cpp:1493 8268 #, kde-format 8269 msgctxt "@item:intext" 8270 msgid "1 hour" 8271 msgid_plural "%1 hours" 8272 msgstr[0] "" 8273 msgstr[1] "" 8274 msgstr[2] "" 8275 8276 #: kdecore/klocale_kde.cpp:1495 8277 #, kde-format 8278 msgctxt "@item:intext" 8279 msgid "1 minute" 8280 msgid_plural "%1 minutes" 8281 msgstr[0] "" 8282 msgstr[1] "" 8283 msgstr[2] "" 8284 8285 #: kdecore/klocale_kde.cpp:1497 8286 #, kde-format 8287 msgctxt "@item:intext" 8288 msgid "1 second" 8289 msgid_plural "%1 seconds" 8290 msgstr[0] "" 8291 msgstr[1] "" 8292 msgstr[2] "" 8293 8294 #: kdecore/klocale_kde.cpp:1521 8295 #, kde-format 8296 msgctxt "" 8297 "@item:intext days and hours. This uses the previous item:intext messages. If " 8298 "this does not fit the grammar of your language please contact the i18n team " 8299 "to solve the problem" 8300 msgid "%1 and %2" 8301 msgstr "%1 и %2" 8302 8303 #: kdecore/klocale_kde.cpp:1527 8304 #, kde-format 8305 msgctxt "" 8306 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8307 "If this does not fit the grammar of your language please contact the i18n " 8308 "team to solve the problem" 8309 msgid "%1 and %2" 8310 msgstr "%1 и %2" 8311 8312 #: kdecore/klocale_kde.cpp:1534 8313 #, kde-format 8314 msgctxt "" 8315 "@item:intext minutes and seconds. This uses the previous item:intext " 8316 "messages. If this does not fit the grammar of your language please contact " 8317 "the i18n team to solve the problem" 8318 msgid "%1 and %2" 8319 msgstr "%1 и %2" 8320 8321 #: kdecore/klocale_kde.cpp:2153 8322 #, kde-format 8323 msgctxt "Before Noon KLocale::LongName" 8324 msgid "Ante Meridiem" 8325 msgstr "" 8326 8327 #: kdecore/klocale_kde.cpp:2154 8328 #, fuzzy, kde-format 8329 #| msgid "Av" 8330 msgctxt "Before Noon KLocale::ShortName" 8331 msgid "AM" 8332 msgstr "Av" 8333 8334 #: kdecore/klocale_kde.cpp:2155 8335 #, fuzzy, kde-format 8336 #| msgid "Av" 8337 msgctxt "Before Noon KLocale::NarrowName" 8338 msgid "A" 8339 msgstr "Av" 8340 8341 #: kdecore/klocale_kde.cpp:2158 8342 #, kde-format 8343 msgctxt "After Noon KLocale::LongName" 8344 msgid "Post Meridiem" 8345 msgstr "" 8346 8347 #: kdecore/klocale_kde.cpp:2159 8348 #, kde-format 8349 msgctxt "After Noon KLocale::ShortName" 8350 msgid "PM" 8351 msgstr "" 8352 8353 #: kdecore/klocale_kde.cpp:2160 8354 #, kde-format 8355 msgctxt "After Noon KLocale::NarrowName" 8356 msgid "P" 8357 msgstr "" 8358 8359 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8360 #, kde-format 8361 msgctxt "concatenation of dates and time" 8362 msgid "%1 %2" 8363 msgstr "%1 %2" 8364 8365 #: kdecore/klocale_kde.cpp:2267 8366 #, kde-format 8367 msgctxt "concatenation of date/time and time zone" 8368 msgid "%1 %2" 8369 msgstr "%1 %2" 8370 8371 #: kdecore/ksavefile.cpp:99 8372 #, kde-format 8373 msgid "No target filename has been given." 8374 msgstr "" 8375 8376 #: kdecore/ksavefile.cpp:106 8377 #, kde-format 8378 msgid "Already opened." 8379 msgstr "" 8380 8381 #: kdecore/ksavefile.cpp:135 8382 #, kde-format 8383 msgid "Insufficient permissions in target directory." 8384 msgstr "" 8385 8386 #: kdecore/ksavefile.cpp:139 8387 #, kde-format 8388 msgid "Unable to open temporary file." 8389 msgstr "" 8390 8391 #: kdecore/ksavefile.cpp:249 8392 #, kde-format 8393 msgid "Synchronization to disk failed" 8394 msgstr "" 8395 8396 #: kdecore/ksavefile.cpp:280 8397 #, kde-format 8398 msgid "Error during rename." 8399 msgstr "" 8400 8401 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8402 #, kde-format 8403 msgid "Timed out trying to connect to remote host" 8404 msgstr "Истече времето при обидот да се поврзам со оддалечениот компјутер" 8405 8406 #: kdecore/netsupp.cpp:866 8407 #, kde-format 8408 msgid "address family for nodename not supported" 8409 msgstr "Не е поддржана фамилијата на адреси за име на јазол" 8410 8411 #: kdecore/netsupp.cpp:868 8412 #, kde-format 8413 msgid "invalid value for 'ai_flags'" 8414 msgstr "невалидни вредности за „ai_flags“" 8415 8416 #: kdecore/netsupp.cpp:870 8417 #, kde-format 8418 msgid "'ai_family' not supported" 8419 msgstr "не е поддржана „ai_family“" 8420 8421 #: kdecore/netsupp.cpp:872 8422 #, kde-format 8423 msgid "no address associated with nodename" 8424 msgstr "нема придружена адреса со име на јазол" 8425 8426 #: kdecore/netsupp.cpp:874 8427 #, kde-format 8428 msgid "servname not supported for ai_socktype" 8429 msgstr "Не е поддржано servname за ai_socktype" 8430 8431 #: kdecore/netsupp.cpp:875 8432 #, kde-format 8433 msgid "'ai_socktype' not supported" 8434 msgstr "Не е поддржан „ai_socktype“" 8435 8436 #: kdecore/netsupp.cpp:876 8437 #, kde-format 8438 msgid "system error" 8439 msgstr "системска грешка" 8440 8441 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8442 #, kde-format 8443 msgid "KDE Test Program" 8444 msgstr "Програма на KDE за тестирање" 8445 8446 #: kdecore/TIMEZONES:1 8447 #, kde-format 8448 msgid "Africa/Abidjan" 8449 msgstr "Африка/Абиџан" 8450 8451 #: kdecore/TIMEZONES:2 8452 #, kde-format 8453 msgid "Africa/Accra" 8454 msgstr "Африка/Акра" 8455 8456 #: kdecore/TIMEZONES:3 8457 #, kde-format 8458 msgid "Africa/Addis_Ababa" 8459 msgstr "Африка/Адис_Абеба" 8460 8461 #: kdecore/TIMEZONES:4 8462 #, kde-format 8463 msgid "Africa/Algiers" 8464 msgstr "Африка/Алжир" 8465 8466 #: kdecore/TIMEZONES:5 8467 #, kde-format 8468 msgid "Africa/Asmara" 8469 msgstr "Африка/Асмара" 8470 8471 #: kdecore/TIMEZONES:6 8472 #, kde-format 8473 msgid "Africa/Asmera" 8474 msgstr "Африка/Асмера" 8475 8476 #: kdecore/TIMEZONES:7 8477 #, kde-format 8478 msgid "Africa/Bamako" 8479 msgstr "Африка/Бамако" 8480 8481 #: kdecore/TIMEZONES:8 8482 #, kde-format 8483 msgid "Africa/Bangui" 8484 msgstr "Африка/Бангуи" 8485 8486 #: kdecore/TIMEZONES:9 8487 #, kde-format 8488 msgid "Africa/Banjul" 8489 msgstr "Африка/Банџул" 8490 8491 #: kdecore/TIMEZONES:10 8492 #, kde-format 8493 msgid "Africa/Bissau" 8494 msgstr "Африка/Бисау" 8495 8496 #: kdecore/TIMEZONES:11 8497 #, kde-format 8498 msgid "Africa/Blantyre" 8499 msgstr "Африка/Блантир" 8500 8501 #: kdecore/TIMEZONES:12 8502 #, kde-format 8503 msgid "Africa/Brazzaville" 8504 msgstr "Африка/Бразавил" 8505 8506 #: kdecore/TIMEZONES:13 8507 #, kde-format 8508 msgid "Africa/Bujumbura" 8509 msgstr "Африка/Буџумбура" 8510 8511 #: kdecore/TIMEZONES:14 8512 #, kde-format 8513 msgid "Africa/Cairo" 8514 msgstr "Африка/Каиро" 8515 8516 #: kdecore/TIMEZONES:15 8517 #, kde-format 8518 msgid "Africa/Casablanca" 8519 msgstr "Африка/Казабланка" 8520 8521 #: kdecore/TIMEZONES:16 8522 #, kde-format 8523 msgid "Africa/Ceuta" 8524 msgstr "Африка/Сеута" 8525 8526 #. i18n: comment to the previous timezone 8527 #: kdecore/TIMEZONES:18 8528 #, kde-format 8529 msgid "Ceuta & Melilla" 8530 msgstr "" 8531 8532 #. i18n: comment to the previous timezone 8533 #: kdecore/TIMEZONES:20 8534 #, kde-format 8535 msgid "Ceuta, Melilla" 8536 msgstr "" 8537 8538 #: kdecore/TIMEZONES:21 8539 #, kde-format 8540 msgid "Africa/Conakry" 8541 msgstr "Африка/Конакри" 8542 8543 #: kdecore/TIMEZONES:22 8544 #, kde-format 8545 msgid "Africa/Dakar" 8546 msgstr "Африка/Дакар" 8547 8548 #: kdecore/TIMEZONES:23 8549 #, kde-format 8550 msgid "Africa/Dar_es_Salaam" 8551 msgstr "Африка/Дар-ес-Салам" 8552 8553 #: kdecore/TIMEZONES:24 8554 #, kde-format 8555 msgid "Africa/Djibouti" 8556 msgstr "Африка/Џибути" 8557 8558 #: kdecore/TIMEZONES:25 8559 #, kde-format 8560 msgid "Africa/Douala" 8561 msgstr "Африка/Дуала" 8562 8563 #: kdecore/TIMEZONES:26 8564 #, kde-format 8565 msgid "Africa/El_Aaiun" 8566 msgstr "Африка/Ел_Ајун" 8567 8568 #: kdecore/TIMEZONES:27 8569 #, kde-format 8570 msgid "Africa/Freetown" 8571 msgstr "Африка/Фритаун" 8572 8573 #: kdecore/TIMEZONES:28 8574 #, kde-format 8575 msgid "Africa/Gaborone" 8576 msgstr "Африка/Габороне" 8577 8578 #: kdecore/TIMEZONES:29 8579 #, kde-format 8580 msgid "Africa/Harare" 8581 msgstr "Африка/Хараре" 8582 8583 #: kdecore/TIMEZONES:30 8584 #, kde-format 8585 msgid "Africa/Johannesburg" 8586 msgstr "Африка/Јоханесбург" 8587 8588 #: kdecore/TIMEZONES:31 8589 #, fuzzy, kde-format 8590 #| msgid "Africa/Ceuta" 8591 msgid "Africa/Juba" 8592 msgstr "Африка/Сеута" 8593 8594 #: kdecore/TIMEZONES:32 8595 #, kde-format 8596 msgid "Africa/Kampala" 8597 msgstr "Африка/Кампала" 8598 8599 #: kdecore/TIMEZONES:33 8600 #, kde-format 8601 msgid "Africa/Khartoum" 8602 msgstr "Африка/Картум" 8603 8604 #: kdecore/TIMEZONES:34 8605 #, kde-format 8606 msgid "Africa/Kigali" 8607 msgstr "Африка/Кигали" 8608 8609 #: kdecore/TIMEZONES:35 8610 #, kde-format 8611 msgid "Africa/Kinshasa" 8612 msgstr "Африка/Киншаса" 8613 8614 #. i18n: comment to the previous timezone 8615 #: kdecore/TIMEZONES:37 8616 #, kde-format 8617 msgid "west Dem. Rep. of Congo" 8618 msgstr "" 8619 8620 #. i18n: comment to the previous timezone 8621 #: kdecore/TIMEZONES:39 8622 #, kde-format 8623 msgid "Dem. Rep. of Congo (west)" 8624 msgstr "" 8625 8626 #: kdecore/TIMEZONES:40 8627 #, kde-format 8628 msgid "Africa/Lagos" 8629 msgstr "Африка/Лагос" 8630 8631 #: kdecore/TIMEZONES:41 8632 #, kde-format 8633 msgid "Africa/Libreville" 8634 msgstr "Африка/Либревил" 8635 8636 #: kdecore/TIMEZONES:42 8637 #, kde-format 8638 msgid "Africa/Lome" 8639 msgstr "Африка/Ломе" 8640 8641 #: kdecore/TIMEZONES:43 8642 #, kde-format 8643 msgid "Africa/Luanda" 8644 msgstr "Африка/Луанда" 8645 8646 #: kdecore/TIMEZONES:44 8647 #, kde-format 8648 msgid "Africa/Lubumbashi" 8649 msgstr "Африка/Лубумбаши" 8650 8651 #. i18n: comment to the previous timezone 8652 #: kdecore/TIMEZONES:46 8653 #, kde-format 8654 msgid "east Dem. Rep. of Congo" 8655 msgstr "" 8656 8657 #. i18n: comment to the previous timezone 8658 #: kdecore/TIMEZONES:48 8659 #, kde-format 8660 msgid "Dem. Rep. of Congo (east)" 8661 msgstr "" 8662 8663 #: kdecore/TIMEZONES:49 8664 #, kde-format 8665 msgid "Africa/Lusaka" 8666 msgstr "Африка/Лусака" 8667 8668 #: kdecore/TIMEZONES:50 8669 #, kde-format 8670 msgid "Africa/Malabo" 8671 msgstr "Африка/Малабо" 8672 8673 #: kdecore/TIMEZONES:51 8674 #, kde-format 8675 msgid "Africa/Maputo" 8676 msgstr "Африка/Мапуто" 8677 8678 #: kdecore/TIMEZONES:52 8679 #, kde-format 8680 msgid "Africa/Maseru" 8681 msgstr "Африка/Масеру" 8682 8683 #: kdecore/TIMEZONES:53 8684 #, kde-format 8685 msgid "Africa/Mbabane" 8686 msgstr "Африка/Мбабане" 8687 8688 #: kdecore/TIMEZONES:54 8689 #, kde-format 8690 msgid "Africa/Mogadishu" 8691 msgstr "Африка/Могадишу" 8692 8693 #: kdecore/TIMEZONES:55 8694 #, kde-format 8695 msgid "Africa/Monrovia" 8696 msgstr "Африка/Монровиjа" 8697 8698 #: kdecore/TIMEZONES:56 8699 #, kde-format 8700 msgid "Africa/Nairobi" 8701 msgstr "Африка/Најроби" 8702 8703 #: kdecore/TIMEZONES:57 8704 #, kde-format 8705 msgid "Africa/Ndjamena" 8706 msgstr "Африка/Нџамена" 8707 8708 #: kdecore/TIMEZONES:58 8709 #, kde-format 8710 msgid "Africa/Niamey" 8711 msgstr "Африка/Ниамеј" 8712 8713 #: kdecore/TIMEZONES:59 8714 #, kde-format 8715 msgid "Africa/Nouakchott" 8716 msgstr "Африка/Нуакшот" 8717 8718 #: kdecore/TIMEZONES:60 8719 #, kde-format 8720 msgid "Africa/Ouagadougou" 8721 msgstr "Африка/Уагадугу" 8722 8723 #: kdecore/TIMEZONES:61 8724 #, kde-format 8725 msgid "Africa/Porto-Novo" 8726 msgstr "Африка/Порто_Ново" 8727 8728 #: kdecore/TIMEZONES:62 8729 #, fuzzy, kde-format 8730 #| msgid "Africa/Ceuta" 8731 msgid "Africa/Pretoria" 8732 msgstr "Африка/Сеута" 8733 8734 #: kdecore/TIMEZONES:63 8735 #, kde-format 8736 msgid "Africa/Sao_Tome" 8737 msgstr "Африка/Сао_Томе" 8738 8739 #: kdecore/TIMEZONES:64 8740 #, kde-format 8741 msgid "Africa/Timbuktu" 8742 msgstr "Африка/Тимбукту" 8743 8744 #: kdecore/TIMEZONES:65 8745 #, kde-format 8746 msgid "Africa/Tripoli" 8747 msgstr "Африка/Триполи" 8748 8749 #: kdecore/TIMEZONES:66 8750 #, kde-format 8751 msgid "Africa/Tunis" 8752 msgstr "Африка/Тунис" 8753 8754 #: kdecore/TIMEZONES:67 8755 #, kde-format 8756 msgid "Africa/Windhoek" 8757 msgstr "Африка/Виндхук" 8758 8759 #: kdecore/TIMEZONES:68 8760 #, kde-format 8761 msgid "America/Adak" 8762 msgstr "Америка/Адак" 8763 8764 #. i18n: comment to the previous timezone 8765 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8766 #, kde-format 8767 msgid "Aleutian Islands" 8768 msgstr "" 8769 8770 #: kdecore/TIMEZONES:71 8771 #, kde-format 8772 msgid "America/Anchorage" 8773 msgstr "Америка/Енкориџ" 8774 8775 #. i18n: comment to the previous timezone 8776 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8777 #, kde-format 8778 msgid "Alaska Time" 8779 msgstr "" 8780 8781 #. i18n: comment to the previous timezone 8782 #: kdecore/TIMEZONES:75 8783 #, kde-format 8784 msgid "Alaska (most areas)" 8785 msgstr "" 8786 8787 #: kdecore/TIMEZONES:76 8788 #, kde-format 8789 msgid "America/Anguilla" 8790 msgstr "Америка/Ангилја" 8791 8792 #: kdecore/TIMEZONES:77 8793 #, kde-format 8794 msgid "America/Antigua" 8795 msgstr "Америка/Антигва" 8796 8797 #: kdecore/TIMEZONES:78 8798 #, kde-format 8799 msgid "America/Araguaina" 8800 msgstr "Америка/Арагвајана" 8801 8802 #. i18n: comment to the previous timezone 8803 #: kdecore/TIMEZONES:80 8804 #, kde-format 8805 msgid "Tocantins" 8806 msgstr "" 8807 8808 #: kdecore/TIMEZONES:81 8809 #, kde-format 8810 msgid "America/Argentina/Buenos_Aires" 8811 msgstr "Америка/Аргентина/Буенос_Аирес" 8812 8813 #. i18n: comment to the previous timezone 8814 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8815 #, kde-format 8816 msgid "Buenos Aires (BA, CF)" 8817 msgstr "" 8818 8819 #: kdecore/TIMEZONES:84 8820 #, kde-format 8821 msgid "America/Argentina/Catamarca" 8822 msgstr "Америка/Аргентина/Катамарка" 8823 8824 #. i18n: comment to the previous timezone 8825 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8826 #, kde-format 8827 msgid "Catamarca (CT), Chubut (CH)" 8828 msgstr "" 8829 8830 #. i18n: comment to the previous timezone 8831 #: kdecore/TIMEZONES:88 8832 #, kde-format 8833 msgid "Catamarca (CT); Chubut (CH)" 8834 msgstr "" 8835 8836 #: kdecore/TIMEZONES:89 8837 #, kde-format 8838 msgid "America/Argentina/ComodRivadavia" 8839 msgstr "Америка/Аргентина/КомодРивадавиа" 8840 8841 #: kdecore/TIMEZONES:92 8842 #, kde-format 8843 msgid "America/Argentina/Cordoba" 8844 msgstr "Америка/Аргентина/Кордоба" 8845 8846 #. i18n: comment to the previous timezone 8847 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8848 #, kde-format 8849 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8850 msgstr "" 8851 8852 #. i18n: comment to the previous timezone 8853 #: kdecore/TIMEZONES:96 8854 #, kde-format 8855 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8856 msgstr "" 8857 8858 #. i18n: comment to the previous timezone 8859 #: kdecore/TIMEZONES:98 8860 #, kde-format 8861 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8862 msgstr "" 8863 8864 #: kdecore/TIMEZONES:99 8865 #, kde-format 8866 msgid "America/Argentina/Jujuy" 8867 msgstr "Америка/Аргентина/Џуџуи" 8868 8869 #. i18n: comment to the previous timezone 8870 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8871 #, kde-format 8872 msgid "Jujuy (JY)" 8873 msgstr "" 8874 8875 #: kdecore/TIMEZONES:102 8876 #, kde-format 8877 msgid "America/Argentina/La_Rioja" 8878 msgstr "Америка/Аргентина/Ла_Риоха" 8879 8880 #. i18n: comment to the previous timezone 8881 #: kdecore/TIMEZONES:104 8882 #, kde-format 8883 msgid "La Rioja (LR)" 8884 msgstr "" 8885 8886 #: kdecore/TIMEZONES:105 8887 #, kde-format 8888 msgid "America/Argentina/Mendoza" 8889 msgstr "Америка/Аргентина/Мендоза" 8890 8891 #. i18n: comment to the previous timezone 8892 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8893 #, kde-format 8894 msgid "Mendoza (MZ)" 8895 msgstr "" 8896 8897 #: kdecore/TIMEZONES:108 8898 #, kde-format 8899 msgid "America/Argentina/Rio_Gallegos" 8900 msgstr "Америка/Аргентина/Рио_Галјегос" 8901 8902 #. i18n: comment to the previous timezone 8903 #: kdecore/TIMEZONES:110 8904 #, kde-format 8905 msgid "Santa Cruz (SC)" 8906 msgstr "" 8907 8908 #: kdecore/TIMEZONES:111 8909 #, fuzzy, kde-format 8910 #| msgid "America/Argentina/San_Juan" 8911 msgid "America/Argentina/Salta" 8912 msgstr "Америка/Аргентина/Сан_Хуан" 8913 8914 #. i18n: comment to the previous timezone 8915 #: kdecore/TIMEZONES:113 8916 #, kde-format 8917 msgid "(SA, LP, NQ, RN)" 8918 msgstr "" 8919 8920 #. i18n: comment to the previous timezone 8921 #: kdecore/TIMEZONES:115 8922 #, kde-format 8923 msgid "Salta (SA, LP, NQ, RN)" 8924 msgstr "" 8925 8926 #: kdecore/TIMEZONES:116 8927 #, kde-format 8928 msgid "America/Argentina/San_Juan" 8929 msgstr "Америка/Аргентина/Сан_Хуан" 8930 8931 #. i18n: comment to the previous timezone 8932 #: kdecore/TIMEZONES:118 8933 #, kde-format 8934 msgid "San Juan (SJ)" 8935 msgstr "" 8936 8937 #: kdecore/TIMEZONES:119 8938 #, fuzzy, kde-format 8939 #| msgid "America/Argentina/San_Juan" 8940 msgid "America/Argentina/San_Luis" 8941 msgstr "Америка/Аргентина/Сан_Хуан" 8942 8943 #. i18n: comment to the previous timezone 8944 #: kdecore/TIMEZONES:121 8945 #, kde-format 8946 msgid "San Luis (SL)" 8947 msgstr "" 8948 8949 #: kdecore/TIMEZONES:122 8950 #, kde-format 8951 msgid "America/Argentina/Tucuman" 8952 msgstr "Америка/Аргентина/Тукуман" 8953 8954 #. i18n: comment to the previous timezone 8955 #: kdecore/TIMEZONES:124 8956 #, kde-format 8957 msgid "Tucuman (TM)" 8958 msgstr "" 8959 8960 #: kdecore/TIMEZONES:125 8961 #, kde-format 8962 msgid "America/Argentina/Ushuaia" 8963 msgstr "Америка/Аргентина/Ушуаја" 8964 8965 #. i18n: comment to the previous timezone 8966 #: kdecore/TIMEZONES:127 8967 #, kde-format 8968 msgid "Tierra del Fuego (TF)" 8969 msgstr "" 8970 8971 #: kdecore/TIMEZONES:128 8972 #, kde-format 8973 msgid "America/Aruba" 8974 msgstr "Америка/Аруба" 8975 8976 #: kdecore/TIMEZONES:129 8977 #, kde-format 8978 msgid "America/Asuncion" 8979 msgstr "Америка/Асунсион" 8980 8981 #: kdecore/TIMEZONES:130 8982 #, kde-format 8983 msgid "America/Atikokan" 8984 msgstr "Америка/Атикокан" 8985 8986 #. i18n: comment to the previous timezone 8987 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8988 #, kde-format 8989 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8990 msgstr "" 8991 8992 #. i18n: comment to the previous timezone 8993 #: kdecore/TIMEZONES:134 8994 #, kde-format 8995 msgid "EST - ON (Atikokan); NU (Coral H)" 8996 msgstr "" 8997 8998 #: kdecore/TIMEZONES:135 8999 #, fuzzy, kde-format 9000 #| msgid "America/Atikokan" 9001 msgid "America/Atka" 9002 msgstr "Америка/Атикокан" 9003 9004 #: kdecore/TIMEZONES:138 9005 #, kde-format 9006 msgid "America/Bahia" 9007 msgstr "Америка/Бaија" 9008 9009 #. i18n: comment to the previous timezone 9010 #: kdecore/TIMEZONES:140 9011 #, kde-format 9012 msgid "Bahia" 9013 msgstr "" 9014 9015 #: kdecore/TIMEZONES:141 9016 #, fuzzy, kde-format 9017 #| msgid "America/Bahia" 9018 msgid "America/Bahia_Banderas" 9019 msgstr "Америка/Бaија" 9020 9021 #. i18n: comment to the previous timezone 9022 #: kdecore/TIMEZONES:143 9023 #, kde-format 9024 msgid "Mexican Central Time - Bahia de Banderas" 9025 msgstr "" 9026 9027 #. i18n: comment to the previous timezone 9028 #: kdecore/TIMEZONES:145 9029 #, kde-format 9030 msgid "Central Time - Bahia de Banderas" 9031 msgstr "" 9032 9033 #: kdecore/TIMEZONES:146 9034 #, kde-format 9035 msgid "America/Barbados" 9036 msgstr "Америка/Барбадос" 9037 9038 #: kdecore/TIMEZONES:147 9039 #, kde-format 9040 msgid "America/Belem" 9041 msgstr "Америка/Белем" 9042 9043 #. i18n: comment to the previous timezone 9044 #: kdecore/TIMEZONES:149 9045 #, kde-format 9046 msgid "Amapa, E Para" 9047 msgstr "" 9048 9049 #. i18n: comment to the previous timezone 9050 #: kdecore/TIMEZONES:151 9051 #, kde-format 9052 msgid "Para (east); Amapa" 9053 msgstr "" 9054 9055 #: kdecore/TIMEZONES:152 9056 #, kde-format 9057 msgid "America/Belize" 9058 msgstr "Америка/Белизе" 9059 9060 #: kdecore/TIMEZONES:153 9061 #, kde-format 9062 msgid "America/Blanc-Sablon" 9063 msgstr "Америка/Бланк-Саблон" 9064 9065 #. i18n: comment to the previous timezone 9066 #: kdecore/TIMEZONES:155 9067 #, kde-format 9068 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9069 msgstr "" 9070 9071 #. i18n: comment to the previous timezone 9072 #: kdecore/TIMEZONES:157 9073 #, kde-format 9074 msgid "AST - QC (Lower North Shore)" 9075 msgstr "" 9076 9077 #: kdecore/TIMEZONES:158 9078 #, kde-format 9079 msgid "America/Boa_Vista" 9080 msgstr "Америка/Боа_Виста" 9081 9082 #. i18n: comment to the previous timezone 9083 #: kdecore/TIMEZONES:160 9084 #, kde-format 9085 msgid "Roraima" 9086 msgstr "" 9087 9088 #: kdecore/TIMEZONES:161 9089 #, kde-format 9090 msgid "America/Bogota" 9091 msgstr "Америка/Богота" 9092 9093 #: kdecore/TIMEZONES:162 9094 #, kde-format 9095 msgid "America/Boise" 9096 msgstr "Америка/Боиси" 9097 9098 #. i18n: comment to the previous timezone 9099 #: kdecore/TIMEZONES:164 9100 #, kde-format 9101 msgid "Mountain Time - south Idaho & east Oregon" 9102 msgstr "" 9103 9104 #. i18n: comment to the previous timezone 9105 #: kdecore/TIMEZONES:166 9106 #, kde-format 9107 msgid "Mountain - ID (south); OR (east)" 9108 msgstr "" 9109 9110 #: kdecore/TIMEZONES:167 9111 #, kde-format 9112 msgid "America/Buenos_Aires" 9113 msgstr "Америка/Буенос_Аирес" 9114 9115 #: kdecore/TIMEZONES:170 9116 #, fuzzy, kde-format 9117 #| msgid "America/Cayman" 9118 msgid "America/Calgary" 9119 msgstr "Америка/Кајман" 9120 9121 #. i18n: comment to the previous timezone 9122 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9123 #, kde-format 9124 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9125 msgstr "" 9126 9127 #: kdecore/TIMEZONES:173 9128 #, kde-format 9129 msgid "America/Cambridge_Bay" 9130 msgstr "Америка/Кембриџ_Беј" 9131 9132 #. i18n: comment to the previous timezone 9133 #: kdecore/TIMEZONES:175 9134 #, kde-format 9135 msgid "Mountain Time - west Nunavut" 9136 msgstr "" 9137 9138 #. i18n: comment to the previous timezone 9139 #: kdecore/TIMEZONES:177 9140 #, kde-format 9141 msgid "Mountain - NU (west)" 9142 msgstr "" 9143 9144 #: kdecore/TIMEZONES:178 9145 #, kde-format 9146 msgid "America/Campo_Grande" 9147 msgstr "Америка/Кампо_Гранде" 9148 9149 #. i18n: comment to the previous timezone 9150 #: kdecore/TIMEZONES:180 9151 #, kde-format 9152 msgid "Mato Grosso do Sul" 9153 msgstr "" 9154 9155 #: kdecore/TIMEZONES:181 9156 #, kde-format 9157 msgid "America/Cancun" 9158 msgstr "Америка/Канкун" 9159 9160 #. i18n: comment to the previous timezone 9161 #: kdecore/TIMEZONES:183 9162 #, kde-format 9163 msgid "Central Time - Quintana Roo" 9164 msgstr "" 9165 9166 #. i18n: comment to the previous timezone 9167 #: kdecore/TIMEZONES:185 9168 #, kde-format 9169 msgid "Eastern Standard Time - Quintana Roo" 9170 msgstr "" 9171 9172 #: kdecore/TIMEZONES:186 9173 #, kde-format 9174 msgid "America/Caracas" 9175 msgstr "Америка/Каракас" 9176 9177 #: kdecore/TIMEZONES:187 9178 #, kde-format 9179 msgid "America/Catamarca" 9180 msgstr "Америка/Катамарка" 9181 9182 #: kdecore/TIMEZONES:190 9183 #, kde-format 9184 msgid "America/Cayenne" 9185 msgstr "Америка/Кајен" 9186 9187 #: kdecore/TIMEZONES:191 9188 #, kde-format 9189 msgid "America/Cayman" 9190 msgstr "Америка/Кајман" 9191 9192 #: kdecore/TIMEZONES:192 9193 #, kde-format 9194 msgid "America/Chicago" 9195 msgstr "Америка/Чикаго" 9196 9197 #. i18n: comment to the previous timezone 9198 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9199 #, kde-format 9200 msgid "Central Time" 9201 msgstr "" 9202 9203 #. i18n: comment to the previous timezone 9204 #: kdecore/TIMEZONES:196 9205 #, kde-format 9206 msgid "Central (most areas)" 9207 msgstr "" 9208 9209 #: kdecore/TIMEZONES:197 9210 #, kde-format 9211 msgid "America/Chihuahua" 9212 msgstr "Америка/Чихуахуа" 9213 9214 #. i18n: comment to the previous timezone 9215 #: kdecore/TIMEZONES:199 9216 #, kde-format 9217 msgid "Mountain Time - Chihuahua" 9218 msgstr "" 9219 9220 #. i18n: comment to the previous timezone 9221 #: kdecore/TIMEZONES:201 9222 #, kde-format 9223 msgid "Mexican Mountain Time - Chihuahua away from US border" 9224 msgstr "" 9225 9226 #. i18n: comment to the previous timezone 9227 #: kdecore/TIMEZONES:203 9228 #, kde-format 9229 msgid "Mountain Time - Chihuahua (most areas)" 9230 msgstr "" 9231 9232 #: kdecore/TIMEZONES:204 9233 #, fuzzy, kde-format 9234 #| msgid "America/Curacao" 9235 msgid "America/Coral_Harbour" 9236 msgstr "Америка/Курасао" 9237 9238 #: kdecore/TIMEZONES:207 9239 #, kde-format 9240 msgid "America/Cordoba" 9241 msgstr "Америка/Кордоба" 9242 9243 #: kdecore/TIMEZONES:210 9244 #, kde-format 9245 msgid "America/Costa_Rica" 9246 msgstr "Америка/Костарика" 9247 9248 #: kdecore/TIMEZONES:211 9249 #, fuzzy, kde-format 9250 #| msgid "Africa/Freetown" 9251 msgid "America/Creston" 9252 msgstr "Африка/Фритаун" 9253 9254 #. i18n: comment to the previous timezone 9255 #: kdecore/TIMEZONES:213 9256 #, kde-format 9257 msgid "Mountain Standard Time - Creston, British Columbia" 9258 msgstr "" 9259 9260 #. i18n: comment to the previous timezone 9261 #: kdecore/TIMEZONES:215 9262 #, kde-format 9263 msgid "MST - BC (Creston)" 9264 msgstr "" 9265 9266 #: kdecore/TIMEZONES:216 9267 #, kde-format 9268 msgid "America/Cuiaba" 9269 msgstr "Америка/Кујаба" 9270 9271 #. i18n: comment to the previous timezone 9272 #: kdecore/TIMEZONES:218 9273 #, kde-format 9274 msgid "Mato Grosso" 9275 msgstr "" 9276 9277 #: kdecore/TIMEZONES:219 9278 #, kde-format 9279 msgid "America/Curacao" 9280 msgstr "Америка/Курасао" 9281 9282 #: kdecore/TIMEZONES:220 9283 #, kde-format 9284 msgid "America/Danmarkshavn" 9285 msgstr "Америка/ДанмарксХавн" 9286 9287 #. i18n: comment to the previous timezone 9288 #: kdecore/TIMEZONES:222 9289 #, kde-format 9290 msgid "east coast, north of Scoresbysund" 9291 msgstr "" 9292 9293 #. i18n: comment to the previous timezone 9294 #: kdecore/TIMEZONES:224 9295 #, kde-format 9296 msgid "National Park (east coast)" 9297 msgstr "" 9298 9299 #: kdecore/TIMEZONES:225 9300 #, kde-format 9301 msgid "America/Dawson" 9302 msgstr "Америка/Доусон" 9303 9304 #. i18n: comment to the previous timezone 9305 #: kdecore/TIMEZONES:227 9306 #, kde-format 9307 msgid "Pacific Time - north Yukon" 9308 msgstr "" 9309 9310 #. i18n: comment to the previous timezone 9311 #: kdecore/TIMEZONES:229 9312 #, kde-format 9313 msgid "MST - Yukon (west)" 9314 msgstr "" 9315 9316 #: kdecore/TIMEZONES:230 9317 #, kde-format 9318 msgid "America/Dawson_Creek" 9319 msgstr "Америка/Доусон_Крик" 9320 9321 #. i18n: comment to the previous timezone 9322 #: kdecore/TIMEZONES:232 9323 #, kde-format 9324 msgid "" 9325 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9326 msgstr "" 9327 9328 #. i18n: comment to the previous timezone 9329 #: kdecore/TIMEZONES:234 9330 #, kde-format 9331 msgid "MST - BC (Dawson Cr, Ft St John)" 9332 msgstr "" 9333 9334 #: kdecore/TIMEZONES:235 9335 #, kde-format 9336 msgid "America/Denver" 9337 msgstr "Америка/Денвер" 9338 9339 #. i18n: comment to the previous timezone 9340 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9341 #, kde-format 9342 msgid "Mountain Time" 9343 msgstr "" 9344 9345 #. i18n: comment to the previous timezone 9346 #: kdecore/TIMEZONES:239 9347 #, kde-format 9348 msgid "Mountain (most areas)" 9349 msgstr "" 9350 9351 #: kdecore/TIMEZONES:240 9352 #, kde-format 9353 msgid "America/Detroit" 9354 msgstr "Америка/Детроит" 9355 9356 #. i18n: comment to the previous timezone 9357 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9358 #, kde-format 9359 msgid "Eastern Time - Michigan - most locations" 9360 msgstr "" 9361 9362 #. i18n: comment to the previous timezone 9363 #: kdecore/TIMEZONES:244 9364 #, kde-format 9365 msgid "Eastern - MI (most areas)" 9366 msgstr "" 9367 9368 #: kdecore/TIMEZONES:245 9369 #, kde-format 9370 msgid "America/Dominica" 9371 msgstr "Америка/Доминика" 9372 9373 #: kdecore/TIMEZONES:246 9374 #, kde-format 9375 msgid "America/Edmonton" 9376 msgstr "Америка/Едмонтон" 9377 9378 #. i18n: comment to the previous timezone 9379 #: kdecore/TIMEZONES:250 9380 #, kde-format 9381 msgid "Mountain - AB; BC (E); SK (W)" 9382 msgstr "" 9383 9384 #: kdecore/TIMEZONES:251 9385 #, kde-format 9386 msgid "America/Eirunepe" 9387 msgstr "Америка/Еирунепе" 9388 9389 #. i18n: comment to the previous timezone 9390 #: kdecore/TIMEZONES:253 9391 #, kde-format 9392 msgid "W Amazonas" 9393 msgstr "" 9394 9395 #. i18n: comment to the previous timezone 9396 #: kdecore/TIMEZONES:255 9397 #, kde-format 9398 msgid "Amazonas (west)" 9399 msgstr "" 9400 9401 #: kdecore/TIMEZONES:256 9402 #, kde-format 9403 msgid "America/El_Salvador" 9404 msgstr "Америка/Ел_Салвадор" 9405 9406 #: kdecore/TIMEZONES:257 9407 #, fuzzy, kde-format 9408 #| msgid "America/Grenada" 9409 msgid "America/Ensenada" 9410 msgstr "Америка/Гренада" 9411 9412 #. i18n: comment to the previous timezone 9413 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9414 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9415 #, fuzzy, kde-format 9416 #| msgid "Pacific/Niue" 9417 msgid "Pacific Time" 9418 msgstr "Пацифик/Ниуе" 9419 9420 #: kdecore/TIMEZONES:260 9421 #, fuzzy, kde-format 9422 #| msgid "America/Porto_Velho" 9423 msgid "America/Fort_Nelson" 9424 msgstr "Америка/Порто_Велјо" 9425 9426 #. i18n: comment to the previous timezone 9427 #: kdecore/TIMEZONES:262 9428 #, kde-format 9429 msgid "MST - BC (Ft Nelson)" 9430 msgstr "" 9431 9432 #: kdecore/TIMEZONES:263 9433 #, fuzzy, kde-format 9434 #| msgid "America/Fortaleza" 9435 msgid "America/Fort_Wayne" 9436 msgstr "Америка/Форталеза" 9437 9438 #. i18n: comment to the previous timezone 9439 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9440 #: kdecore/TIMEZONES:1419 9441 #, kde-format 9442 msgid "Eastern Time - Indiana - most locations" 9443 msgstr "" 9444 9445 #: kdecore/TIMEZONES:266 9446 #, kde-format 9447 msgid "America/Fortaleza" 9448 msgstr "Америка/Форталеза" 9449 9450 #. i18n: comment to the previous timezone 9451 #: kdecore/TIMEZONES:268 9452 #, kde-format 9453 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9454 msgstr "" 9455 9456 #. i18n: comment to the previous timezone 9457 #: kdecore/TIMEZONES:270 9458 #, kde-format 9459 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9460 msgstr "" 9461 9462 #: kdecore/TIMEZONES:271 9463 #, fuzzy, kde-format 9464 #| msgid "Africa/Freetown" 9465 msgid "America/Fredericton" 9466 msgstr "Африка/Фритаун" 9467 9468 #. i18n: comment to the previous timezone 9469 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9470 #, kde-format 9471 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9472 msgstr "" 9473 9474 #: kdecore/TIMEZONES:274 9475 #, kde-format 9476 msgid "America/Glace_Bay" 9477 msgstr "Америка/Глејс_Беј" 9478 9479 #. i18n: comment to the previous timezone 9480 #: kdecore/TIMEZONES:276 9481 #, kde-format 9482 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9483 msgstr "" 9484 9485 #. i18n: comment to the previous timezone 9486 #: kdecore/TIMEZONES:278 9487 #, fuzzy, kde-format 9488 #| msgid "Atlantic/Cape_Verde" 9489 msgid "Atlantic - NS (Cape Breton)" 9490 msgstr "Атлантик/Кејп_Верде" 9491 9492 #: kdecore/TIMEZONES:279 9493 #, kde-format 9494 msgid "America/Godthab" 9495 msgstr "Америка/Готхоб" 9496 9497 #. i18n: comment to the previous timezone 9498 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9499 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9500 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9501 #: kdecore/TIMEZONES:1350 9502 #, kde-format 9503 msgid "most locations" 9504 msgstr "" 9505 9506 #: kdecore/TIMEZONES:282 9507 #, kde-format 9508 msgid "America/Goose_Bay" 9509 msgstr "Америка/Гус_Беј" 9510 9511 #. i18n: comment to the previous timezone 9512 #: kdecore/TIMEZONES:284 9513 #, kde-format 9514 msgid "Atlantic Time - Labrador - most locations" 9515 msgstr "" 9516 9517 #. i18n: comment to the previous timezone 9518 #: kdecore/TIMEZONES:286 9519 #, kde-format 9520 msgid "Atlantic - Labrador (most areas)" 9521 msgstr "" 9522 9523 #: kdecore/TIMEZONES:287 9524 #, kde-format 9525 msgid "America/Grand_Turk" 9526 msgstr "Америка/Гранд_Турк" 9527 9528 #: kdecore/TIMEZONES:288 9529 #, kde-format 9530 msgid "America/Grenada" 9531 msgstr "Америка/Гренада" 9532 9533 #: kdecore/TIMEZONES:289 9534 #, kde-format 9535 msgid "America/Guadeloupe" 9536 msgstr "Америка/Гвадалупе" 9537 9538 #: kdecore/TIMEZONES:290 9539 #, kde-format 9540 msgid "America/Guatemala" 9541 msgstr "Америка/Гватемала" 9542 9543 #: kdecore/TIMEZONES:291 9544 #, kde-format 9545 msgid "America/Guayaquil" 9546 msgstr "Америка/Гвајакил" 9547 9548 #. i18n: comment to the previous timezone 9549 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9550 #: kdecore/TIMEZONES:1400 9551 #, kde-format 9552 msgid "mainland" 9553 msgstr "" 9554 9555 #. i18n: comment to the previous timezone 9556 #: kdecore/TIMEZONES:295 9557 #, kde-format 9558 msgid "Ecuador (mainland)" 9559 msgstr "" 9560 9561 #: kdecore/TIMEZONES:296 9562 #, kde-format 9563 msgid "America/Guyana" 9564 msgstr "Америка/Гвајана" 9565 9566 #: kdecore/TIMEZONES:297 9567 #, kde-format 9568 msgid "America/Halifax" 9569 msgstr "Америка/Халифакс" 9570 9571 #. i18n: comment to the previous timezone 9572 #: kdecore/TIMEZONES:301 9573 #, kde-format 9574 msgid "Atlantic - NS (most areas); PE" 9575 msgstr "" 9576 9577 #: kdecore/TIMEZONES:302 9578 #, kde-format 9579 msgid "America/Havana" 9580 msgstr "Америка/Хавана" 9581 9582 #: kdecore/TIMEZONES:303 9583 #, kde-format 9584 msgid "America/Hermosillo" 9585 msgstr "Америка/Хермосиљо" 9586 9587 #. i18n: comment to the previous timezone 9588 #: kdecore/TIMEZONES:305 9589 #, kde-format 9590 msgid "Mountain Standard Time - Sonora" 9591 msgstr "" 9592 9593 #: kdecore/TIMEZONES:306 9594 #, kde-format 9595 msgid "America/Indiana/Indianapolis" 9596 msgstr "Америка/Индијана/Индијанаполис" 9597 9598 #. i18n: comment to the previous timezone 9599 #: kdecore/TIMEZONES:310 9600 #, kde-format 9601 msgid "Eastern - IN (most areas)" 9602 msgstr "" 9603 9604 #: kdecore/TIMEZONES:311 9605 #, kde-format 9606 msgid "America/Indiana/Knox" 9607 msgstr "Америка/Индијана/Нокс" 9608 9609 #. i18n: comment to the previous timezone 9610 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9611 #, kde-format 9612 msgid "Eastern Time - Indiana - Starke County" 9613 msgstr "" 9614 9615 #. i18n: comment to the previous timezone 9616 #: kdecore/TIMEZONES:315 9617 #, kde-format 9618 msgid "Central Time - Indiana - Starke County" 9619 msgstr "" 9620 9621 #. i18n: comment to the previous timezone 9622 #: kdecore/TIMEZONES:317 9623 #, kde-format 9624 msgid "Central - IN (Starke)" 9625 msgstr "" 9626 9627 #: kdecore/TIMEZONES:318 9628 #, kde-format 9629 msgid "America/Indiana/Marengo" 9630 msgstr "Америка/Индијана/Маренго" 9631 9632 #. i18n: comment to the previous timezone 9633 #: kdecore/TIMEZONES:320 9634 #, kde-format 9635 msgid "Eastern Time - Indiana - Crawford County" 9636 msgstr "" 9637 9638 #. i18n: comment to the previous timezone 9639 #: kdecore/TIMEZONES:322 9640 #, kde-format 9641 msgid "Eastern - IN (Crawford)" 9642 msgstr "" 9643 9644 #: kdecore/TIMEZONES:323 9645 #, kde-format 9646 msgid "America/Indiana/Petersburg" 9647 msgstr "Америка/Индијана/Петерсбург" 9648 9649 #. i18n: comment to the previous timezone 9650 #: kdecore/TIMEZONES:325 9651 #, kde-format 9652 msgid "Central Time - Indiana - Pike County" 9653 msgstr "" 9654 9655 #. i18n: comment to the previous timezone 9656 #: kdecore/TIMEZONES:327 9657 #, kde-format 9658 msgid "Eastern Time - Indiana - Pike County" 9659 msgstr "" 9660 9661 #. i18n: comment to the previous timezone 9662 #: kdecore/TIMEZONES:329 9663 #, kde-format 9664 msgid "Eastern - IN (Pike)" 9665 msgstr "" 9666 9667 #: kdecore/TIMEZONES:330 9668 #, kde-format 9669 msgid "America/Indiana/Tell_City" 9670 msgstr "Америка/Индијана/Тел_Сити" 9671 9672 #. i18n: comment to the previous timezone 9673 #: kdecore/TIMEZONES:332 9674 #, kde-format 9675 msgid "Central Time - Indiana - Perry County" 9676 msgstr "" 9677 9678 #. i18n: comment to the previous timezone 9679 #: kdecore/TIMEZONES:334 9680 #, kde-format 9681 msgid "Central - IN (Perry)" 9682 msgstr "" 9683 9684 #: kdecore/TIMEZONES:335 9685 #, kde-format 9686 msgid "America/Indiana/Vevay" 9687 msgstr "Америка/Индијана/Вивеј" 9688 9689 #. i18n: comment to the previous timezone 9690 #: kdecore/TIMEZONES:337 9691 #, kde-format 9692 msgid "Eastern Time - Indiana - Switzerland County" 9693 msgstr "" 9694 9695 #. i18n: comment to the previous timezone 9696 #: kdecore/TIMEZONES:339 9697 #, kde-format 9698 msgid "Eastern - IN (Switzerland)" 9699 msgstr "" 9700 9701 #: kdecore/TIMEZONES:340 9702 #, kde-format 9703 msgid "America/Indiana/Vincennes" 9704 msgstr "Америка/Индијана/Винсенс" 9705 9706 #. i18n: comment to the previous timezone 9707 #: kdecore/TIMEZONES:342 9708 #, kde-format 9709 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9710 msgstr "" 9711 9712 #. i18n: comment to the previous timezone 9713 #: kdecore/TIMEZONES:344 9714 #, kde-format 9715 msgid "Eastern - IN (Da, Du, K, Mn)" 9716 msgstr "" 9717 9718 #: kdecore/TIMEZONES:345 9719 #, kde-format 9720 msgid "America/Indiana/Winamac" 9721 msgstr "Америка/Индијана/Уинамак" 9722 9723 #. i18n: comment to the previous timezone 9724 #: kdecore/TIMEZONES:347 9725 #, kde-format 9726 msgid "Eastern Time - Indiana - Pulaski County" 9727 msgstr "" 9728 9729 #. i18n: comment to the previous timezone 9730 #: kdecore/TIMEZONES:349 9731 #, kde-format 9732 msgid "Eastern - IN (Pulaski)" 9733 msgstr "" 9734 9735 #: kdecore/TIMEZONES:350 9736 #, kde-format 9737 msgid "America/Indianapolis" 9738 msgstr "Америка/Индијанаполис" 9739 9740 #: kdecore/TIMEZONES:353 9741 #, kde-format 9742 msgid "America/Inuvik" 9743 msgstr "Америка/Инувик" 9744 9745 #. i18n: comment to the previous timezone 9746 #: kdecore/TIMEZONES:355 9747 #, kde-format 9748 msgid "Mountain Time - west Northwest Territories" 9749 msgstr "" 9750 9751 #. i18n: comment to the previous timezone 9752 #: kdecore/TIMEZONES:357 9753 #, kde-format 9754 msgid "Mountain - NT (west)" 9755 msgstr "" 9756 9757 #: kdecore/TIMEZONES:358 9758 #, kde-format 9759 msgid "America/Iqaluit" 9760 msgstr "Америка/Икалуит" 9761 9762 #. i18n: comment to the previous timezone 9763 #: kdecore/TIMEZONES:360 9764 #, kde-format 9765 msgid "Eastern Time - east Nunavut - most locations" 9766 msgstr "" 9767 9768 #. i18n: comment to the previous timezone 9769 #: kdecore/TIMEZONES:362 9770 #, kde-format 9771 msgid "Eastern - NU (most east areas)" 9772 msgstr "" 9773 9774 #: kdecore/TIMEZONES:363 9775 #, kde-format 9776 msgid "America/Jamaica" 9777 msgstr "Америка/Јамајка" 9778 9779 #: kdecore/TIMEZONES:364 9780 #, kde-format 9781 msgid "America/Jujuy" 9782 msgstr "Америка/Џуџуи" 9783 9784 #: kdecore/TIMEZONES:367 9785 #, kde-format 9786 msgid "America/Juneau" 9787 msgstr "Америка/Џуно" 9788 9789 #. i18n: comment to the previous timezone 9790 #: kdecore/TIMEZONES:369 9791 #, kde-format 9792 msgid "Alaska Time - Alaska panhandle" 9793 msgstr "" 9794 9795 #. i18n: comment to the previous timezone 9796 #: kdecore/TIMEZONES:371 9797 #, kde-format 9798 msgid "Alaska - Juneau area" 9799 msgstr "" 9800 9801 #: kdecore/TIMEZONES:372 9802 #, kde-format 9803 msgid "America/Kentucky/Louisville" 9804 msgstr "Америка/Кентаки/Луисвил" 9805 9806 #. i18n: comment to the previous timezone 9807 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9808 #, fuzzy, kde-format 9809 #| msgid "America/Kentucky/Louisville" 9810 msgid "Eastern Time - Kentucky - Louisville area" 9811 msgstr "Америка/Кентаки/Луисвил" 9812 9813 #. i18n: comment to the previous timezone 9814 #: kdecore/TIMEZONES:376 9815 #, fuzzy, kde-format 9816 #| msgid "America/Kentucky/Louisville" 9817 msgid "Eastern - KY (Louisville area)" 9818 msgstr "Америка/Кентаки/Луисвил" 9819 9820 #: kdecore/TIMEZONES:377 9821 #, kde-format 9822 msgid "America/Kentucky/Monticello" 9823 msgstr "Америка/Кентаки/Монтичело" 9824 9825 #. i18n: comment to the previous timezone 9826 #: kdecore/TIMEZONES:379 9827 #, kde-format 9828 msgid "Eastern Time - Kentucky - Wayne County" 9829 msgstr "" 9830 9831 #. i18n: comment to the previous timezone 9832 #: kdecore/TIMEZONES:381 9833 #, kde-format 9834 msgid "Eastern - KY (Wayne)" 9835 msgstr "" 9836 9837 #: kdecore/TIMEZONES:382 9838 #, fuzzy, kde-format 9839 #| msgid "America/Indiana/Knox" 9840 msgid "America/Knox_IN" 9841 msgstr "Америка/Индијана/Нокс" 9842 9843 #: kdecore/TIMEZONES:385 9844 #, fuzzy, kde-format 9845 #| msgid "America/Grenada" 9846 msgid "America/Kralendijk" 9847 msgstr "Америка/Гренада" 9848 9849 #: kdecore/TIMEZONES:386 9850 #, kde-format 9851 msgid "America/La_Paz" 9852 msgstr "Америка/Ла_Паз" 9853 9854 #: kdecore/TIMEZONES:387 9855 #, kde-format 9856 msgid "America/Lima" 9857 msgstr "Америка/Лима" 9858 9859 #: kdecore/TIMEZONES:388 9860 #, kde-format 9861 msgid "America/Los_Angeles" 9862 msgstr "Америка/Лос_Анџелес" 9863 9864 #. i18n: comment to the previous timezone 9865 #: kdecore/TIMEZONES:392 9866 #, fuzzy, kde-format 9867 #| msgid "Pacific/Yap" 9868 msgid "Pacific" 9869 msgstr "Пацифик/Јап" 9870 9871 #: kdecore/TIMEZONES:393 9872 #, kde-format 9873 msgid "America/Louisville" 9874 msgstr "Америка/Луисвил" 9875 9876 #: kdecore/TIMEZONES:396 9877 #, fuzzy, kde-format 9878 #| msgid "America/Port-au-Prince" 9879 msgid "America/Lower_Princes" 9880 msgstr "Америка/Порт-о-Пренс" 9881 9882 #: kdecore/TIMEZONES:397 9883 #, kde-format 9884 msgid "America/Maceio" 9885 msgstr "Америка/Масеио" 9886 9887 #. i18n: comment to the previous timezone 9888 #: kdecore/TIMEZONES:399 9889 #, kde-format 9890 msgid "Alagoas, Sergipe" 9891 msgstr "" 9892 9893 #: kdecore/TIMEZONES:400 9894 #, kde-format 9895 msgid "America/Managua" 9896 msgstr "Америка/Манагва" 9897 9898 #: kdecore/TIMEZONES:401 9899 #, kde-format 9900 msgid "America/Manaus" 9901 msgstr "Америка/Манаус" 9902 9903 #. i18n: comment to the previous timezone 9904 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9905 #, kde-format 9906 msgid "E Amazonas" 9907 msgstr "" 9908 9909 #. i18n: comment to the previous timezone 9910 #: kdecore/TIMEZONES:405 9911 #, kde-format 9912 msgid "Amazonas (east)" 9913 msgstr "" 9914 9915 #: kdecore/TIMEZONES:406 9916 #, fuzzy, kde-format 9917 #| msgid "America/Maceio" 9918 msgid "America/Marigot" 9919 msgstr "Америка/Масеио" 9920 9921 #: kdecore/TIMEZONES:407 9922 #, kde-format 9923 msgid "America/Martinique" 9924 msgstr "Америка/Мартиник" 9925 9926 #: kdecore/TIMEZONES:408 9927 #, fuzzy, kde-format 9928 #| msgid "America/Manaus" 9929 msgid "America/Matamoros" 9930 msgstr "Америка/Манаус" 9931 9932 #. i18n: comment to the previous timezone 9933 #: kdecore/TIMEZONES:410 9934 #, kde-format 9935 msgid "" 9936 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9937 msgstr "" 9938 9939 #. i18n: comment to the previous timezone 9940 #: kdecore/TIMEZONES:412 9941 #, kde-format 9942 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9943 msgstr "" 9944 9945 #: kdecore/TIMEZONES:413 9946 #, kde-format 9947 msgid "America/Mazatlan" 9948 msgstr "Америка/Мазатлан" 9949 9950 #. i18n: comment to the previous timezone 9951 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9952 #, kde-format 9953 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9954 msgstr "" 9955 9956 #. i18n: comment to the previous timezone 9957 #: kdecore/TIMEZONES:417 9958 #, kde-format 9959 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9960 msgstr "" 9961 9962 #: kdecore/TIMEZONES:418 9963 #, kde-format 9964 msgid "America/Mendoza" 9965 msgstr "Америка/Мендоза" 9966 9967 #: kdecore/TIMEZONES:421 9968 #, kde-format 9969 msgid "America/Menominee" 9970 msgstr "Америка/Меномини" 9971 9972 #. i18n: comment to the previous timezone 9973 #: kdecore/TIMEZONES:423 9974 #, kde-format 9975 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9976 msgstr "" 9977 9978 #. i18n: comment to the previous timezone 9979 #: kdecore/TIMEZONES:425 9980 #, kde-format 9981 msgid "Central - MI (Wisconsin border)" 9982 msgstr "" 9983 9984 #: kdecore/TIMEZONES:426 9985 #, kde-format 9986 msgid "America/Merida" 9987 msgstr "Америка/Мерида" 9988 9989 #. i18n: comment to the previous timezone 9990 #: kdecore/TIMEZONES:428 9991 #, kde-format 9992 msgid "Central Time - Campeche, Yucatan" 9993 msgstr "" 9994 9995 #: kdecore/TIMEZONES:429 9996 #, fuzzy, kde-format 9997 #| msgid "America/Mazatlan" 9998 msgid "America/Metlakatla" 9999 msgstr "Америка/Мазатлан" 10000 10001 #. i18n: comment to the previous timezone 10002 #: kdecore/TIMEZONES:431 10003 #, kde-format 10004 msgid "Metlakatla Time - Annette Island" 10005 msgstr "" 10006 10007 #. i18n: comment to the previous timezone 10008 #: kdecore/TIMEZONES:433 10009 #, kde-format 10010 msgid "Alaska - Annette Island" 10011 msgstr "" 10012 10013 #: kdecore/TIMEZONES:434 10014 #, kde-format 10015 msgid "America/Mexico_City" 10016 msgstr "Америка/Мексико_Сити" 10017 10018 #. i18n: comment to the previous timezone 10019 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 10020 #, kde-format 10021 msgid "Central Time - most locations" 10022 msgstr "" 10023 10024 #: kdecore/TIMEZONES:439 10025 #, kde-format 10026 msgid "America/Miquelon" 10027 msgstr "Америка/Микелон" 10028 10029 #: kdecore/TIMEZONES:440 10030 #, kde-format 10031 msgid "America/Moncton" 10032 msgstr "Америка/Монктон" 10033 10034 #. i18n: comment to the previous timezone 10035 #: kdecore/TIMEZONES:442 10036 #, kde-format 10037 msgid "Atlantic Time - New Brunswick" 10038 msgstr "" 10039 10040 #. i18n: comment to the previous timezone 10041 #: kdecore/TIMEZONES:444 10042 #, kde-format 10043 msgid "Atlantic - New Brunswick" 10044 msgstr "" 10045 10046 #: kdecore/TIMEZONES:445 10047 #, kde-format 10048 msgid "America/Monterrey" 10049 msgstr "Америка/Монтереј" 10050 10051 #. i18n: comment to the previous timezone 10052 #: kdecore/TIMEZONES:447 10053 #, kde-format 10054 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10055 msgstr "" 10056 10057 #. i18n: comment to the previous timezone 10058 #: kdecore/TIMEZONES:449 10059 #, kde-format 10060 msgid "" 10061 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10062 "US border" 10063 msgstr "" 10064 10065 #. i18n: comment to the previous timezone 10066 #: kdecore/TIMEZONES:451 10067 #, kde-format 10068 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10069 msgstr "" 10070 10071 #: kdecore/TIMEZONES:452 10072 #, kde-format 10073 msgid "America/Montevideo" 10074 msgstr "Америка/Монтевидео" 10075 10076 #: kdecore/TIMEZONES:453 10077 #, kde-format 10078 msgid "America/Montreal" 10079 msgstr "Америка/Монтреал" 10080 10081 #. i18n: comment to the previous timezone 10082 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10083 #, kde-format 10084 msgid "Eastern Time - Quebec - most locations" 10085 msgstr "" 10086 10087 #: kdecore/TIMEZONES:456 10088 #, kde-format 10089 msgid "America/Montserrat" 10090 msgstr "Америка/Монсерат" 10091 10092 #: kdecore/TIMEZONES:457 10093 #, kde-format 10094 msgid "America/Nassau" 10095 msgstr "Америка/Насау" 10096 10097 #: kdecore/TIMEZONES:458 10098 #, kde-format 10099 msgid "America/New_York" 10100 msgstr "Америка/Њу_Јорк" 10101 10102 #. i18n: comment to the previous timezone 10103 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10104 #, kde-format 10105 msgid "Eastern Time" 10106 msgstr "" 10107 10108 #. i18n: comment to the previous timezone 10109 #: kdecore/TIMEZONES:462 10110 #, kde-format 10111 msgid "Eastern (most areas)" 10112 msgstr "" 10113 10114 #: kdecore/TIMEZONES:463 10115 #, kde-format 10116 msgid "America/Nipigon" 10117 msgstr "Америка/Нипигон" 10118 10119 #. i18n: comment to the previous timezone 10120 #: kdecore/TIMEZONES:465 10121 #, kde-format 10122 msgid "" 10123 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10124 msgstr "" 10125 10126 #. i18n: comment to the previous timezone 10127 #: kdecore/TIMEZONES:467 10128 #, kde-format 10129 msgid "Eastern - ON, QC (no DST 1967-73)" 10130 msgstr "" 10131 10132 #: kdecore/TIMEZONES:468 10133 #, kde-format 10134 msgid "America/Nome" 10135 msgstr "Америка/Ном" 10136 10137 #. i18n: comment to the previous timezone 10138 #: kdecore/TIMEZONES:470 10139 #, kde-format 10140 msgid "Alaska Time - west Alaska" 10141 msgstr "" 10142 10143 #. i18n: comment to the previous timezone 10144 #: kdecore/TIMEZONES:472 10145 #, kde-format 10146 msgid "Alaska (west)" 10147 msgstr "" 10148 10149 #: kdecore/TIMEZONES:473 10150 #, kde-format 10151 msgid "America/Noronha" 10152 msgstr "Америка/Норонха" 10153 10154 #. i18n: comment to the previous timezone 10155 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10156 #, fuzzy, kde-format 10157 #| msgid "Atlantic/Canary" 10158 msgid "Atlantic islands" 10159 msgstr "Атлантик/Канарски_Острови" 10160 10161 #: kdecore/TIMEZONES:476 10162 #, fuzzy, kde-format 10163 #| msgid "America/North_Dakota/Center" 10164 msgid "America/North_Dakota/Beulah" 10165 msgstr "Америка/Северна_Дакота/Центар" 10166 10167 #. i18n: comment to the previous timezone 10168 #: kdecore/TIMEZONES:478 10169 #, kde-format 10170 msgid "Central Time - North Dakota - Mercer County" 10171 msgstr "" 10172 10173 #. i18n: comment to the previous timezone 10174 #: kdecore/TIMEZONES:480 10175 #, kde-format 10176 msgid "Central - ND (Mercer)" 10177 msgstr "" 10178 10179 #: kdecore/TIMEZONES:481 10180 #, kde-format 10181 msgid "America/North_Dakota/Center" 10182 msgstr "Америка/Северна_Дакота/Центар" 10183 10184 #. i18n: comment to the previous timezone 10185 #: kdecore/TIMEZONES:483 10186 #, kde-format 10187 msgid "Central Time - North Dakota - Oliver County" 10188 msgstr "" 10189 10190 #. i18n: comment to the previous timezone 10191 #: kdecore/TIMEZONES:485 10192 #, kde-format 10193 msgid "Central - ND (Oliver)" 10194 msgstr "" 10195 10196 #: kdecore/TIMEZONES:486 10197 #, kde-format 10198 msgid "America/North_Dakota/New_Salem" 10199 msgstr "Америка/Северна_Дакота/Њу_Салем" 10200 10201 #. i18n: comment to the previous timezone 10202 #: kdecore/TIMEZONES:488 10203 #, kde-format 10204 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10205 msgstr "" 10206 10207 #. i18n: comment to the previous timezone 10208 #: kdecore/TIMEZONES:490 10209 #, kde-format 10210 msgid "Central - ND (Morton rural)" 10211 msgstr "" 10212 10213 #: kdecore/TIMEZONES:491 10214 #, fuzzy, kde-format 10215 #| msgid "America/Jujuy" 10216 msgid "America/Nuuk" 10217 msgstr "Америка/Џуџуи" 10218 10219 #. i18n: comment to the previous timezone 10220 #: kdecore/TIMEZONES:493 10221 #, kde-format 10222 msgid "Greenland (most areas)" 10223 msgstr "" 10224 10225 #: kdecore/TIMEZONES:494 10226 #, fuzzy, kde-format 10227 #| msgid "America/Managua" 10228 msgid "America/Ojinaga" 10229 msgstr "Америка/Манагва" 10230 10231 #. i18n: comment to the previous timezone 10232 #: kdecore/TIMEZONES:496 10233 #, kde-format 10234 msgid "US Mountain Time - Chihuahua near US border" 10235 msgstr "" 10236 10237 #. i18n: comment to the previous timezone 10238 #: kdecore/TIMEZONES:498 10239 #, kde-format 10240 msgid "Mountain Time US - Chihuahua (US border)" 10241 msgstr "" 10242 10243 #: kdecore/TIMEZONES:499 10244 #, fuzzy, kde-format 10245 #| msgid "America/Maceio" 10246 msgid "America/Ontario" 10247 msgstr "Америка/Масеио" 10248 10249 #: kdecore/TIMEZONES:502 10250 #, kde-format 10251 msgid "America/Panama" 10252 msgstr "Америка/Панама" 10253 10254 #: kdecore/TIMEZONES:503 10255 #, kde-format 10256 msgid "America/Pangnirtung" 10257 msgstr "Америка/Пангниртунг" 10258 10259 #. i18n: comment to the previous timezone 10260 #: kdecore/TIMEZONES:505 10261 #, kde-format 10262 msgid "Eastern Time - Pangnirtung, Nunavut" 10263 msgstr "" 10264 10265 #. i18n: comment to the previous timezone 10266 #: kdecore/TIMEZONES:507 10267 #, kde-format 10268 msgid "Eastern - NU (Pangnirtung)" 10269 msgstr "" 10270 10271 #: kdecore/TIMEZONES:508 10272 #, kde-format 10273 msgid "America/Paramaribo" 10274 msgstr "Америка/Парамарибо" 10275 10276 #: kdecore/TIMEZONES:509 10277 #, kde-format 10278 msgid "America/Phoenix" 10279 msgstr "Америка/Феникс" 10280 10281 #. i18n: comment to the previous timezone 10282 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10283 #, kde-format 10284 msgid "Mountain Standard Time - Arizona" 10285 msgstr "" 10286 10287 #. i18n: comment to the previous timezone 10288 #: kdecore/TIMEZONES:513 10289 #, kde-format 10290 msgid "MST - Arizona (except Navajo)" 10291 msgstr "" 10292 10293 #: kdecore/TIMEZONES:514 10294 #, kde-format 10295 msgid "America/Port-au-Prince" 10296 msgstr "Америка/Порт-о-Пренс" 10297 10298 #: kdecore/TIMEZONES:515 10299 #, kde-format 10300 msgid "America/Port_of_Spain" 10301 msgstr "Америка/Порт_оф_Спејн" 10302 10303 #: kdecore/TIMEZONES:516 10304 #, fuzzy, kde-format 10305 #| msgid "America/Porto_Velho" 10306 msgid "America/Porto_Acre" 10307 msgstr "Америка/Порто_Велјо" 10308 10309 #. i18n: comment to the previous timezone 10310 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10311 #, kde-format 10312 msgid "Acre" 10313 msgstr "" 10314 10315 #: kdecore/TIMEZONES:519 10316 #, kde-format 10317 msgid "America/Porto_Velho" 10318 msgstr "Америка/Порто_Велјо" 10319 10320 #. i18n: comment to the previous timezone 10321 #: kdecore/TIMEZONES:521 10322 #, kde-format 10323 msgid "Rondonia" 10324 msgstr "" 10325 10326 #: kdecore/TIMEZONES:522 10327 #, kde-format 10328 msgid "America/Puerto_Rico" 10329 msgstr "Америка/Порторико" 10330 10331 #: kdecore/TIMEZONES:523 10332 #, fuzzy, kde-format 10333 #| msgid "America/Buenos_Aires" 10334 msgid "America/Punta_Arenas" 10335 msgstr "Америка/Буенос_Аирес" 10336 10337 #. i18n: comment to the previous timezone 10338 #: kdecore/TIMEZONES:525 10339 #, kde-format 10340 msgid "Region of Magallanes" 10341 msgstr "" 10342 10343 #: kdecore/TIMEZONES:526 10344 #, kde-format 10345 msgid "America/Rainy_River" 10346 msgstr "Америка/Рејни_Ривер" 10347 10348 #. i18n: comment to the previous timezone 10349 #: kdecore/TIMEZONES:528 10350 #, kde-format 10351 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10352 msgstr "" 10353 10354 #. i18n: comment to the previous timezone 10355 #: kdecore/TIMEZONES:530 10356 #, kde-format 10357 msgid "Central - ON (Rainy R, Ft Frances)" 10358 msgstr "" 10359 10360 #: kdecore/TIMEZONES:531 10361 #, kde-format 10362 msgid "America/Rankin_Inlet" 10363 msgstr "Америка/Ранкин_Инлет" 10364 10365 #. i18n: comment to the previous timezone 10366 #: kdecore/TIMEZONES:533 10367 #, kde-format 10368 msgid "Central Time - central Nunavut" 10369 msgstr "" 10370 10371 #. i18n: comment to the previous timezone 10372 #: kdecore/TIMEZONES:535 10373 #, kde-format 10374 msgid "Central - NU (central)" 10375 msgstr "" 10376 10377 #: kdecore/TIMEZONES:536 10378 #, kde-format 10379 msgid "America/Recife" 10380 msgstr "Америка/Ресифе" 10381 10382 #. i18n: comment to the previous timezone 10383 #: kdecore/TIMEZONES:538 10384 #, kde-format 10385 msgid "Pernambuco" 10386 msgstr "" 10387 10388 #: kdecore/TIMEZONES:539 10389 #, kde-format 10390 msgid "America/Regina" 10391 msgstr "Америка/Реџина" 10392 10393 #. i18n: comment to the previous timezone 10394 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10395 #: kdecore/TIMEZONES:1123 10396 #, kde-format 10397 msgid "Central Standard Time - Saskatchewan - most locations" 10398 msgstr "" 10399 10400 #. i18n: comment to the previous timezone 10401 #: kdecore/TIMEZONES:543 10402 #, kde-format 10403 msgid "CST - SK (most areas)" 10404 msgstr "" 10405 10406 #: kdecore/TIMEZONES:544 10407 #, kde-format 10408 msgid "America/Resolute" 10409 msgstr "Америка/Резолут" 10410 10411 #. i18n: comment to the previous timezone 10412 #: kdecore/TIMEZONES:546 10413 #, kde-format 10414 msgid "Eastern Time - Resolute, Nunavut" 10415 msgstr "" 10416 10417 #. i18n: comment to the previous timezone 10418 #: kdecore/TIMEZONES:548 10419 #, kde-format 10420 msgid "Central Standard Time - Resolute, Nunavut" 10421 msgstr "" 10422 10423 #. i18n: comment to the previous timezone 10424 #: kdecore/TIMEZONES:550 10425 #, kde-format 10426 msgid "Central - NU (Resolute)" 10427 msgstr "" 10428 10429 #: kdecore/TIMEZONES:551 10430 #, kde-format 10431 msgid "America/Rio_Branco" 10432 msgstr "Америка/Рио_Бранко" 10433 10434 #: kdecore/TIMEZONES:554 10435 #, kde-format 10436 msgid "America/Rosario" 10437 msgstr "Америка/Росарио" 10438 10439 #: kdecore/TIMEZONES:557 10440 #, fuzzy, kde-format 10441 #| msgid "America/Santiago" 10442 msgid "America/Santa_Isabel" 10443 msgstr "Америка/Сантијаго" 10444 10445 #. i18n: comment to the previous timezone 10446 #: kdecore/TIMEZONES:559 10447 #, kde-format 10448 msgid "Mexican Pacific Time - Baja California away from US border" 10449 msgstr "" 10450 10451 #: kdecore/TIMEZONES:560 10452 #, fuzzy, kde-format 10453 #| msgid "America/Santiago" 10454 msgid "America/Santarem" 10455 msgstr "Америка/Сантијаго" 10456 10457 #. i18n: comment to the previous timezone 10458 #: kdecore/TIMEZONES:562 10459 #, fuzzy, kde-format 10460 msgid "W Para" 10461 msgstr "од мар" 10462 10463 #. i18n: comment to the previous timezone 10464 #: kdecore/TIMEZONES:564 10465 #, kde-format 10466 msgid "Para (west)" 10467 msgstr "" 10468 10469 #: kdecore/TIMEZONES:565 10470 #, kde-format 10471 msgid "America/Santiago" 10472 msgstr "Америка/Сантијаго" 10473 10474 #. i18n: comment to the previous timezone 10475 #: kdecore/TIMEZONES:569 10476 #, kde-format 10477 msgid "Chile (most areas)" 10478 msgstr "" 10479 10480 #: kdecore/TIMEZONES:570 10481 #, kde-format 10482 msgid "America/Santo_Domingo" 10483 msgstr "Америка/Санто_Доминго" 10484 10485 #: kdecore/TIMEZONES:571 10486 #, kde-format 10487 msgid "America/Sao_Paulo" 10488 msgstr "Америка/Сао_Паоло" 10489 10490 #. i18n: comment to the previous timezone 10491 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10492 #, kde-format 10493 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10494 msgstr "" 10495 10496 #. i18n: comment to the previous timezone 10497 #: kdecore/TIMEZONES:575 10498 #, kde-format 10499 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10500 msgstr "" 10501 10502 #: kdecore/TIMEZONES:576 10503 #, fuzzy, kde-format 10504 #| msgid "America/Dawson" 10505 msgid "America/Saskatoon" 10506 msgstr "Америка/Доусон" 10507 10508 #: kdecore/TIMEZONES:579 10509 #, kde-format 10510 msgid "America/Scoresbysund" 10511 msgstr "Америка/Скорсбисунд" 10512 10513 #. i18n: comment to the previous timezone 10514 #: kdecore/TIMEZONES:581 10515 #, kde-format 10516 msgid "Scoresbysund / Ittoqqortoormiit" 10517 msgstr "" 10518 10519 #. i18n: comment to the previous timezone 10520 #: kdecore/TIMEZONES:583 10521 #, kde-format 10522 msgid "Scoresbysund/Ittoqqortoormiit" 10523 msgstr "" 10524 10525 #: kdecore/TIMEZONES:584 10526 #, kde-format 10527 msgid "America/Shiprock" 10528 msgstr "Америка/Шипрок" 10529 10530 #. i18n: comment to the previous timezone 10531 #: kdecore/TIMEZONES:586 10532 #, kde-format 10533 msgid "Mountain Time - Navajo" 10534 msgstr "" 10535 10536 #: kdecore/TIMEZONES:587 10537 #, fuzzy, kde-format 10538 #| msgid "America/Atikokan" 10539 msgid "America/Sitka" 10540 msgstr "Америка/Атикокан" 10541 10542 #. i18n: comment to the previous timezone 10543 #: kdecore/TIMEZONES:589 10544 #, kde-format 10545 msgid "Alaska Time - southeast Alaska panhandle" 10546 msgstr "" 10547 10548 #. i18n: comment to the previous timezone 10549 #: kdecore/TIMEZONES:591 10550 #, kde-format 10551 msgid "Alaska - Sitka area" 10552 msgstr "" 10553 10554 #: kdecore/TIMEZONES:592 10555 #, fuzzy, kde-format 10556 #| msgid "America/Belem" 10557 msgid "America/St_Barthelemy" 10558 msgstr "Америка/Белем" 10559 10560 #: kdecore/TIMEZONES:593 10561 #, kde-format 10562 msgid "America/St_Johns" 10563 msgstr "Америка/Сент_Џонс" 10564 10565 #. i18n: comment to the previous timezone 10566 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10567 #, kde-format 10568 msgid "Newfoundland Time, including SE Labrador" 10569 msgstr "" 10570 10571 #. i18n: comment to the previous timezone 10572 #: kdecore/TIMEZONES:597 10573 #, kde-format 10574 msgid "Newfoundland; Labrador (southeast)" 10575 msgstr "" 10576 10577 #: kdecore/TIMEZONES:598 10578 #, kde-format 10579 msgid "America/St_Kitts" 10580 msgstr "Америка/Сент_Китс" 10581 10582 #: kdecore/TIMEZONES:599 10583 #, kde-format 10584 msgid "America/St_Lucia" 10585 msgstr "Америка/Света_Лусија" 10586 10587 #: kdecore/TIMEZONES:600 10588 #, kde-format 10589 msgid "America/St_Thomas" 10590 msgstr "Америка/Свети_Томас" 10591 10592 #: kdecore/TIMEZONES:601 10593 #, kde-format 10594 msgid "America/St_Vincent" 10595 msgstr "Америка/Сент_Винсент" 10596 10597 #: kdecore/TIMEZONES:602 10598 #, kde-format 10599 msgid "America/Swift_Current" 10600 msgstr "Америка/Свифт_Карент" 10601 10602 #. i18n: comment to the previous timezone 10603 #: kdecore/TIMEZONES:604 10604 #, kde-format 10605 msgid "Central Standard Time - Saskatchewan - midwest" 10606 msgstr "" 10607 10608 #. i18n: comment to the previous timezone 10609 #: kdecore/TIMEZONES:606 10610 #, kde-format 10611 msgid "CST - SK (midwest)" 10612 msgstr "" 10613 10614 #: kdecore/TIMEZONES:607 10615 #, kde-format 10616 msgid "America/Tegucigalpa" 10617 msgstr "Америка/Тегусигалпа" 10618 10619 #: kdecore/TIMEZONES:608 10620 #, kde-format 10621 msgid "America/Thule" 10622 msgstr "Америка/Туле" 10623 10624 #. i18n: comment to the previous timezone 10625 #: kdecore/TIMEZONES:610 10626 #, kde-format 10627 msgid "Thule / Pituffik" 10628 msgstr "" 10629 10630 #. i18n: comment to the previous timezone 10631 #: kdecore/TIMEZONES:612 10632 #, kde-format 10633 msgid "Thule/Pituffik" 10634 msgstr "" 10635 10636 #: kdecore/TIMEZONES:613 10637 #, kde-format 10638 msgid "America/Thunder_Bay" 10639 msgstr "Америка/Тандер_Беј" 10640 10641 #. i18n: comment to the previous timezone 10642 #: kdecore/TIMEZONES:615 10643 #, kde-format 10644 msgid "Eastern Time - Thunder Bay, Ontario" 10645 msgstr "" 10646 10647 #. i18n: comment to the previous timezone 10648 #: kdecore/TIMEZONES:617 10649 #, kde-format 10650 msgid "Eastern - ON (Thunder Bay)" 10651 msgstr "" 10652 10653 #: kdecore/TIMEZONES:618 10654 #, kde-format 10655 msgid "America/Tijuana" 10656 msgstr "Америка/Тихуана" 10657 10658 #. i18n: comment to the previous timezone 10659 #: kdecore/TIMEZONES:622 10660 #, kde-format 10661 msgid "US Pacific Time - Baja California near US border" 10662 msgstr "" 10663 10664 #. i18n: comment to the previous timezone 10665 #: kdecore/TIMEZONES:624 10666 #, kde-format 10667 msgid "Pacific Time US - Baja California" 10668 msgstr "" 10669 10670 #: kdecore/TIMEZONES:625 10671 #, kde-format 10672 msgid "America/Toronto" 10673 msgstr "Америка/Торонто" 10674 10675 #. i18n: comment to the previous timezone 10676 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10677 #, kde-format 10678 msgid "Eastern Time - Ontario - most locations" 10679 msgstr "" 10680 10681 #. i18n: comment to the previous timezone 10682 #: kdecore/TIMEZONES:629 10683 #, kde-format 10684 msgid "Eastern - ON, QC (most areas)" 10685 msgstr "" 10686 10687 #: kdecore/TIMEZONES:630 10688 #, kde-format 10689 msgid "America/Tortola" 10690 msgstr "Америка/Тортола" 10691 10692 #: kdecore/TIMEZONES:631 10693 #, kde-format 10694 msgid "America/Vancouver" 10695 msgstr "Америка/Ванкувер" 10696 10697 #. i18n: comment to the previous timezone 10698 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10699 #, kde-format 10700 msgid "Pacific Time - west British Columbia" 10701 msgstr "" 10702 10703 #. i18n: comment to the previous timezone 10704 #: kdecore/TIMEZONES:635 10705 #, kde-format 10706 msgid "Pacific - BC (most areas)" 10707 msgstr "" 10708 10709 #: kdecore/TIMEZONES:636 10710 #, fuzzy, kde-format 10711 #| msgid "America/Regina" 10712 msgid "America/Virgin" 10713 msgstr "Америка/Реџина" 10714 10715 #: kdecore/TIMEZONES:637 10716 #, kde-format 10717 msgid "America/Whitehorse" 10718 msgstr "Америка/Вајтхорс" 10719 10720 #. i18n: comment to the previous timezone 10721 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10722 #, kde-format 10723 msgid "Pacific Time - south Yukon" 10724 msgstr "" 10725 10726 #. i18n: comment to the previous timezone 10727 #: kdecore/TIMEZONES:641 10728 #, kde-format 10729 msgid "MST - Yukon (east)" 10730 msgstr "" 10731 10732 #: kdecore/TIMEZONES:642 10733 #, kde-format 10734 msgid "America/Winnipeg" 10735 msgstr "Америка/Винипег" 10736 10737 #. i18n: comment to the previous timezone 10738 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10739 #, kde-format 10740 msgid "Central Time - Manitoba & west Ontario" 10741 msgstr "" 10742 10743 #. i18n: comment to the previous timezone 10744 #: kdecore/TIMEZONES:646 10745 #, kde-format 10746 msgid "Central - ON (west); Manitoba" 10747 msgstr "" 10748 10749 #: kdecore/TIMEZONES:647 10750 #, kde-format 10751 msgid "America/Yakutat" 10752 msgstr "Америка/Јакутат" 10753 10754 #. i18n: comment to the previous timezone 10755 #: kdecore/TIMEZONES:649 10756 #, kde-format 10757 msgid "Alaska Time - Alaska panhandle neck" 10758 msgstr "" 10759 10760 #. i18n: comment to the previous timezone 10761 #: kdecore/TIMEZONES:651 10762 #, kde-format 10763 msgid "Alaska - Yakutat" 10764 msgstr "" 10765 10766 #: kdecore/TIMEZONES:652 10767 #, kde-format 10768 msgid "America/Yellowknife" 10769 msgstr "Америка/Јелоунајф" 10770 10771 #. i18n: comment to the previous timezone 10772 #: kdecore/TIMEZONES:654 10773 #, kde-format 10774 msgid "Mountain Time - central Northwest Territories" 10775 msgstr "" 10776 10777 #. i18n: comment to the previous timezone 10778 #: kdecore/TIMEZONES:656 10779 #, kde-format 10780 msgid "Mountain - NT (central)" 10781 msgstr "" 10782 10783 #: kdecore/TIMEZONES:657 10784 #, kde-format 10785 msgid "Antarctica/Casey" 10786 msgstr "Антарктик/Кејси" 10787 10788 #. i18n: comment to the previous timezone 10789 #: kdecore/TIMEZONES:659 10790 #, kde-format 10791 msgid "Casey Station, Bailey Peninsula" 10792 msgstr "" 10793 10794 #. i18n: comment to the previous timezone 10795 #: kdecore/TIMEZONES:661 10796 #, kde-format 10797 msgid "Casey" 10798 msgstr "" 10799 10800 #: kdecore/TIMEZONES:662 10801 #, kde-format 10802 msgid "Antarctica/Davis" 10803 msgstr "Антарктик/Дејвис" 10804 10805 #. i18n: comment to the previous timezone 10806 #: kdecore/TIMEZONES:664 10807 #, kde-format 10808 msgid "Davis Station, Vestfold Hills" 10809 msgstr "" 10810 10811 #. i18n: comment to the previous timezone 10812 #: kdecore/TIMEZONES:666 10813 #, kde-format 10814 msgid "Davis" 10815 msgstr "" 10816 10817 #: kdecore/TIMEZONES:667 10818 #, kde-format 10819 msgid "Antarctica/DumontDUrville" 10820 msgstr "Антарктик/Димон_дУрвил" 10821 10822 #. i18n: comment to the previous timezone 10823 #: kdecore/TIMEZONES:669 10824 #, kde-format 10825 msgid "Dumont-d'Urville Station, Terre Adelie" 10826 msgstr "" 10827 10828 #. i18n: comment to the previous timezone 10829 #: kdecore/TIMEZONES:671 10830 #, fuzzy, kde-format 10831 #| msgid "Antarctica/DumontDUrville" 10832 msgid "Dumont-d'Urville" 10833 msgstr "Антарктик/Димон_дУрвил" 10834 10835 #: kdecore/TIMEZONES:672 10836 #, fuzzy, kde-format 10837 #| msgid "Antarctica/McMurdo" 10838 msgid "Antarctica/Macquarie" 10839 msgstr "Антарктик/МакМердо" 10840 10841 #. i18n: comment to the previous timezone 10842 #: kdecore/TIMEZONES:674 10843 #, kde-format 10844 msgid "Macquarie Island Station, Macquarie Island" 10845 msgstr "" 10846 10847 #. i18n: comment to the previous timezone 10848 #: kdecore/TIMEZONES:676 10849 #, kde-format 10850 msgid "Macquarie Island" 10851 msgstr "" 10852 10853 #: kdecore/TIMEZONES:677 10854 #, kde-format 10855 msgid "Antarctica/Mawson" 10856 msgstr "Антарктик/Моусон" 10857 10858 #. i18n: comment to the previous timezone 10859 #: kdecore/TIMEZONES:679 10860 #, kde-format 10861 msgid "Mawson Station, Holme Bay" 10862 msgstr "" 10863 10864 #. i18n: comment to the previous timezone 10865 #: kdecore/TIMEZONES:681 10866 #, kde-format 10867 msgid "Mawson" 10868 msgstr "" 10869 10870 #: kdecore/TIMEZONES:682 10871 #, kde-format 10872 msgid "Antarctica/McMurdo" 10873 msgstr "Антарктик/МакМердо" 10874 10875 #. i18n: comment to the previous timezone 10876 #: kdecore/TIMEZONES:684 10877 #, kde-format 10878 msgid "McMurdo Station, Ross Island" 10879 msgstr "" 10880 10881 #. i18n: comment to the previous timezone 10882 #: kdecore/TIMEZONES:686 10883 #, kde-format 10884 msgid "New Zealand time - McMurdo, South Pole" 10885 msgstr "" 10886 10887 #: kdecore/TIMEZONES:687 10888 #, kde-format 10889 msgid "Antarctica/Palmer" 10890 msgstr "Антарктик/Палмер" 10891 10892 #. i18n: comment to the previous timezone 10893 #: kdecore/TIMEZONES:689 10894 #, kde-format 10895 msgid "Palmer Station, Anvers Island" 10896 msgstr "" 10897 10898 #. i18n: comment to the previous timezone 10899 #: kdecore/TIMEZONES:691 10900 #, kde-format 10901 msgid "Palmer" 10902 msgstr "" 10903 10904 #: kdecore/TIMEZONES:692 10905 #, kde-format 10906 msgid "Antarctica/Rothera" 10907 msgstr "Антарктик/Ротера" 10908 10909 #. i18n: comment to the previous timezone 10910 #: kdecore/TIMEZONES:694 10911 #, kde-format 10912 msgid "Rothera Station, Adelaide Island" 10913 msgstr "" 10914 10915 #. i18n: comment to the previous timezone 10916 #: kdecore/TIMEZONES:696 10917 #, kde-format 10918 msgid "Rothera" 10919 msgstr "" 10920 10921 #: kdecore/TIMEZONES:697 10922 #, kde-format 10923 msgid "Antarctica/South_Pole" 10924 msgstr "Антарктик/Јужен_Пол" 10925 10926 #. i18n: comment to the previous timezone 10927 #: kdecore/TIMEZONES:699 10928 #, kde-format 10929 msgid "Amundsen-Scott Station, South Pole" 10930 msgstr "" 10931 10932 #: kdecore/TIMEZONES:700 10933 #, kde-format 10934 msgid "Antarctica/Syowa" 10935 msgstr "Антарктик/Сјова" 10936 10937 #. i18n: comment to the previous timezone 10938 #: kdecore/TIMEZONES:702 10939 #, kde-format 10940 msgid "Syowa Station, E Ongul I" 10941 msgstr "" 10942 10943 #. i18n: comment to the previous timezone 10944 #: kdecore/TIMEZONES:704 10945 #, kde-format 10946 msgid "Syowa" 10947 msgstr "" 10948 10949 #: kdecore/TIMEZONES:705 10950 #, fuzzy, kde-format 10951 #| msgid "Antarctica/McMurdo" 10952 msgid "Antarctica/Troll" 10953 msgstr "Антарктик/МакМердо" 10954 10955 #. i18n: comment to the previous timezone 10956 #: kdecore/TIMEZONES:707 10957 #, kde-format 10958 msgid "Troll" 10959 msgstr "" 10960 10961 #: kdecore/TIMEZONES:708 10962 #, kde-format 10963 msgid "Antarctica/Vostok" 10964 msgstr "Антарктик/Восток" 10965 10966 #. i18n: comment to the previous timezone 10967 #: kdecore/TIMEZONES:710 10968 #, kde-format 10969 msgid "Vostok Station, S Magnetic Pole" 10970 msgstr "" 10971 10972 #. i18n: comment to the previous timezone 10973 #: kdecore/TIMEZONES:712 10974 #, kde-format 10975 msgid "Vostok Station, Lake Vostok" 10976 msgstr "" 10977 10978 #. i18n: comment to the previous timezone 10979 #: kdecore/TIMEZONES:714 10980 #, kde-format 10981 msgid "Vostok" 10982 msgstr "" 10983 10984 #: kdecore/TIMEZONES:715 10985 #, kde-format 10986 msgid "Arctic/Longyearbyen" 10987 msgstr "Арктик/Лонгјербјен" 10988 10989 #: kdecore/TIMEZONES:716 10990 #, kde-format 10991 msgid "Asia/Aden" 10992 msgstr "Азија/Аден" 10993 10994 #: kdecore/TIMEZONES:717 10995 #, kde-format 10996 msgid "Asia/Almaty" 10997 msgstr "Азија/Алмати" 10998 10999 #. i18n: comment to the previous timezone 11000 #: kdecore/TIMEZONES:721 11001 #, kde-format 11002 msgid "Kazakhstan (most areas)" 11003 msgstr "" 11004 11005 #: kdecore/TIMEZONES:722 11006 #, kde-format 11007 msgid "Asia/Amman" 11008 msgstr "Азија/Аман" 11009 11010 #: kdecore/TIMEZONES:723 11011 #, kde-format 11012 msgid "Asia/Anadyr" 11013 msgstr "Азија/Анадир" 11014 11015 #. i18n: comment to the previous timezone 11016 #: kdecore/TIMEZONES:725 11017 #, kde-format 11018 msgid "Moscow+10 - Bering Sea" 11019 msgstr "" 11020 11021 #. i18n: comment to the previous timezone 11022 #: kdecore/TIMEZONES:727 11023 #, kde-format 11024 msgid "Moscow+08 - Bering Sea" 11025 msgstr "" 11026 11027 #. i18n: comment to the previous timezone 11028 #: kdecore/TIMEZONES:729 11029 #, kde-format 11030 msgid "MSK+09 - Bering Sea" 11031 msgstr "" 11032 11033 #: kdecore/TIMEZONES:730 11034 #, kde-format 11035 msgid "Asia/Aqtau" 11036 msgstr "Азија/Актау" 11037 11038 #. i18n: comment to the previous timezone 11039 #: kdecore/TIMEZONES:732 11040 #, kde-format 11041 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11042 msgstr "" 11043 11044 #. i18n: comment to the previous timezone 11045 #: kdecore/TIMEZONES:734 11046 #, kde-format 11047 msgid "Mangghystau/Mankistau" 11048 msgstr "" 11049 11050 #: kdecore/TIMEZONES:735 11051 #, kde-format 11052 msgid "Asia/Aqtobe" 11053 msgstr "Азија/Актобе" 11054 11055 #. i18n: comment to the previous timezone 11056 #: kdecore/TIMEZONES:737 11057 #, kde-format 11058 msgid "Aqtobe (Aktobe)" 11059 msgstr "" 11060 11061 #. i18n: comment to the previous timezone 11062 #: kdecore/TIMEZONES:739 11063 #, kde-format 11064 msgid "Aqtobe/Aktobe" 11065 msgstr "" 11066 11067 #: kdecore/TIMEZONES:740 11068 #, kde-format 11069 msgid "Asia/Ashgabat" 11070 msgstr "Азија/Ашгабат" 11071 11072 #: kdecore/TIMEZONES:741 11073 #, fuzzy, kde-format 11074 #| msgid "Asia/Ashgabat" 11075 msgid "Asia/Ashkhabad" 11076 msgstr "Азија/Ашгабат" 11077 11078 #: kdecore/TIMEZONES:742 11079 #, fuzzy, kde-format 11080 #| msgid "Asia/Aqtau" 11081 msgid "Asia/Atyrau" 11082 msgstr "Азија/Актау" 11083 11084 #. i18n: comment to the previous timezone 11085 #: kdecore/TIMEZONES:744 11086 #, kde-format 11087 msgid "Atyrau/Atirau/Gur'yev" 11088 msgstr "" 11089 11090 #: kdecore/TIMEZONES:745 11091 #, kde-format 11092 msgid "Asia/Baghdad" 11093 msgstr "Азија/Багдад" 11094 11095 #: kdecore/TIMEZONES:746 11096 #, kde-format 11097 msgid "Asia/Bahrain" 11098 msgstr "Азија/Бахреин" 11099 11100 #: kdecore/TIMEZONES:747 11101 #, kde-format 11102 msgid "Asia/Baku" 11103 msgstr "Азија/Баку" 11104 11105 #: kdecore/TIMEZONES:748 11106 #, kde-format 11107 msgid "Asia/Bangkok" 11108 msgstr "Азија/Банког" 11109 11110 #: kdecore/TIMEZONES:749 11111 #, fuzzy, kde-format 11112 #| msgid "Asia/Baku" 11113 msgid "Asia/Barnaul" 11114 msgstr "Азија/Баку" 11115 11116 #. i18n: comment to the previous timezone 11117 #: kdecore/TIMEZONES:751 11118 #, kde-format 11119 msgid "MSK+04 - Altai" 11120 msgstr "" 11121 11122 #: kdecore/TIMEZONES:752 11123 #, fuzzy, kde-format 11124 #| msgid "Asia/Beirut" 11125 msgid "Asia/Beijing" 11126 msgstr "Азија/Бејрут" 11127 11128 #. i18n: comment to the previous timezone 11129 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11130 #, kde-format 11131 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11132 msgstr "" 11133 11134 #. i18n: comment to the previous timezone 11135 #: kdecore/TIMEZONES:756 11136 #, kde-format 11137 msgid "China Standard Time" 11138 msgstr "" 11139 11140 #: kdecore/TIMEZONES:757 11141 #, kde-format 11142 msgid "Asia/Beirut" 11143 msgstr "Азија/Бејрут" 11144 11145 #: kdecore/TIMEZONES:758 11146 #, kde-format 11147 msgid "Asia/Bishkek" 11148 msgstr "Азија/Бишкек" 11149 11150 #: kdecore/TIMEZONES:759 11151 #, kde-format 11152 msgid "Asia/Brunei" 11153 msgstr "Азија/Брунеи" 11154 11155 #: kdecore/TIMEZONES:760 11156 #, kde-format 11157 msgid "Asia/Calcutta" 11158 msgstr "Азија/Калкута" 11159 11160 #: kdecore/TIMEZONES:761 11161 #, fuzzy, kde-format 11162 #| msgid "Asia/Choibalsan" 11163 msgid "Asia/Chita" 11164 msgstr "Азија/Чоибалсан" 11165 11166 #. i18n: comment to the previous timezone 11167 #: kdecore/TIMEZONES:763 11168 #, kde-format 11169 msgid "MSK+06 - Zabaykalsky" 11170 msgstr "" 11171 11172 #: kdecore/TIMEZONES:764 11173 #, kde-format 11174 msgid "Asia/Choibalsan" 11175 msgstr "Азија/Чоибалсан" 11176 11177 #. i18n: comment to the previous timezone 11178 #: kdecore/TIMEZONES:766 11179 #, kde-format 11180 msgid "Dornod, Sukhbaatar" 11181 msgstr "" 11182 11183 #: kdecore/TIMEZONES:767 11184 #, kde-format 11185 msgid "Asia/Chongqing" 11186 msgstr "Азија/Чунгкинг" 11187 11188 #. i18n: comment to the previous timezone 11189 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11190 #, kde-format 11191 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11192 msgstr "" 11193 11194 #. i18n: comment to the previous timezone 11195 #: kdecore/TIMEZONES:771 11196 #, kde-format 11197 msgid "China mountains" 11198 msgstr "" 11199 11200 #: kdecore/TIMEZONES:772 11201 #, fuzzy, kde-format 11202 #| msgid "Asia/Chongqing" 11203 msgid "Asia/Chungking" 11204 msgstr "Азија/Чунгкинг" 11205 11206 #: kdecore/TIMEZONES:775 11207 #, kde-format 11208 msgid "Asia/Colombo" 11209 msgstr "Азија/Коломбо" 11210 11211 #: kdecore/TIMEZONES:776 11212 #, fuzzy, kde-format 11213 #| msgid "Asia/Dhaka" 11214 msgid "Asia/Dacca" 11215 msgstr "Азија/Дака" 11216 11217 #: kdecore/TIMEZONES:777 11218 #, kde-format 11219 msgid "Asia/Damascus" 11220 msgstr "Азија/Дамаск" 11221 11222 #: kdecore/TIMEZONES:778 11223 #, kde-format 11224 msgid "Asia/Dhaka" 11225 msgstr "Азија/Дака" 11226 11227 #: kdecore/TIMEZONES:779 11228 #, kde-format 11229 msgid "Asia/Dili" 11230 msgstr "Азија/Дили" 11231 11232 #: kdecore/TIMEZONES:780 11233 #, kde-format 11234 msgid "Asia/Dubai" 11235 msgstr "Азија/Дубаи" 11236 11237 #: kdecore/TIMEZONES:781 11238 #, fuzzy, kde-format 11239 #| msgid "Do shanbe" 11240 msgid "Asia/Dushanbe" 11241 msgstr "Do shanbe" 11242 11243 #: kdecore/TIMEZONES:782 11244 #, fuzzy, kde-format 11245 #| msgid "Asia/Damascus" 11246 msgid "Asia/Famagusta" 11247 msgstr "Азија/Дамаск" 11248 11249 #. i18n: comment to the previous timezone 11250 #: kdecore/TIMEZONES:784 11251 #, kde-format 11252 msgid "Northern Cyprus" 11253 msgstr "" 11254 11255 #: kdecore/TIMEZONES:785 11256 #, kde-format 11257 msgid "Asia/Gaza" 11258 msgstr "Азија/Газа" 11259 11260 #. i18n: comment to the previous timezone 11261 #: kdecore/TIMEZONES:787 11262 #, kde-format 11263 msgid "Gaza Strip" 11264 msgstr "" 11265 11266 #: kdecore/TIMEZONES:788 11267 #, kde-format 11268 msgid "Asia/Harbin" 11269 msgstr "Азија/Харбин" 11270 11271 #. i18n: comment to the previous timezone 11272 #: kdecore/TIMEZONES:790 11273 #, kde-format 11274 msgid "Heilongjiang (except Mohe), Jilin" 11275 msgstr "" 11276 11277 #. i18n: comment to the previous timezone 11278 #: kdecore/TIMEZONES:792 11279 #, kde-format 11280 msgid "China north" 11281 msgstr "" 11282 11283 #: kdecore/TIMEZONES:793 11284 #, fuzzy, kde-format 11285 #| msgid "Asia/Harbin" 11286 msgid "Asia/Hebron" 11287 msgstr "Азија/Харбин" 11288 11289 #. i18n: comment to the previous timezone 11290 #: kdecore/TIMEZONES:795 11291 #, kde-format 11292 msgid "West Bank" 11293 msgstr "" 11294 11295 #: kdecore/TIMEZONES:796 11296 #, fuzzy, kde-format 11297 #| msgid "Asia/Chongqing" 11298 msgid "Asia/Ho_Chi_Minh" 11299 msgstr "Азија/Чунгкинг" 11300 11301 #: kdecore/TIMEZONES:797 11302 #, kde-format 11303 msgid "Asia/Hong_Kong" 11304 msgstr "Азија/Хонг_Конг" 11305 11306 #: kdecore/TIMEZONES:798 11307 #, kde-format 11308 msgid "Asia/Hovd" 11309 msgstr "Азија/Ховд" 11310 11311 #. i18n: comment to the previous timezone 11312 #: kdecore/TIMEZONES:800 11313 #, kde-format 11314 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11315 msgstr "" 11316 11317 #: kdecore/TIMEZONES:801 11318 #, kde-format 11319 msgid "Asia/Irkutsk" 11320 msgstr "Азија/Иркутск" 11321 11322 #. i18n: comment to the previous timezone 11323 #: kdecore/TIMEZONES:803 11324 #, kde-format 11325 msgid "Moscow+05 - Lake Baikal" 11326 msgstr "" 11327 11328 #. i18n: comment to the previous timezone 11329 #: kdecore/TIMEZONES:805 11330 #, kde-format 11331 msgid "MSK+05 - Irkutsk, Buryatia" 11332 msgstr "" 11333 11334 #: kdecore/TIMEZONES:806 11335 #, kde-format 11336 msgid "Asia/Jakarta" 11337 msgstr "Азија/Џакарта" 11338 11339 #. i18n: comment to the previous timezone 11340 #: kdecore/TIMEZONES:808 11341 #, kde-format 11342 msgid "Java & Sumatra" 11343 msgstr "" 11344 11345 #. i18n: comment to the previous timezone 11346 #: kdecore/TIMEZONES:810 11347 #, kde-format 11348 msgid "Java, Sumatra" 11349 msgstr "" 11350 11351 #: kdecore/TIMEZONES:811 11352 #, kde-format 11353 msgid "Asia/Jayapura" 11354 msgstr "Азија/Гајапура" 11355 11356 #. i18n: comment to the previous timezone 11357 #: kdecore/TIMEZONES:813 11358 #, kde-format 11359 msgid "Irian Jaya & the Moluccas" 11360 msgstr "" 11361 11362 #. i18n: comment to the previous timezone 11363 #: kdecore/TIMEZONES:815 11364 #, kde-format 11365 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11366 msgstr "" 11367 11368 #. i18n: comment to the previous timezone 11369 #: kdecore/TIMEZONES:817 11370 #, kde-format 11371 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11372 msgstr "" 11373 11374 #: kdecore/TIMEZONES:818 11375 #, kde-format 11376 msgid "Asia/Jerusalem" 11377 msgstr "Азија/Ерусалим" 11378 11379 #: kdecore/TIMEZONES:819 11380 #, kde-format 11381 msgid "Asia/Kabul" 11382 msgstr "Азија/Кабул" 11383 11384 #: kdecore/TIMEZONES:820 11385 #, kde-format 11386 msgid "Asia/Kamchatka" 11387 msgstr "Азија/Камчатка" 11388 11389 #. i18n: comment to the previous timezone 11390 #: kdecore/TIMEZONES:822 11391 #, kde-format 11392 msgid "Moscow+09 - Kamchatka" 11393 msgstr "" 11394 11395 #. i18n: comment to the previous timezone 11396 #: kdecore/TIMEZONES:824 11397 #, kde-format 11398 msgid "Moscow+08 - Kamchatka" 11399 msgstr "" 11400 11401 #. i18n: comment to the previous timezone 11402 #: kdecore/TIMEZONES:826 11403 #, kde-format 11404 msgid "MSK+09 - Kamchatka" 11405 msgstr "" 11406 11407 #: kdecore/TIMEZONES:827 11408 #, kde-format 11409 msgid "Asia/Karachi" 11410 msgstr "Азија/Карачи" 11411 11412 #: kdecore/TIMEZONES:828 11413 #, kde-format 11414 msgid "Asia/Kashgar" 11415 msgstr "Азија/Кашгар" 11416 11417 #. i18n: comment to the previous timezone 11418 #: kdecore/TIMEZONES:830 11419 #, kde-format 11420 msgid "west Tibet & Xinjiang" 11421 msgstr "" 11422 11423 #. i18n: comment to the previous timezone 11424 #: kdecore/TIMEZONES:832 11425 #, kde-format 11426 msgid "China west Xinjiang" 11427 msgstr "" 11428 11429 #: kdecore/TIMEZONES:833 11430 #, fuzzy, kde-format 11431 #| msgid "Asia/Katmandu" 11432 msgid "Asia/Kathmandu" 11433 msgstr "Азија/Катманду" 11434 11435 #: kdecore/TIMEZONES:834 11436 #, kde-format 11437 msgid "Asia/Katmandu" 11438 msgstr "Азија/Катманду" 11439 11440 #: kdecore/TIMEZONES:835 11441 #, fuzzy, kde-format 11442 #| msgid "Asia/Shanghai" 11443 msgid "Asia/Khandyga" 11444 msgstr "Азија/Шангај" 11445 11446 #. i18n: comment to the previous timezone 11447 #: kdecore/TIMEZONES:837 11448 #, kde-format 11449 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11450 msgstr "" 11451 11452 #: kdecore/TIMEZONES:838 11453 #, fuzzy, kde-format 11454 #| msgid "Asia/Jakarta" 11455 msgid "Asia/Kolkata" 11456 msgstr "Азија/Џакарта" 11457 11458 #: kdecore/TIMEZONES:839 11459 #, kde-format 11460 msgid "Asia/Krasnoyarsk" 11461 msgstr "Азија/Краснојарск" 11462 11463 #. i18n: comment to the previous timezone 11464 #: kdecore/TIMEZONES:841 11465 #, kde-format 11466 msgid "Moscow+04 - Yenisei River" 11467 msgstr "" 11468 11469 #. i18n: comment to the previous timezone 11470 #: kdecore/TIMEZONES:843 11471 #, kde-format 11472 msgid "MSK+04 - Krasnoyarsk area" 11473 msgstr "" 11474 11475 #: kdecore/TIMEZONES:844 11476 #, kde-format 11477 msgid "Asia/Kuala_Lumpur" 11478 msgstr "Азија/Куала_Лумпур" 11479 11480 #. i18n: comment to the previous timezone 11481 #: kdecore/TIMEZONES:846 11482 #, kde-format 11483 msgid "peninsular Malaysia" 11484 msgstr "" 11485 11486 #. i18n: comment to the previous timezone 11487 #: kdecore/TIMEZONES:848 11488 #, kde-format 11489 msgid "Malaysia (peninsula)" 11490 msgstr "" 11491 11492 #: kdecore/TIMEZONES:849 11493 #, kde-format 11494 msgid "Asia/Kuching" 11495 msgstr "Азија/Кучинг" 11496 11497 #. i18n: comment to the previous timezone 11498 #: kdecore/TIMEZONES:851 11499 #, kde-format 11500 msgid "Sabah & Sarawak" 11501 msgstr "" 11502 11503 #. i18n: comment to the previous timezone 11504 #: kdecore/TIMEZONES:853 11505 #, kde-format 11506 msgid "Sabah, Sarawak" 11507 msgstr "" 11508 11509 #: kdecore/TIMEZONES:854 11510 #, kde-format 11511 msgid "Asia/Kuwait" 11512 msgstr "Азија/Кувајт" 11513 11514 #: kdecore/TIMEZONES:855 11515 #, fuzzy, kde-format 11516 #| msgid "Asia/Macau" 11517 msgid "Asia/Macao" 11518 msgstr "Азија/Макао" 11519 11520 #: kdecore/TIMEZONES:856 11521 #, kde-format 11522 msgid "Asia/Macau" 11523 msgstr "Азија/Макао" 11524 11525 #: kdecore/TIMEZONES:857 11526 #, kde-format 11527 msgid "Asia/Magadan" 11528 msgstr "Азија/Магадан" 11529 11530 #. i18n: comment to the previous timezone 11531 #: kdecore/TIMEZONES:859 11532 #, kde-format 11533 msgid "Moscow+08 - Magadan" 11534 msgstr "" 11535 11536 #. i18n: comment to the previous timezone 11537 #: kdecore/TIMEZONES:861 11538 #, kde-format 11539 msgid "MSK+08 - Magadan" 11540 msgstr "" 11541 11542 #: kdecore/TIMEZONES:862 11543 #, kde-format 11544 msgid "Asia/Makassar" 11545 msgstr "Азија/Макасар" 11546 11547 #. i18n: comment to the previous timezone 11548 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11549 #, kde-format 11550 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11551 msgstr "" 11552 11553 #. i18n: comment to the previous timezone 11554 #: kdecore/TIMEZONES:866 11555 #, kde-format 11556 msgid "" 11557 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11558 msgstr "" 11559 11560 #. i18n: comment to the previous timezone 11561 #: kdecore/TIMEZONES:868 11562 #, kde-format 11563 msgid "" 11564 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11565 msgstr "" 11566 11567 #: kdecore/TIMEZONES:869 11568 #, kde-format 11569 msgid "Asia/Manila" 11570 msgstr "Азија/Манила" 11571 11572 #: kdecore/TIMEZONES:870 11573 #, kde-format 11574 msgid "Asia/Muscat" 11575 msgstr "Азија/Мускат" 11576 11577 #: kdecore/TIMEZONES:871 11578 #, kde-format 11579 msgid "Asia/Nicosia" 11580 msgstr "Азија/Никозија" 11581 11582 #. i18n: comment to the previous timezone 11583 #: kdecore/TIMEZONES:873 11584 #, kde-format 11585 msgid "Cyprus (most areas)" 11586 msgstr "" 11587 11588 #: kdecore/TIMEZONES:874 11589 #, fuzzy, kde-format 11590 #| msgid "Asia/Irkutsk" 11591 msgid "Asia/Novokuznetsk" 11592 msgstr "Азија/Иркутск" 11593 11594 #. i18n: comment to the previous timezone 11595 #: kdecore/TIMEZONES:876 11596 #, fuzzy, kde-format 11597 #| msgid "Asia/Novosibirsk" 11598 msgid "Moscow+03 - Novokuznetsk" 11599 msgstr "Азија/Новосибирск" 11600 11601 #. i18n: comment to the previous timezone 11602 #: kdecore/TIMEZONES:878 11603 #, kde-format 11604 msgid "MSK+04 - Kemerovo" 11605 msgstr "" 11606 11607 #: kdecore/TIMEZONES:879 11608 #, kde-format 11609 msgid "Asia/Novosibirsk" 11610 msgstr "Азија/Новосибирск" 11611 11612 #. i18n: comment to the previous timezone 11613 #: kdecore/TIMEZONES:881 11614 #, fuzzy, kde-format 11615 #| msgid "Asia/Novosibirsk" 11616 msgid "Moscow+03 - Novosibirsk" 11617 msgstr "Азија/Новосибирск" 11618 11619 #. i18n: comment to the previous timezone 11620 #: kdecore/TIMEZONES:883 11621 #, fuzzy, kde-format 11622 #| msgid "Asia/Novosibirsk" 11623 msgid "MSK+04 - Novosibirsk" 11624 msgstr "Азија/Новосибирск" 11625 11626 #: kdecore/TIMEZONES:884 11627 #, kde-format 11628 msgid "Asia/Omsk" 11629 msgstr "Азија/Омск" 11630 11631 #. i18n: comment to the previous timezone 11632 #: kdecore/TIMEZONES:886 11633 #, kde-format 11634 msgid "Moscow+03 - west Siberia" 11635 msgstr "" 11636 11637 #. i18n: comment to the previous timezone 11638 #: kdecore/TIMEZONES:888 11639 #, kde-format 11640 msgid "MSK+03 - Omsk" 11641 msgstr "" 11642 11643 #: kdecore/TIMEZONES:889 11644 #, kde-format 11645 msgid "Asia/Oral" 11646 msgstr "Азија/Орал" 11647 11648 #. i18n: comment to the previous timezone 11649 #: kdecore/TIMEZONES:891 11650 #, kde-format 11651 msgid "West Kazakhstan" 11652 msgstr "" 11653 11654 #: kdecore/TIMEZONES:892 11655 #, kde-format 11656 msgid "Asia/Phnom_Penh" 11657 msgstr "Азија/Пном_Пен" 11658 11659 #: kdecore/TIMEZONES:893 11660 #, kde-format 11661 msgid "Asia/Pontianak" 11662 msgstr "Азија/Понтијанак" 11663 11664 #. i18n: comment to the previous timezone 11665 #: kdecore/TIMEZONES:895 11666 #, kde-format 11667 msgid "west & central Borneo" 11668 msgstr "" 11669 11670 #. i18n: comment to the previous timezone 11671 #: kdecore/TIMEZONES:897 11672 #, kde-format 11673 msgid "Borneo (west, central)" 11674 msgstr "" 11675 11676 #: kdecore/TIMEZONES:898 11677 #, kde-format 11678 msgid "Asia/Pyongyang" 11679 msgstr "Азија/Пјонгјанг" 11680 11681 #: kdecore/TIMEZONES:899 11682 #, kde-format 11683 msgid "Asia/Qatar" 11684 msgstr "Азија/Катар" 11685 11686 #: kdecore/TIMEZONES:900 11687 #, fuzzy, kde-format 11688 #| msgid "Asia/Pontianak" 11689 msgid "Asia/Qostanay" 11690 msgstr "Азија/Понтијанак" 11691 11692 #. i18n: comment to the previous timezone 11693 #: kdecore/TIMEZONES:902 11694 #, kde-format 11695 msgid "Qostanay/Kostanay/Kustanay" 11696 msgstr "" 11697 11698 #: kdecore/TIMEZONES:903 11699 #, kde-format 11700 msgid "Asia/Qyzylorda" 11701 msgstr "Азија/Кизилорда" 11702 11703 #. i18n: comment to the previous timezone 11704 #: kdecore/TIMEZONES:905 11705 #, kde-format 11706 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11707 msgstr "" 11708 11709 #. i18n: comment to the previous timezone 11710 #: kdecore/TIMEZONES:907 11711 #, kde-format 11712 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11713 msgstr "" 11714 11715 #: kdecore/TIMEZONES:908 11716 #, kde-format 11717 msgid "Asia/Rangoon" 11718 msgstr "Азија/Рангун" 11719 11720 #: kdecore/TIMEZONES:909 11721 #, kde-format 11722 msgid "Asia/Riyadh" 11723 msgstr "Азија/Ријад" 11724 11725 #: kdecore/TIMEZONES:910 11726 #, kde-format 11727 msgid "Asia/Saigon" 11728 msgstr "Азија/Сајгон" 11729 11730 #: kdecore/TIMEZONES:911 11731 #, kde-format 11732 msgid "Asia/Sakhalin" 11733 msgstr "Азија/Сахалин" 11734 11735 #. i18n: comment to the previous timezone 11736 #: kdecore/TIMEZONES:913 11737 #, kde-format 11738 msgid "Moscow+07 - Sakhalin Island" 11739 msgstr "" 11740 11741 #. i18n: comment to the previous timezone 11742 #: kdecore/TIMEZONES:915 11743 #, kde-format 11744 msgid "MSK+08 - Sakhalin Island" 11745 msgstr "" 11746 11747 #: kdecore/TIMEZONES:916 11748 #, kde-format 11749 msgid "Asia/Samarkand" 11750 msgstr "Азија/Самарканд" 11751 11752 #. i18n: comment to the previous timezone 11753 #: kdecore/TIMEZONES:918 11754 #, kde-format 11755 msgid "west Uzbekistan" 11756 msgstr "" 11757 11758 #. i18n: comment to the previous timezone 11759 #: kdecore/TIMEZONES:920 11760 #, kde-format 11761 msgid "Uzbekistan (west)" 11762 msgstr "" 11763 11764 #: kdecore/TIMEZONES:921 11765 #, kde-format 11766 msgid "Asia/Seoul" 11767 msgstr "Азија/Сеул" 11768 11769 #: kdecore/TIMEZONES:922 11770 #, kde-format 11771 msgid "Asia/Shanghai" 11772 msgstr "Азија/Шангај" 11773 11774 #. i18n: comment to the previous timezone 11775 #: kdecore/TIMEZONES:926 11776 #, kde-format 11777 msgid "China east" 11778 msgstr "" 11779 11780 #. i18n: comment to the previous timezone 11781 #: kdecore/TIMEZONES:928 11782 #, kde-format 11783 msgid "Beijing Time" 11784 msgstr "" 11785 11786 #: kdecore/TIMEZONES:929 11787 #, kde-format 11788 msgid "Asia/Singapore" 11789 msgstr "Азија/Сингапур" 11790 11791 #: kdecore/TIMEZONES:930 11792 #, fuzzy, kde-format 11793 #| msgid "Asia/Krasnoyarsk" 11794 msgid "Asia/Srednekolymsk" 11795 msgstr "Азија/Краснојарск" 11796 11797 #. i18n: comment to the previous timezone 11798 #: kdecore/TIMEZONES:932 11799 #, kde-format 11800 msgid "MSK+08 - Sakha (E); North Kuril Is" 11801 msgstr "" 11802 11803 #: kdecore/TIMEZONES:933 11804 #, kde-format 11805 msgid "Asia/Taipei" 11806 msgstr "Азија/Тајпеј" 11807 11808 #: kdecore/TIMEZONES:934 11809 #, kde-format 11810 msgid "Asia/Tashkent" 11811 msgstr "Азија/Ташкент" 11812 11813 #. i18n: comment to the previous timezone 11814 #: kdecore/TIMEZONES:936 11815 #, kde-format 11816 msgid "east Uzbekistan" 11817 msgstr "" 11818 11819 #. i18n: comment to the previous timezone 11820 #: kdecore/TIMEZONES:938 11821 #, kde-format 11822 msgid "Uzbekistan (east)" 11823 msgstr "" 11824 11825 #: kdecore/TIMEZONES:939 11826 #, kde-format 11827 msgid "Asia/Tbilisi" 11828 msgstr "Азија/Тбилиси" 11829 11830 #: kdecore/TIMEZONES:940 11831 #, kde-format 11832 msgid "Asia/Tehran" 11833 msgstr "Азија/Техеран" 11834 11835 #: kdecore/TIMEZONES:941 11836 #, fuzzy, kde-format 11837 #| msgid "Asia/Taipei" 11838 msgid "Asia/Tel_Aviv" 11839 msgstr "Азија/Тајпеј" 11840 11841 #: kdecore/TIMEZONES:942 11842 #, fuzzy, kde-format 11843 #| msgid "Asia/Thimphu" 11844 msgid "Asia/Thimbu" 11845 msgstr "Азија/Тимфу" 11846 11847 #: kdecore/TIMEZONES:943 11848 #, kde-format 11849 msgid "Asia/Thimphu" 11850 msgstr "Азија/Тимфу" 11851 11852 #: kdecore/TIMEZONES:944 11853 #, kde-format 11854 msgid "Asia/Tokyo" 11855 msgstr "Азија/Токио" 11856 11857 #: kdecore/TIMEZONES:945 11858 #, fuzzy, kde-format 11859 #| msgid "Asia/Omsk" 11860 msgid "Asia/Tomsk" 11861 msgstr "Азија/Омск" 11862 11863 #. i18n: comment to the previous timezone 11864 #: kdecore/TIMEZONES:947 11865 #, kde-format 11866 msgid "MSK+04 - Tomsk" 11867 msgstr "" 11868 11869 #: kdecore/TIMEZONES:948 11870 #, kde-format 11871 msgid "Asia/Ujung_Pandang" 11872 msgstr "Азија/Ујунг_Панданг" 11873 11874 #: kdecore/TIMEZONES:951 11875 #, kde-format 11876 msgid "Asia/Ulaanbaatar" 11877 msgstr "Азија/Уланбатор" 11878 11879 #. i18n: comment to the previous timezone 11880 #: kdecore/TIMEZONES:955 11881 #, kde-format 11882 msgid "Mongolia (most areas)" 11883 msgstr "" 11884 11885 #: kdecore/TIMEZONES:956 11886 #, fuzzy, kde-format 11887 #| msgid "Asia/Ulaanbaatar" 11888 msgid "Asia/Ulan_Bator" 11889 msgstr "Азија/Уланбатор" 11890 11891 #: kdecore/TIMEZONES:959 11892 #, kde-format 11893 msgid "Asia/Urumqi" 11894 msgstr "Азија/Урумчи" 11895 11896 #. i18n: comment to the previous timezone 11897 #: kdecore/TIMEZONES:961 11898 #, kde-format 11899 msgid "most of Tibet & Xinjiang" 11900 msgstr "" 11901 11902 #. i18n: comment to the previous timezone 11903 #: kdecore/TIMEZONES:963 11904 #, kde-format 11905 msgid "China Xinjiang-Tibet" 11906 msgstr "" 11907 11908 #. i18n: comment to the previous timezone 11909 #: kdecore/TIMEZONES:965 11910 #, kde-format 11911 msgid "Xinjiang Time" 11912 msgstr "" 11913 11914 #: kdecore/TIMEZONES:966 11915 #, fuzzy, kde-format 11916 #| msgid "Asia/Tehran" 11917 msgid "Asia/Ust-Nera" 11918 msgstr "Азија/Техеран" 11919 11920 #. i18n: comment to the previous timezone 11921 #: kdecore/TIMEZONES:968 11922 #, kde-format 11923 msgid "MSK+07 - Oymyakonsky" 11924 msgstr "" 11925 11926 #: kdecore/TIMEZONES:969 11927 #, kde-format 11928 msgid "Asia/Vientiane" 11929 msgstr "Азија/Виентиан" 11930 11931 #: kdecore/TIMEZONES:970 11932 #, kde-format 11933 msgid "Asia/Vladivostok" 11934 msgstr "Азија/Владивосток" 11935 11936 #. i18n: comment to the previous timezone 11937 #: kdecore/TIMEZONES:972 11938 #, kde-format 11939 msgid "Moscow+07 - Amur River" 11940 msgstr "" 11941 11942 #. i18n: comment to the previous timezone 11943 #: kdecore/TIMEZONES:974 11944 #, kde-format 11945 msgid "MSK+07 - Amur River" 11946 msgstr "" 11947 11948 #: kdecore/TIMEZONES:975 11949 #, kde-format 11950 msgid "Asia/Yakutsk" 11951 msgstr "Азија/Јакутск" 11952 11953 #. i18n: comment to the previous timezone 11954 #: kdecore/TIMEZONES:977 11955 #, kde-format 11956 msgid "Moscow+06 - Lena River" 11957 msgstr "" 11958 11959 #. i18n: comment to the previous timezone 11960 #: kdecore/TIMEZONES:979 11961 #, kde-format 11962 msgid "MSK+06 - Lena River" 11963 msgstr "" 11964 11965 #: kdecore/TIMEZONES:980 11966 #, fuzzy, kde-format 11967 #| msgid "Asia/Rangoon" 11968 msgid "Asia/Yangon" 11969 msgstr "Азија/Рангун" 11970 11971 #: kdecore/TIMEZONES:981 11972 #, kde-format 11973 msgid "Asia/Yekaterinburg" 11974 msgstr "Азија/Екатеринбург" 11975 11976 #. i18n: comment to the previous timezone 11977 #: kdecore/TIMEZONES:983 11978 #, kde-format 11979 msgid "Moscow+02 - Urals" 11980 msgstr "" 11981 11982 #. i18n: comment to the previous timezone 11983 #: kdecore/TIMEZONES:985 11984 #, kde-format 11985 msgid "MSK+02 - Urals" 11986 msgstr "" 11987 11988 #: kdecore/TIMEZONES:986 11989 #, kde-format 11990 msgid "Asia/Yerevan" 11991 msgstr "Азија/Ереван" 11992 11993 #: kdecore/TIMEZONES:987 11994 #, kde-format 11995 msgid "Atlantic/Azores" 11996 msgstr "Атлантик/Азури" 11997 11998 #. i18n: comment to the previous timezone 11999 #: kdecore/TIMEZONES:989 12000 #, kde-format 12001 msgid "Azores" 12002 msgstr "" 12003 12004 #: kdecore/TIMEZONES:990 12005 #, kde-format 12006 msgid "Atlantic/Bermuda" 12007 msgstr "Атлантик/Бермуди" 12008 12009 #: kdecore/TIMEZONES:991 12010 #, kde-format 12011 msgid "Atlantic/Canary" 12012 msgstr "Атлантик/Канарски_Острови" 12013 12014 #. i18n: comment to the previous timezone 12015 #: kdecore/TIMEZONES:993 12016 #, kde-format 12017 msgid "Canary Islands" 12018 msgstr "" 12019 12020 #: kdecore/TIMEZONES:994 12021 #, kde-format 12022 msgid "Atlantic/Cape_Verde" 12023 msgstr "Атлантик/Кејп_Верде" 12024 12025 #: kdecore/TIMEZONES:995 12026 #, kde-format 12027 msgid "Atlantic/Faeroe" 12028 msgstr "Атлантик/Фарски_Острови" 12029 12030 #: kdecore/TIMEZONES:996 12031 #, kde-format 12032 msgid "Atlantic/Faroe" 12033 msgstr "Атлантик/Фарски_Острови" 12034 12035 #: kdecore/TIMEZONES:997 12036 #, kde-format 12037 msgid "Atlantic/Jan_Mayen" 12038 msgstr "Атлантик/Јан_Мајен" 12039 12040 #: kdecore/TIMEZONES:998 12041 #, kde-format 12042 msgid "Atlantic/Madeira" 12043 msgstr "Атлантик/Мадеира" 12044 12045 #. i18n: comment to the previous timezone 12046 #: kdecore/TIMEZONES:1000 12047 #, kde-format 12048 msgid "Madeira Islands" 12049 msgstr "" 12050 12051 #: kdecore/TIMEZONES:1001 12052 #, kde-format 12053 msgid "Atlantic/Reykjavik" 12054 msgstr "Атлантик/Рејкјавик" 12055 12056 #: kdecore/TIMEZONES:1002 12057 #, kde-format 12058 msgid "Atlantic/South_Georgia" 12059 msgstr "Атлантик/Јужна_Џорџија" 12060 12061 #: kdecore/TIMEZONES:1003 12062 #, kde-format 12063 msgid "Atlantic/St_Helena" 12064 msgstr "Атлантик/Света_Елена" 12065 12066 #: kdecore/TIMEZONES:1004 12067 #, kde-format 12068 msgid "Atlantic/Stanley" 12069 msgstr "Атлантик/Стенли" 12070 12071 #: kdecore/TIMEZONES:1005 12072 #, fuzzy, kde-format 12073 #| msgid "Australia/Currie" 12074 msgid "Australia/ACT" 12075 msgstr "Австралија/Кари" 12076 12077 #. i18n: comment to the previous timezone 12078 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12079 #: kdecore/TIMEZONES:1073 12080 #, kde-format 12081 msgid "New South Wales - most locations" 12082 msgstr "" 12083 12084 #: kdecore/TIMEZONES:1008 12085 #, kde-format 12086 msgid "Australia/Adelaide" 12087 msgstr "Австралија/Аделаида" 12088 12089 #. i18n: comment to the previous timezone 12090 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12091 #, fuzzy, kde-format 12092 #| msgid "Australia/Eucla" 12093 msgid "South Australia" 12094 msgstr "Австралија/Еукла" 12095 12096 #: kdecore/TIMEZONES:1011 12097 #, kde-format 12098 msgid "Australia/Brisbane" 12099 msgstr "Австралија/Бризбејн" 12100 12101 #. i18n: comment to the previous timezone 12102 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12103 #, kde-format 12104 msgid "Queensland - most locations" 12105 msgstr "" 12106 12107 #. i18n: comment to the previous timezone 12108 #: kdecore/TIMEZONES:1015 12109 #, kde-format 12110 msgid "Queensland (most areas)" 12111 msgstr "" 12112 12113 #: kdecore/TIMEZONES:1016 12114 #, kde-format 12115 msgid "Australia/Broken_Hill" 12116 msgstr "Австралија/Брокен_Хил" 12117 12118 #. i18n: comment to the previous timezone 12119 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12120 #, kde-format 12121 msgid "New South Wales - Yancowinna" 12122 msgstr "" 12123 12124 #. i18n: comment to the previous timezone 12125 #: kdecore/TIMEZONES:1020 12126 #, kde-format 12127 msgid "New South Wales (Yancowinna)" 12128 msgstr "" 12129 12130 #: kdecore/TIMEZONES:1021 12131 #, fuzzy, kde-format 12132 #| msgid "Australia/Currie" 12133 msgid "Australia/Canberra" 12134 msgstr "Австралија/Кари" 12135 12136 #: kdecore/TIMEZONES:1024 12137 #, kde-format 12138 msgid "Australia/Currie" 12139 msgstr "Австралија/Кари" 12140 12141 #. i18n: comment to the previous timezone 12142 #: kdecore/TIMEZONES:1026 12143 #, kde-format 12144 msgid "Tasmania - King Island" 12145 msgstr "" 12146 12147 #: kdecore/TIMEZONES:1027 12148 #, kde-format 12149 msgid "Australia/Darwin" 12150 msgstr "Австралија/Дарвин" 12151 12152 #. i18n: comment to the previous timezone 12153 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12154 #, kde-format 12155 msgid "Northern Territory" 12156 msgstr "" 12157 12158 #: kdecore/TIMEZONES:1030 12159 #, kde-format 12160 msgid "Australia/Eucla" 12161 msgstr "Австралија/Еукла" 12162 12163 #. i18n: comment to the previous timezone 12164 #: kdecore/TIMEZONES:1032 12165 #, fuzzy, kde-format 12166 #| msgid "Australia/Eucla" 12167 msgid "Western Australia - Eucla area" 12168 msgstr "Австралија/Еукла" 12169 12170 #. i18n: comment to the previous timezone 12171 #: kdecore/TIMEZONES:1034 12172 #, fuzzy, kde-format 12173 #| msgid "Australia/Eucla" 12174 msgid "Western Australia (Eucla)" 12175 msgstr "Австралија/Еукла" 12176 12177 #: kdecore/TIMEZONES:1035 12178 #, kde-format 12179 msgid "Australia/Hobart" 12180 msgstr "Австралија/Хобарт" 12181 12182 #. i18n: comment to the previous timezone 12183 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12184 #, kde-format 12185 msgid "Tasmania - most locations" 12186 msgstr "" 12187 12188 #. i18n: comment to the previous timezone 12189 #: kdecore/TIMEZONES:1039 12190 #, fuzzy, kde-format 12191 #| msgid "Australia/Brisbane" 12192 msgid "Tasmania" 12193 msgstr "Австралија/Бризбејн" 12194 12195 #: kdecore/TIMEZONES:1040 12196 #, fuzzy, kde-format 12197 #| msgid "Australia/Hobart" 12198 msgid "Australia/LHI" 12199 msgstr "Австралија/Хобарт" 12200 12201 #. i18n: comment to the previous timezone 12202 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12203 #, kde-format 12204 msgid "Lord Howe Island" 12205 msgstr "" 12206 12207 #: kdecore/TIMEZONES:1043 12208 #, kde-format 12209 msgid "Australia/Lindeman" 12210 msgstr "Австралија/Линдеман" 12211 12212 #. i18n: comment to the previous timezone 12213 #: kdecore/TIMEZONES:1045 12214 #, kde-format 12215 msgid "Queensland - Holiday Islands" 12216 msgstr "" 12217 12218 #. i18n: comment to the previous timezone 12219 #: kdecore/TIMEZONES:1047 12220 #, kde-format 12221 msgid "Queensland (Whitsunday Islands)" 12222 msgstr "" 12223 12224 #: kdecore/TIMEZONES:1048 12225 #, kde-format 12226 msgid "Australia/Lord_Howe" 12227 msgstr "Австралија/Лорд_Хоу" 12228 12229 #: kdecore/TIMEZONES:1051 12230 #, kde-format 12231 msgid "Australia/Melbourne" 12232 msgstr "Австралија/Мелбурн" 12233 12234 #. i18n: comment to the previous timezone 12235 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12236 #, kde-format 12237 msgid "Victoria" 12238 msgstr "" 12239 12240 #: kdecore/TIMEZONES:1054 12241 #, fuzzy, kde-format 12242 #| msgid "Australia/Sydney" 12243 msgid "Australia/NSW" 12244 msgstr "Австралија/Сиднеј" 12245 12246 #: kdecore/TIMEZONES:1057 12247 #, fuzzy, kde-format 12248 #| msgid "Australia/Perth" 12249 msgid "Australia/North" 12250 msgstr "Австралија/Перт" 12251 12252 #: kdecore/TIMEZONES:1060 12253 #, kde-format 12254 msgid "Australia/Perth" 12255 msgstr "Австралија/Перт" 12256 12257 #. i18n: comment to the previous timezone 12258 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12259 #, kde-format 12260 msgid "Western Australia - most locations" 12261 msgstr "" 12262 12263 #. i18n: comment to the previous timezone 12264 #: kdecore/TIMEZONES:1064 12265 #, fuzzy, kde-format 12266 #| msgid "Australia/Eucla" 12267 msgid "Western Australia (most areas)" 12268 msgstr "Австралија/Еукла" 12269 12270 #: kdecore/TIMEZONES:1065 12271 #, fuzzy, kde-format 12272 #| msgid "Australia/Eucla" 12273 msgid "Australia/Queensland" 12274 msgstr "Австралија/Еукла" 12275 12276 #: kdecore/TIMEZONES:1068 12277 #, fuzzy, kde-format 12278 #| msgid "Australia/Perth" 12279 msgid "Australia/South" 12280 msgstr "Австралија/Перт" 12281 12282 #: kdecore/TIMEZONES:1071 12283 #, kde-format 12284 msgid "Australia/Sydney" 12285 msgstr "Австралија/Сиднеј" 12286 12287 #. i18n: comment to the previous timezone 12288 #: kdecore/TIMEZONES:1075 12289 #, kde-format 12290 msgid "New South Wales (most areas)" 12291 msgstr "" 12292 12293 #: kdecore/TIMEZONES:1076 12294 #, fuzzy, kde-format 12295 #| msgid "Australia/Brisbane" 12296 msgid "Australia/Tasmania" 12297 msgstr "Австралија/Бризбејн" 12298 12299 #: kdecore/TIMEZONES:1079 12300 #, fuzzy, kde-format 12301 #| msgid "Australia/Eucla" 12302 msgid "Australia/Victoria" 12303 msgstr "Австралија/Еукла" 12304 12305 #: kdecore/TIMEZONES:1082 12306 #, fuzzy, kde-format 12307 #| msgid "Australia/Perth" 12308 msgid "Australia/West" 12309 msgstr "Австралија/Перт" 12310 12311 #: kdecore/TIMEZONES:1085 12312 #, fuzzy, kde-format 12313 #| msgid "Australia/Darwin" 12314 msgid "Australia/Yancowinna" 12315 msgstr "Австралија/Дарвин" 12316 12317 #: kdecore/TIMEZONES:1088 12318 #, kde-format 12319 msgid "Brazil/Acre" 12320 msgstr "" 12321 12322 #: kdecore/TIMEZONES:1091 12323 #, fuzzy, kde-format 12324 #| msgid "America/Noronha" 12325 msgid "Brazil/DeNoronha" 12326 msgstr "Америка/Норонха" 12327 12328 #: kdecore/TIMEZONES:1094 12329 #, kde-format 12330 msgid "Brazil/East" 12331 msgstr "" 12332 12333 #: kdecore/TIMEZONES:1097 12334 #, kde-format 12335 msgid "Brazil/West" 12336 msgstr "" 12337 12338 #: kdecore/TIMEZONES:1100 12339 #, kde-format 12340 msgid "Canada/Atlantic" 12341 msgstr "" 12342 12343 #: kdecore/TIMEZONES:1103 12344 #, kde-format 12345 msgid "Canada/Central" 12346 msgstr "" 12347 12348 #: kdecore/TIMEZONES:1106 12349 #, kde-format 12350 msgid "Canada/East-Saskatchewan" 12351 msgstr "" 12352 12353 #: kdecore/TIMEZONES:1109 12354 #, kde-format 12355 msgid "Canada/Eastern" 12356 msgstr "" 12357 12358 #: kdecore/TIMEZONES:1112 12359 #, kde-format 12360 msgid "Canada/Mountain" 12361 msgstr "" 12362 12363 #: kdecore/TIMEZONES:1115 12364 #, kde-format 12365 msgid "Canada/Newfoundland" 12366 msgstr "" 12367 12368 #: kdecore/TIMEZONES:1118 12369 #, kde-format 12370 msgid "Canada/Pacific" 12371 msgstr "" 12372 12373 #: kdecore/TIMEZONES:1121 12374 #, kde-format 12375 msgid "Canada/Saskatchewan" 12376 msgstr "" 12377 12378 #: kdecore/TIMEZONES:1124 12379 #, kde-format 12380 msgid "Canada/Yukon" 12381 msgstr "" 12382 12383 #: kdecore/TIMEZONES:1127 12384 #, kde-format 12385 msgid "Chile/Continental" 12386 msgstr "" 12387 12388 #: kdecore/TIMEZONES:1130 12389 #, kde-format 12390 msgid "Chile/EasterIsland" 12391 msgstr "" 12392 12393 #. i18n: comment to the previous timezone 12394 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12395 #, kde-format 12396 msgid "Easter Island & Sala y Gomez" 12397 msgstr "" 12398 12399 #: kdecore/TIMEZONES:1133 12400 #, kde-format 12401 msgid "Cuba" 12402 msgstr "" 12403 12404 #: kdecore/TIMEZONES:1134 12405 #, kde-format 12406 msgid "Egypt" 12407 msgstr "" 12408 12409 #: kdecore/TIMEZONES:1135 12410 #, kde-format 12411 msgid "Eire" 12412 msgstr "" 12413 12414 #: kdecore/TIMEZONES:1136 12415 #, kde-format 12416 msgid "Europe/Amsterdam" 12417 msgstr "Европа/Амстердам" 12418 12419 #: kdecore/TIMEZONES:1137 12420 #, kde-format 12421 msgid "Europe/Andorra" 12422 msgstr "Европа/Андора" 12423 12424 #: kdecore/TIMEZONES:1138 12425 #, fuzzy, kde-format 12426 #| msgid "Europe/Athens" 12427 msgid "Europe/Astrakhan" 12428 msgstr "Европа/Атина" 12429 12430 #. i18n: comment to the previous timezone 12431 #: kdecore/TIMEZONES:1140 12432 #, kde-format 12433 msgid "MSK+01 - Astrakhan" 12434 msgstr "" 12435 12436 #: kdecore/TIMEZONES:1141 12437 #, kde-format 12438 msgid "Europe/Athens" 12439 msgstr "Европа/Атина" 12440 12441 #: kdecore/TIMEZONES:1142 12442 #, kde-format 12443 msgid "Europe/Belfast" 12444 msgstr "Европа/Белфаст" 12445 12446 #: kdecore/TIMEZONES:1143 12447 #, kde-format 12448 msgid "Europe/Belgrade" 12449 msgstr "Европа/Белград" 12450 12451 #: kdecore/TIMEZONES:1144 12452 #, kde-format 12453 msgid "Europe/Berlin" 12454 msgstr "Европа/Берлин" 12455 12456 #. i18n: comment to the previous timezone 12457 #: kdecore/TIMEZONES:1146 12458 #, kde-format 12459 msgid "Germany (most areas)" 12460 msgstr "" 12461 12462 #: kdecore/TIMEZONES:1147 12463 #, kde-format 12464 msgid "Europe/Bratislava" 12465 msgstr "Европа/Братислава" 12466 12467 #: kdecore/TIMEZONES:1148 12468 #, kde-format 12469 msgid "Europe/Brussels" 12470 msgstr "Европа/Брисел" 12471 12472 #: kdecore/TIMEZONES:1149 12473 #, kde-format 12474 msgid "Europe/Bucharest" 12475 msgstr "Европа/Букурешт" 12476 12477 #: kdecore/TIMEZONES:1150 12478 #, kde-format 12479 msgid "Europe/Budapest" 12480 msgstr "Европа/Будимпешта" 12481 12482 #: kdecore/TIMEZONES:1151 12483 #, fuzzy, kde-format 12484 #| msgid "Europe/Brussels" 12485 msgid "Europe/Busingen" 12486 msgstr "Европа/Брисел" 12487 12488 #. i18n: comment to the previous timezone 12489 #: kdecore/TIMEZONES:1153 12490 #, kde-format 12491 msgid "Busingen" 12492 msgstr "" 12493 12494 #: kdecore/TIMEZONES:1154 12495 #, kde-format 12496 msgid "Europe/Chisinau" 12497 msgstr "Европа/Чишинау" 12498 12499 #: kdecore/TIMEZONES:1155 12500 #, kde-format 12501 msgid "Europe/Copenhagen" 12502 msgstr "Европа/Копенхаген" 12503 12504 #: kdecore/TIMEZONES:1156 12505 #, kde-format 12506 msgid "Europe/Dublin" 12507 msgstr "Европа/Даблин" 12508 12509 #: kdecore/TIMEZONES:1157 12510 #, kde-format 12511 msgid "Europe/Gibraltar" 12512 msgstr "Европа/Гибралтар" 12513 12514 #: kdecore/TIMEZONES:1158 12515 #, kde-format 12516 msgid "Europe/Guernsey" 12517 msgstr "Европа/Гернзи" 12518 12519 #: kdecore/TIMEZONES:1159 12520 #, kde-format 12521 msgid "Europe/Helsinki" 12522 msgstr "Европа/Хелсинки" 12523 12524 #: kdecore/TIMEZONES:1160 12525 #, kde-format 12526 msgid "Europe/Isle_of_Man" 12527 msgstr "" 12528 12529 #: kdecore/TIMEZONES:1161 12530 #, kde-format 12531 msgid "Europe/Istanbul" 12532 msgstr "Европа/Истанбул" 12533 12534 #: kdecore/TIMEZONES:1162 12535 #, kde-format 12536 msgid "Europe/Jersey" 12537 msgstr "Европа/Џерзи" 12538 12539 #: kdecore/TIMEZONES:1163 12540 #, kde-format 12541 msgid "Europe/Kaliningrad" 12542 msgstr "Европа/Калининград" 12543 12544 #. i18n: comment to the previous timezone 12545 #: kdecore/TIMEZONES:1165 12546 #, kde-format 12547 msgid "Moscow-01 - Kaliningrad" 12548 msgstr "" 12549 12550 #. i18n: comment to the previous timezone 12551 #: kdecore/TIMEZONES:1167 12552 #, kde-format 12553 msgid "MSK-01 - Kaliningrad" 12554 msgstr "" 12555 12556 #: kdecore/TIMEZONES:1168 12557 #, kde-format 12558 msgid "Europe/Kiev" 12559 msgstr "Европа/Киев" 12560 12561 #. i18n: comment to the previous timezone 12562 #: kdecore/TIMEZONES:1172 12563 #, kde-format 12564 msgid "Ukraine (most areas)" 12565 msgstr "" 12566 12567 #: kdecore/TIMEZONES:1173 12568 #, fuzzy, kde-format 12569 #| msgid "Europe/Kiev" 12570 msgid "Europe/Kirov" 12571 msgstr "Европа/Киев" 12572 12573 #. i18n: comment to the previous timezone 12574 #: kdecore/TIMEZONES:1175 12575 #, kde-format 12576 msgid "MSK+00 - Kirov" 12577 msgstr "" 12578 12579 #: kdecore/TIMEZONES:1176 12580 #, kde-format 12581 msgid "Europe/Lisbon" 12582 msgstr "Европа/Лисабон" 12583 12584 #. i18n: comment to the previous timezone 12585 #: kdecore/TIMEZONES:1180 12586 #, kde-format 12587 msgid "Portugal (mainland)" 12588 msgstr "" 12589 12590 #: kdecore/TIMEZONES:1181 12591 #, kde-format 12592 msgid "Europe/Ljubljana" 12593 msgstr "Европа/Љубљана" 12594 12595 #: kdecore/TIMEZONES:1182 12596 #, kde-format 12597 msgid "Europe/London" 12598 msgstr "Европа/Лондон" 12599 12600 #: kdecore/TIMEZONES:1183 12601 #, kde-format 12602 msgid "Europe/Luxembourg" 12603 msgstr "Европа/Луксембург" 12604 12605 #: kdecore/TIMEZONES:1184 12606 #, kde-format 12607 msgid "Europe/Madrid" 12608 msgstr "Европа/Мадрид" 12609 12610 #. i18n: comment to the previous timezone 12611 #: kdecore/TIMEZONES:1188 12612 #, kde-format 12613 msgid "Spain (mainland)" 12614 msgstr "" 12615 12616 #: kdecore/TIMEZONES:1189 12617 #, kde-format 12618 msgid "Europe/Malta" 12619 msgstr "Европа/Малта" 12620 12621 #: kdecore/TIMEZONES:1190 12622 #, kde-format 12623 msgid "Europe/Mariehamn" 12624 msgstr "Европа/Мариехам" 12625 12626 #: kdecore/TIMEZONES:1191 12627 #, kde-format 12628 msgid "Europe/Minsk" 12629 msgstr "Европа/Минск" 12630 12631 #: kdecore/TIMEZONES:1192 12632 #, kde-format 12633 msgid "Europe/Monaco" 12634 msgstr "Европа/Монако" 12635 12636 #: kdecore/TIMEZONES:1193 12637 #, kde-format 12638 msgid "Europe/Moscow" 12639 msgstr "Европа/Москва" 12640 12641 #. i18n: comment to the previous timezone 12642 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12643 #, kde-format 12644 msgid "Moscow+00 - west Russia" 12645 msgstr "" 12646 12647 #. i18n: comment to the previous timezone 12648 #: kdecore/TIMEZONES:1197 12649 #, kde-format 12650 msgid "MSK+00 - Moscow area" 12651 msgstr "" 12652 12653 #: kdecore/TIMEZONES:1198 12654 #, kde-format 12655 msgid "Europe/Oslo" 12656 msgstr "Европа/Осло" 12657 12658 #: kdecore/TIMEZONES:1199 12659 #, kde-format 12660 msgid "Europe/Paris" 12661 msgstr "Европа/Париз" 12662 12663 #: kdecore/TIMEZONES:1200 12664 #, kde-format 12665 msgid "Europe/Podgorica" 12666 msgstr "Европа/Подгорица" 12667 12668 #: kdecore/TIMEZONES:1201 12669 #, kde-format 12670 msgid "Europe/Prague" 12671 msgstr "Европа/Прага" 12672 12673 #: kdecore/TIMEZONES:1202 12674 #, kde-format 12675 msgid "Europe/Riga" 12676 msgstr "Европа/Рига" 12677 12678 #: kdecore/TIMEZONES:1203 12679 #, kde-format 12680 msgid "Europe/Rome" 12681 msgstr "Европа/Рим" 12682 12683 #: kdecore/TIMEZONES:1204 12684 #, kde-format 12685 msgid "Europe/Samara" 12686 msgstr "Европа/Самара" 12687 12688 #. i18n: comment to the previous timezone 12689 #: kdecore/TIMEZONES:1206 12690 #, kde-format 12691 msgid "Moscow+01 - Samara, Udmurtia" 12692 msgstr "" 12693 12694 #. i18n: comment to the previous timezone 12695 #: kdecore/TIMEZONES:1208 12696 #, kde-format 12697 msgid "Moscow+00 - Samara, Udmurtia" 12698 msgstr "" 12699 12700 #. i18n: comment to the previous timezone 12701 #: kdecore/TIMEZONES:1210 12702 #, kde-format 12703 msgid "MSK+01 - Samara, Udmurtia" 12704 msgstr "" 12705 12706 #: kdecore/TIMEZONES:1211 12707 #, kde-format 12708 msgid "Europe/San_Marino" 12709 msgstr "Европа/Сан_Марино" 12710 12711 #: kdecore/TIMEZONES:1212 12712 #, kde-format 12713 msgid "Europe/Sarajevo" 12714 msgstr "Европа/Сараево" 12715 12716 #: kdecore/TIMEZONES:1213 12717 #, fuzzy, kde-format 12718 #| msgid "Europe/Sarajevo" 12719 msgid "Europe/Saratov" 12720 msgstr "Европа/Сараево" 12721 12722 #. i18n: comment to the previous timezone 12723 #: kdecore/TIMEZONES:1215 12724 #, kde-format 12725 msgid "MSK+01 - Saratov" 12726 msgstr "" 12727 12728 #: kdecore/TIMEZONES:1216 12729 #, kde-format 12730 msgid "Europe/Simferopol" 12731 msgstr "Европа/Симферопол" 12732 12733 #. i18n: comment to the previous timezone 12734 #: kdecore/TIMEZONES:1218 12735 #, kde-format 12736 msgid "central Crimea" 12737 msgstr "" 12738 12739 #. i18n: comment to the previous timezone 12740 #: kdecore/TIMEZONES:1220 12741 #, fuzzy, kde-format 12742 #| msgid "Prime: " 12743 msgid "Crimea" 12744 msgstr "Прост број:" 12745 12746 #: kdecore/TIMEZONES:1221 12747 #, kde-format 12748 msgid "Europe/Skopje" 12749 msgstr "Европа/Скопје" 12750 12751 #: kdecore/TIMEZONES:1222 12752 #, kde-format 12753 msgid "Europe/Sofia" 12754 msgstr "Европа/Софија" 12755 12756 #: kdecore/TIMEZONES:1223 12757 #, kde-format 12758 msgid "Europe/Stockholm" 12759 msgstr "Европа/Стокхолм" 12760 12761 #: kdecore/TIMEZONES:1224 12762 #, kde-format 12763 msgid "Europe/Tallinn" 12764 msgstr "Европа/Талин" 12765 12766 #: kdecore/TIMEZONES:1225 12767 #, kde-format 12768 msgid "Europe/Tirane" 12769 msgstr "Европа/Тирана" 12770 12771 #: kdecore/TIMEZONES:1226 12772 #, fuzzy, kde-format 12773 #| msgid "Europe/Tirane" 12774 msgid "Europe/Tiraspol" 12775 msgstr "Европа/Тирана" 12776 12777 #: kdecore/TIMEZONES:1227 12778 #, fuzzy, kde-format 12779 #| msgid "Europe/Minsk" 12780 msgid "Europe/Ulyanovsk" 12781 msgstr "Европа/Минск" 12782 12783 #. i18n: comment to the previous timezone 12784 #: kdecore/TIMEZONES:1229 12785 #, kde-format 12786 msgid "MSK+01 - Ulyanovsk" 12787 msgstr "" 12788 12789 #: kdecore/TIMEZONES:1230 12790 #, kde-format 12791 msgid "Europe/Uzhgorod" 12792 msgstr "Европа/Ужгород" 12793 12794 #. i18n: comment to the previous timezone 12795 #: kdecore/TIMEZONES:1232 12796 #, kde-format 12797 msgid "Ruthenia" 12798 msgstr "" 12799 12800 #. i18n: comment to the previous timezone 12801 #: kdecore/TIMEZONES:1234 12802 #, kde-format 12803 msgid "Transcarpathia" 12804 msgstr "" 12805 12806 #: kdecore/TIMEZONES:1235 12807 #, kde-format 12808 msgid "Europe/Vaduz" 12809 msgstr "Европа/Вадуз" 12810 12811 #: kdecore/TIMEZONES:1236 12812 #, kde-format 12813 msgid "Europe/Vatican" 12814 msgstr "Европа/Ватикан" 12815 12816 #: kdecore/TIMEZONES:1237 12817 #, kde-format 12818 msgid "Europe/Vienna" 12819 msgstr "Европа/Виена" 12820 12821 #: kdecore/TIMEZONES:1238 12822 #, kde-format 12823 msgid "Europe/Vilnius" 12824 msgstr "Европа/Вилниус" 12825 12826 #: kdecore/TIMEZONES:1239 12827 #, kde-format 12828 msgid "Europe/Volgograd" 12829 msgstr "Европа/Волгоград" 12830 12831 #. i18n: comment to the previous timezone 12832 #: kdecore/TIMEZONES:1241 12833 #, kde-format 12834 msgid "Moscow+00 - Caspian Sea" 12835 msgstr "" 12836 12837 #. i18n: comment to the previous timezone 12838 #: kdecore/TIMEZONES:1243 12839 #, kde-format 12840 msgid "MSK+00 - Volgograd" 12841 msgstr "" 12842 12843 #: kdecore/TIMEZONES:1244 12844 #, kde-format 12845 msgid "Europe/Warsaw" 12846 msgstr "Европа/Варшава" 12847 12848 #: kdecore/TIMEZONES:1245 12849 #, kde-format 12850 msgid "Europe/Zagreb" 12851 msgstr "Европа/Загреб" 12852 12853 #: kdecore/TIMEZONES:1246 12854 #, kde-format 12855 msgid "Europe/Zaporozhye" 12856 msgstr "Европа/Запорожје" 12857 12858 #. i18n: comment to the previous timezone 12859 #: kdecore/TIMEZONES:1248 12860 #, kde-format 12861 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12862 msgstr "" 12863 12864 #. i18n: comment to the previous timezone 12865 #: kdecore/TIMEZONES:1250 12866 #, kde-format 12867 msgid "Zaporozhye and east Lugansk" 12868 msgstr "" 12869 12870 #: kdecore/TIMEZONES:1251 12871 #, kde-format 12872 msgid "Europe/Zurich" 12873 msgstr "Европа/Цирих" 12874 12875 #: kdecore/TIMEZONES:1252 12876 #, kde-format 12877 msgid "GB" 12878 msgstr "" 12879 12880 #: kdecore/TIMEZONES:1253 12881 #, kde-format 12882 msgid "GB-Eire" 12883 msgstr "" 12884 12885 #: kdecore/TIMEZONES:1254 12886 #, fuzzy, kde-format 12887 #| msgid "Asia/Hong_Kong" 12888 msgid "Hongkong" 12889 msgstr "Азија/Хонг_Конг" 12890 12891 #: kdecore/TIMEZONES:1255 12892 #, kde-format 12893 msgid "Iceland" 12894 msgstr "" 12895 12896 #: kdecore/TIMEZONES:1256 12897 #, kde-format 12898 msgid "Indian/Antananarivo" 12899 msgstr "Индија/Тананариве" 12900 12901 #: kdecore/TIMEZONES:1257 12902 #, kde-format 12903 msgid "Indian/Chagos" 12904 msgstr "Индија/Чагос" 12905 12906 #: kdecore/TIMEZONES:1258 12907 #, kde-format 12908 msgid "Indian/Christmas" 12909 msgstr "Индија/Крисмас" 12910 12911 #: kdecore/TIMEZONES:1259 12912 #, kde-format 12913 msgid "Indian/Cocos" 12914 msgstr "Индија/Кокос" 12915 12916 #: kdecore/TIMEZONES:1260 12917 #, kde-format 12918 msgid "Indian/Comoro" 12919 msgstr "Индија/Комори" 12920 12921 #: kdecore/TIMEZONES:1261 12922 #, kde-format 12923 msgid "Indian/Kerguelen" 12924 msgstr "Индија/Кергелен" 12925 12926 #: kdecore/TIMEZONES:1262 12927 #, kde-format 12928 msgid "Indian/Mahe" 12929 msgstr "Индија/Махе" 12930 12931 #: kdecore/TIMEZONES:1263 12932 #, kde-format 12933 msgid "Indian/Maldives" 12934 msgstr "Индија/Малдиви" 12935 12936 #: kdecore/TIMEZONES:1264 12937 #, kde-format 12938 msgid "Indian/Mauritius" 12939 msgstr "Индија/Маврициус" 12940 12941 #: kdecore/TIMEZONES:1265 12942 #, kde-format 12943 msgid "Indian/Mayotte" 12944 msgstr "Индија/Мајот" 12945 12946 #: kdecore/TIMEZONES:1266 12947 #, kde-format 12948 msgid "Indian/Reunion" 12949 msgstr "Индија/Реинион" 12950 12951 #: kdecore/TIMEZONES:1267 12952 #, kde-format 12953 msgid "Iran" 12954 msgstr "" 12955 12956 #: kdecore/TIMEZONES:1268 12957 #, fuzzy, kde-format 12958 #| msgid "Pacific/Kosrae" 12959 msgid "Israel" 12960 msgstr "Пацифик/Косрае" 12961 12962 #: kdecore/TIMEZONES:1269 12963 #, fuzzy, kde-format 12964 #| msgid "America/Jamaica" 12965 msgid "Jamaica" 12966 msgstr "Америка/Јамајка" 12967 12968 #: kdecore/TIMEZONES:1270 12969 #, kde-format 12970 msgid "Japan" 12971 msgstr "" 12972 12973 #. i18n: comment to the previous timezone 12974 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12975 #, fuzzy, kde-format 12976 #| msgid "Pacific/Kwajalein" 12977 msgid "Kwajalein" 12978 msgstr "Пацифик/Кваџелин" 12979 12980 #: kdecore/TIMEZONES:1274 12981 #, kde-format 12982 msgid "Libya" 12983 msgstr "" 12984 12985 #: kdecore/TIMEZONES:1275 12986 #, kde-format 12987 msgid "Mexico/BajaNorte" 12988 msgstr "" 12989 12990 #: kdecore/TIMEZONES:1278 12991 #, kde-format 12992 msgid "Mexico/BajaSur" 12993 msgstr "" 12994 12995 #: kdecore/TIMEZONES:1281 12996 #, kde-format 12997 msgid "Mexico/General" 12998 msgstr "" 12999 13000 #: kdecore/TIMEZONES:1284 13001 #, kde-format 13002 msgid "NZ" 13003 msgstr "" 13004 13005 #: kdecore/TIMEZONES:1287 13006 #, kde-format 13007 msgid "NZ-CHAT" 13008 msgstr "" 13009 13010 #. i18n: comment to the previous timezone 13011 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 13012 #, kde-format 13013 msgid "Chatham Islands" 13014 msgstr "" 13015 13016 #: kdecore/TIMEZONES:1290 13017 #, kde-format 13018 msgid "Navajo" 13019 msgstr "" 13020 13021 #: kdecore/TIMEZONES:1293 13022 #, kde-format 13023 msgid "PRC" 13024 msgstr "" 13025 13026 #: kdecore/TIMEZONES:1296 13027 #, kde-format 13028 msgid "Pacific/Apia" 13029 msgstr "Пацифик/Апиа" 13030 13031 #: kdecore/TIMEZONES:1297 13032 #, kde-format 13033 msgid "Pacific/Auckland" 13034 msgstr "Пацифик/Окланд" 13035 13036 #. i18n: comment to the previous timezone 13037 #: kdecore/TIMEZONES:1301 13038 #, kde-format 13039 msgid "New Zealand (most areas)" 13040 msgstr "" 13041 13042 #: kdecore/TIMEZONES:1302 13043 #, fuzzy, kde-format 13044 #| msgid "Pacific/Honolulu" 13045 msgid "Pacific/Bougainville" 13046 msgstr "Пацифик/Хонолулу" 13047 13048 #. i18n: comment to the previous timezone 13049 #: kdecore/TIMEZONES:1304 13050 #, kde-format 13051 msgid "Bougainville" 13052 msgstr "" 13053 13054 #: kdecore/TIMEZONES:1305 13055 #, kde-format 13056 msgid "Pacific/Chatham" 13057 msgstr "Пацифик/Чатам" 13058 13059 #: kdecore/TIMEZONES:1308 13060 #, fuzzy, kde-format 13061 #| msgid "Pacific/Truk" 13062 msgid "Pacific/Chuuk" 13063 msgstr "Пацифик/Трук" 13064 13065 #. i18n: comment to the previous timezone 13066 #: kdecore/TIMEZONES:1310 13067 #, kde-format 13068 msgid "Chuuk (Truk) and Yap" 13069 msgstr "" 13070 13071 #. i18n: comment to the previous timezone 13072 #: kdecore/TIMEZONES:1312 13073 #, kde-format 13074 msgid "Chuuk/Truk, Yap" 13075 msgstr "" 13076 13077 #: kdecore/TIMEZONES:1313 13078 #, kde-format 13079 msgid "Pacific/Easter" 13080 msgstr "Пацифик/Истер" 13081 13082 #. i18n: comment to the previous timezone 13083 #: kdecore/TIMEZONES:1317 13084 #, fuzzy, kde-format 13085 #| msgctxt "digit set" 13086 #| msgid "Eastern Arabic-Indic" 13087 msgid "Easter Island" 13088 msgstr "Источен арапски-индиски" 13089 13090 #: kdecore/TIMEZONES:1318 13091 #, kde-format 13092 msgid "Pacific/Efate" 13093 msgstr "Пацифик/Ефејт" 13094 13095 #: kdecore/TIMEZONES:1319 13096 #, kde-format 13097 msgid "Pacific/Enderbury" 13098 msgstr "Пацифик/Ендербери" 13099 13100 #. i18n: comment to the previous timezone 13101 #: kdecore/TIMEZONES:1321 13102 #, kde-format 13103 msgid "Phoenix Islands" 13104 msgstr "" 13105 13106 #: kdecore/TIMEZONES:1322 13107 #, kde-format 13108 msgid "Pacific/Fakaofo" 13109 msgstr "Пацифик/Факаофо" 13110 13111 #: kdecore/TIMEZONES:1323 13112 #, kde-format 13113 msgid "Pacific/Fiji" 13114 msgstr "Пацифик/Фиџи" 13115 13116 #: kdecore/TIMEZONES:1324 13117 #, kde-format 13118 msgid "Pacific/Funafuti" 13119 msgstr "Пацифик/Фунафути" 13120 13121 #: kdecore/TIMEZONES:1325 13122 #, kde-format 13123 msgid "Pacific/Galapagos" 13124 msgstr "Пацифик/Галапагос" 13125 13126 #. i18n: comment to the previous timezone 13127 #: kdecore/TIMEZONES:1327 13128 #, kde-format 13129 msgid "Galapagos Islands" 13130 msgstr "" 13131 13132 #: kdecore/TIMEZONES:1328 13133 #, kde-format 13134 msgid "Pacific/Gambier" 13135 msgstr "Пацифик/Гамбиер" 13136 13137 #. i18n: comment to the previous timezone 13138 #: kdecore/TIMEZONES:1330 13139 #, kde-format 13140 msgid "Gambier Islands" 13141 msgstr "" 13142 13143 #: kdecore/TIMEZONES:1331 13144 #, kde-format 13145 msgid "Pacific/Guadalcanal" 13146 msgstr "Пацифик/Гвадалканал" 13147 13148 #: kdecore/TIMEZONES:1332 13149 #, kde-format 13150 msgid "Pacific/Guam" 13151 msgstr "Пацифик/Гуам" 13152 13153 #: kdecore/TIMEZONES:1333 13154 #, kde-format 13155 msgid "Pacific/Honolulu" 13156 msgstr "Пацифик/Хонолулу" 13157 13158 #. i18n: comment to the previous timezone 13159 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13160 #, kde-format 13161 msgid "Hawaii" 13162 msgstr "" 13163 13164 #: kdecore/TIMEZONES:1336 13165 #, kde-format 13166 msgid "Pacific/Johnston" 13167 msgstr "Пацифик/Џонстон" 13168 13169 #. i18n: comment to the previous timezone 13170 #: kdecore/TIMEZONES:1338 13171 #, kde-format 13172 msgid "Johnston Atoll" 13173 msgstr "" 13174 13175 #: kdecore/TIMEZONES:1339 13176 #, kde-format 13177 msgid "Pacific/Kiritimati" 13178 msgstr "Пацифик/Киритимати" 13179 13180 #. i18n: comment to the previous timezone 13181 #: kdecore/TIMEZONES:1341 13182 #, kde-format 13183 msgid "Line Islands" 13184 msgstr "" 13185 13186 #: kdecore/TIMEZONES:1342 13187 #, kde-format 13188 msgid "Pacific/Kosrae" 13189 msgstr "Пацифик/Косрае" 13190 13191 #. i18n: comment to the previous timezone 13192 #: kdecore/TIMEZONES:1344 13193 #, fuzzy, kde-format 13194 #| msgid "Pacific/Kosrae" 13195 msgid "Kosrae" 13196 msgstr "Пацифик/Косрае" 13197 13198 #: kdecore/TIMEZONES:1345 13199 #, kde-format 13200 msgid "Pacific/Kwajalein" 13201 msgstr "Пацифик/Кваџелин" 13202 13203 #: kdecore/TIMEZONES:1348 13204 #, kde-format 13205 msgid "Pacific/Majuro" 13206 msgstr "Пацифик/Махуро" 13207 13208 #. i18n: comment to the previous timezone 13209 #: kdecore/TIMEZONES:1352 13210 #, kde-format 13211 msgid "Marshall Islands (most areas)" 13212 msgstr "" 13213 13214 #: kdecore/TIMEZONES:1353 13215 #, kde-format 13216 msgid "Pacific/Marquesas" 13217 msgstr "Пацифик/Маркесас" 13218 13219 #. i18n: comment to the previous timezone 13220 #: kdecore/TIMEZONES:1355 13221 #, kde-format 13222 msgid "Marquesas Islands" 13223 msgstr "" 13224 13225 #: kdecore/TIMEZONES:1356 13226 #, kde-format 13227 msgid "Pacific/Midway" 13228 msgstr "Пацифик/Мидвеј" 13229 13230 #. i18n: comment to the previous timezone 13231 #: kdecore/TIMEZONES:1358 13232 #, kde-format 13233 msgid "Midway Islands" 13234 msgstr "" 13235 13236 #: kdecore/TIMEZONES:1359 13237 #, kde-format 13238 msgid "Pacific/Nauru" 13239 msgstr "Пацифик/Науру" 13240 13241 #: kdecore/TIMEZONES:1360 13242 #, kde-format 13243 msgid "Pacific/Niue" 13244 msgstr "Пацифик/Ниуе" 13245 13246 #: kdecore/TIMEZONES:1361 13247 #, kde-format 13248 msgid "Pacific/Norfolk" 13249 msgstr "Пацифик/Норфолк" 13250 13251 #: kdecore/TIMEZONES:1362 13252 #, kde-format 13253 msgid "Pacific/Noumea" 13254 msgstr "Пацифик/Нумеа" 13255 13256 #: kdecore/TIMEZONES:1363 13257 #, kde-format 13258 msgid "Pacific/Pago_Pago" 13259 msgstr "Пацифик/Паго_Паго" 13260 13261 #: kdecore/TIMEZONES:1364 13262 #, kde-format 13263 msgid "Pacific/Palau" 13264 msgstr "Пацифик/Палау" 13265 13266 #: kdecore/TIMEZONES:1365 13267 #, kde-format 13268 msgid "Pacific/Pitcairn" 13269 msgstr "Пацифик/Питкерн" 13270 13271 #: kdecore/TIMEZONES:1366 13272 #, fuzzy, kde-format 13273 #| msgid "Pacific/Ponape" 13274 msgid "Pacific/Pohnpei" 13275 msgstr "Пацифик/Понапе" 13276 13277 #. i18n: comment to the previous timezone 13278 #: kdecore/TIMEZONES:1368 13279 #, kde-format 13280 msgid "Pohnpei (Ponape)" 13281 msgstr "" 13282 13283 #. i18n: comment to the previous timezone 13284 #: kdecore/TIMEZONES:1370 13285 #, fuzzy, kde-format 13286 #| msgid "Pacific/Ponape" 13287 msgid "Pohnpei/Ponape" 13288 msgstr "Пацифик/Понапе" 13289 13290 #: kdecore/TIMEZONES:1371 13291 #, kde-format 13292 msgid "Pacific/Ponape" 13293 msgstr "Пацифик/Понапе" 13294 13295 #. i18n: comment to the previous timezone 13296 #: kdecore/TIMEZONES:1373 13297 #, kde-format 13298 msgid "Ponape (Pohnpei)" 13299 msgstr "" 13300 13301 #: kdecore/TIMEZONES:1374 13302 #, kde-format 13303 msgid "Pacific/Port_Moresby" 13304 msgstr "Пацифик/Порт_Морсби" 13305 13306 #. i18n: comment to the previous timezone 13307 #: kdecore/TIMEZONES:1376 13308 #, kde-format 13309 msgid "Papua New Guinea (most areas)" 13310 msgstr "" 13311 13312 #: kdecore/TIMEZONES:1377 13313 #, kde-format 13314 msgid "Pacific/Rarotonga" 13315 msgstr "Пацифик/Раротонга" 13316 13317 #: kdecore/TIMEZONES:1378 13318 #, kde-format 13319 msgid "Pacific/Saipan" 13320 msgstr "Пацифик/Сајпан" 13321 13322 #: kdecore/TIMEZONES:1379 13323 #, fuzzy, kde-format 13324 #| msgid "Pacific/Saipan" 13325 msgid "Pacific/Samoa" 13326 msgstr "Пацифик/Сајпан" 13327 13328 #: kdecore/TIMEZONES:1380 13329 #, kde-format 13330 msgid "Pacific/Tahiti" 13331 msgstr "Пацифик/Тахити" 13332 13333 #. i18n: comment to the previous timezone 13334 #: kdecore/TIMEZONES:1382 13335 #, kde-format 13336 msgid "Society Islands" 13337 msgstr "" 13338 13339 #: kdecore/TIMEZONES:1383 13340 #, kde-format 13341 msgid "Pacific/Tarawa" 13342 msgstr "Пацифик/Тарава" 13343 13344 #. i18n: comment to the previous timezone 13345 #: kdecore/TIMEZONES:1385 13346 #, kde-format 13347 msgid "Gilbert Islands" 13348 msgstr "" 13349 13350 #: kdecore/TIMEZONES:1386 13351 #, kde-format 13352 msgid "Pacific/Tongatapu" 13353 msgstr "Пацифик/Тонгатапу" 13354 13355 #: kdecore/TIMEZONES:1387 13356 #, kde-format 13357 msgid "Pacific/Truk" 13358 msgstr "Пацифик/Трук" 13359 13360 #. i18n: comment to the previous timezone 13361 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13362 #, kde-format 13363 msgid "Truk (Chuuk) and Yap" 13364 msgstr "" 13365 13366 #: kdecore/TIMEZONES:1390 13367 #, kde-format 13368 msgid "Pacific/Wake" 13369 msgstr "Пацифик/Вејк" 13370 13371 #. i18n: comment to the previous timezone 13372 #: kdecore/TIMEZONES:1392 13373 #, kde-format 13374 msgid "Wake Island" 13375 msgstr "" 13376 13377 #: kdecore/TIMEZONES:1393 13378 #, kde-format 13379 msgid "Pacific/Wallis" 13380 msgstr "Пацифик/Валис" 13381 13382 #: kdecore/TIMEZONES:1394 13383 #, kde-format 13384 msgid "Pacific/Yap" 13385 msgstr "Пацифик/Јап" 13386 13387 #: kdecore/TIMEZONES:1397 13388 #, kde-format 13389 msgid "Poland" 13390 msgstr "" 13391 13392 #: kdecore/TIMEZONES:1398 13393 #, kde-format 13394 msgid "Portugal" 13395 msgstr "" 13396 13397 #: kdecore/TIMEZONES:1401 13398 #, kde-format 13399 msgid "ROC" 13400 msgstr "" 13401 13402 #: kdecore/TIMEZONES:1402 13403 #, kde-format 13404 msgid "ROK" 13405 msgstr "" 13406 13407 #: kdecore/TIMEZONES:1403 13408 #, fuzzy, kde-format 13409 #| msgid "Asia/Singapore" 13410 msgid "Singapore" 13411 msgstr "Азија/Сингапур" 13412 13413 #: kdecore/TIMEZONES:1404 13414 #, kde-format 13415 msgid "Turkey" 13416 msgstr "" 13417 13418 #: kdecore/TIMEZONES:1405 13419 #, kde-format 13420 msgid "US/Alaska" 13421 msgstr "" 13422 13423 #: kdecore/TIMEZONES:1408 13424 #, kde-format 13425 msgid "US/Aleutian" 13426 msgstr "" 13427 13428 #: kdecore/TIMEZONES:1411 13429 #, kde-format 13430 msgid "US/Arizona" 13431 msgstr "" 13432 13433 #: kdecore/TIMEZONES:1414 13434 #, kde-format 13435 msgid "US/Central" 13436 msgstr "" 13437 13438 #: kdecore/TIMEZONES:1417 13439 #, kde-format 13440 msgid "US/East-Indiana" 13441 msgstr "" 13442 13443 #: kdecore/TIMEZONES:1420 13444 #, kde-format 13445 msgid "US/Eastern" 13446 msgstr "" 13447 13448 #: kdecore/TIMEZONES:1423 13449 #, kde-format 13450 msgid "US/Hawaii" 13451 msgstr "" 13452 13453 #: kdecore/TIMEZONES:1426 13454 #, kde-format 13455 msgid "US/Indiana-Starke" 13456 msgstr "" 13457 13458 #: kdecore/TIMEZONES:1429 13459 #, kde-format 13460 msgid "US/Michigan" 13461 msgstr "" 13462 13463 #: kdecore/TIMEZONES:1432 13464 #, kde-format 13465 msgid "US/Mountain" 13466 msgstr "" 13467 13468 #: kdecore/TIMEZONES:1435 13469 #, fuzzy, kde-format 13470 #| msgid "Pacific/Yap" 13471 msgid "US/Pacific" 13472 msgstr "Пацифик/Јап" 13473 13474 #: kdecore/TIMEZONES:1438 13475 #, kde-format 13476 msgid "US/Samoa" 13477 msgstr "" 13478 13479 #: kdecore/TIMEZONES:1439 13480 #, kde-format 13481 msgid "W-SU" 13482 msgstr "" 13483 13484 #. i18n: Generic sans serif font presented in font choosers. When selected, 13485 #. the system will choose a real font, mandated by distro settings. 13486 #: kdeui/fonthelpers.cpp:29 13487 #, kde-format 13488 msgctxt "@item Font name" 13489 msgid "Sans Serif" 13490 msgstr "Sans Serif" 13491 13492 #. i18n: Generic serif font presented in font choosers. When selected, 13493 #. the system will choose a real font, mandated by distro settings. 13494 #: kdeui/fonthelpers.cpp:32 13495 #, kde-format 13496 msgctxt "@item Font name" 13497 msgid "Serif" 13498 msgstr "Serif" 13499 13500 #. i18n: Generic monospace font presented in font choosers. When selected, 13501 #. the system will choose a real font, mandated by distro settings. 13502 #: kdeui/fonthelpers.cpp:35 13503 #, kde-format 13504 msgctxt "@item Font name" 13505 msgid "Monospace" 13506 msgstr "" 13507 13508 #: kdeui/k4timezonewidget.cpp:62 13509 #, kde-format 13510 msgctxt "Define an area in the time zone, like a town area" 13511 msgid "Area" 13512 msgstr "Област" 13513 13514 #: kdeui/k4timezonewidget.cpp:62 13515 #, kde-format 13516 msgctxt "Time zone" 13517 msgid "Region" 13518 msgstr "Регион" 13519 13520 #: kdeui/k4timezonewidget.cpp:62 13521 #, fuzzy, kde-format 13522 msgid "Comment" 13523 msgstr "Коментар" 13524 13525 #: kdeui/kapplication.cpp:741 13526 #, kde-format 13527 msgid "The style '%1' was not found" 13528 msgstr "Стилот „%1“ не беше пронајден" 13529 13530 #: kdeui/kcolordialog.cpp:102 13531 #, kde-format 13532 msgctxt "palette name" 13533 msgid "* Recent Colors *" 13534 msgstr "* Последни бои *" 13535 13536 #: kdeui/kcolordialog.cpp:103 13537 #, kde-format 13538 msgctxt "palette name" 13539 msgid "* Custom Colors *" 13540 msgstr "* Ваши бои *" 13541 13542 #: kdeui/kcolordialog.cpp:104 13543 #, kde-format 13544 msgctxt "palette name" 13545 msgid "Forty Colors" 13546 msgstr "Четириесет бои" 13547 13548 #: kdeui/kcolordialog.cpp:105 13549 #, kde-format 13550 msgctxt "palette name" 13551 msgid "Oxygen Colors" 13552 msgstr "Бои на Оксиген" 13553 13554 #: kdeui/kcolordialog.cpp:106 13555 #, kde-format 13556 msgctxt "palette name" 13557 msgid "Rainbow Colors" 13558 msgstr "Бои на виножито" 13559 13560 #: kdeui/kcolordialog.cpp:107 13561 #, kde-format 13562 msgctxt "palette name" 13563 msgid "Royal Colors" 13564 msgstr "Кралски бои" 13565 13566 #: kdeui/kcolordialog.cpp:108 13567 #, kde-format 13568 msgctxt "palette name" 13569 msgid "Web Colors" 13570 msgstr "Бои за веб" 13571 13572 #: kdeui/kcolordialog.cpp:572 13573 #, kde-format 13574 msgid "Named Colors" 13575 msgstr "Именувани бои" 13576 13577 #: kdeui/kcolordialog.cpp:746 13578 #, kde-format 13579 msgctxt "" 13580 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13581 "them)" 13582 msgid "" 13583 "Unable to read X11 RGB color strings. The following file location was " 13584 "examined:\n" 13585 "%2" 13586 msgid_plural "" 13587 "Unable to read X11 RGB color strings. The following file locations were " 13588 "examined:\n" 13589 "%2" 13590 msgstr[0] "" 13591 msgstr[1] "" 13592 msgstr[2] "" 13593 13594 #: kdeui/kcolordialog.cpp:997 13595 #, kde-format 13596 msgid "Select Color" 13597 msgstr "Избери боја" 13598 13599 #: kdeui/kcolordialog.cpp:1077 13600 #, kde-format 13601 msgid "Hue:" 13602 msgstr "Нијанси:" 13603 13604 #: kdeui/kcolordialog.cpp:1083 13605 #, kde-format 13606 msgctxt "The angular degree unit (for hue)" 13607 msgid "°" 13608 msgstr "" 13609 13610 #: kdeui/kcolordialog.cpp:1088 13611 #, fuzzy, kde-format 13612 #| msgid "Saturday" 13613 msgid "Saturation:" 13614 msgstr "сабота" 13615 13616 #: kdeui/kcolordialog.cpp:1098 13617 #, kde-format 13618 msgctxt "This is the V of HSV" 13619 msgid "Value:" 13620 msgstr "Вредност:" 13621 13622 #: kdeui/kcolordialog.cpp:1111 13623 #, kde-format 13624 msgid "Red:" 13625 msgstr "Црвена:" 13626 13627 #: kdeui/kcolordialog.cpp:1121 13628 #, kde-format 13629 msgid "Green:" 13630 msgstr "Зелена:" 13631 13632 #: kdeui/kcolordialog.cpp:1131 13633 #, kde-format 13634 msgid "Blue:" 13635 msgstr "Сина:" 13636 13637 #: kdeui/kcolordialog.cpp:1152 13638 #, kde-format 13639 msgid "Alpha:" 13640 msgstr "" 13641 13642 #: kdeui/kcolordialog.cpp:1206 13643 #, kde-format 13644 msgid "&Add to Custom Colors" 13645 msgstr "&Додајте кај вашите бои" 13646 13647 #: kdeui/kcolordialog.cpp:1234 13648 #, kde-format 13649 msgid "Name:" 13650 msgstr "Име:" 13651 13652 #: kdeui/kcolordialog.cpp:1241 13653 #, kde-format 13654 msgid "HTML:" 13655 msgstr "HTML:" 13656 13657 #: kdeui/kcolordialog.cpp:1328 13658 #, kde-format 13659 msgid "Default color" 13660 msgstr "Стандардна боја" 13661 13662 #: kdeui/kcolordialog.cpp:1393 13663 #, kde-format 13664 msgid "-default-" 13665 msgstr "-стандардно-" 13666 13667 #: kdeui/kcolordialog.cpp:1668 13668 #, kde-format 13669 msgid "-unnamed-" 13670 msgstr "-неименувано-" 13671 13672 #: kdeui/kdeprintdialog.cpp:40 13673 #, kde-format 13674 msgctxt "@title:window" 13675 msgid "Print" 13676 msgstr "Печатење" 13677 13678 #: kdeui/kdialog.cpp:271 13679 #, kde-format 13680 msgid "&Try" 13681 msgstr "П&робај" 13682 13683 #: kdeui/kdialog.cpp:484 13684 #, kde-format 13685 msgid "modified" 13686 msgstr "изменето" 13687 13688 #: kdeui/kdialog.cpp:495 13689 #, kde-format 13690 msgctxt "Document/application separator in titlebar" 13691 msgid " – " 13692 msgstr " – " 13693 13694 #: kdeui/kdialog.cpp:896 13695 #, kde-format 13696 msgid "&Details" 13697 msgstr "&Детали" 13698 13699 #: kdeui/kdialog.cpp:1054 13700 #, kde-format 13701 msgid "Get help..." 13702 msgstr "Помош..." 13703 13704 #: kdeui/keditlistbox.cpp:324 13705 #, kde-format 13706 msgid "&Add" 13707 msgstr "&Додај" 13708 13709 #: kdeui/keditlistbox.cpp:336 13710 #, kde-format 13711 msgid "&Remove" 13712 msgstr "О&тстрани" 13713 13714 #: kdeui/keditlistbox.cpp:348 13715 #, kde-format 13716 msgid "Move &Up" 13717 msgstr "Помести &горе" 13718 13719 #: kdeui/keditlistbox.cpp:353 13720 #, kde-format 13721 msgid "Move &Down" 13722 msgstr "Помести &долу" 13723 13724 #. i18n: A shorter version of the alphabet test phrase translated in 13725 #. another message. It is displayed in the dropdown list of font previews 13726 #. (the font selection combo box), so keep it under the length equivalent 13727 #. to 60 or so proportional Latin characters. 13728 #: kdeui/kfontcombobox.cpp:48 13729 #, fuzzy, kde-format 13730 #| msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13731 msgctxt "short" 13732 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13733 msgstr "АБВГДЃЕЖЗЅИЈКЛЉМНЊОПРСТЌУФХЦЧЏШ абвгдѓежзѕијклљмнњопрстќуфхцчџш" 13734 13735 #. i18n: Integer which indicates the script you used in the sample text 13736 #. for font previews in your language. For the possible values, see 13737 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13738 #. If the sample text contains several scripts, their IDs can be given 13739 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13740 #: kdeui/kfontcombobox.cpp:119 13741 #, kde-format 13742 msgctxt "Numeric IDs of scripts for font previews" 13743 msgid "1" 13744 msgstr "1" 13745 13746 #: kdeui/kfontdialog.cpp:51 13747 #, kde-format 13748 msgid "Select Font" 13749 msgstr "Избери фонт" 13750 13751 #: kdeui/kprintpreview.cpp:118 13752 #, kde-format 13753 msgid "Could not load print preview part" 13754 msgstr "Не можам да го вчитам делот за преглед на печатење" 13755 13756 #: kdeui/kprintpreview.cpp:135 13757 #, kde-format 13758 msgid "Print Preview" 13759 msgstr "Преглед на печатење" 13760 13761 #: kdeui/ksystemtrayicon.cpp:153 13762 #, kde-format 13763 msgid "Minimize" 13764 msgstr "Спушти" 13765 13766 #: kdeui/ksystemtrayicon.cpp:205 13767 #, kde-format 13768 msgid "&Minimize" 13769 msgstr "&Спушти" 13770 13771 #: kdeui/ksystemtrayicon.cpp:207 13772 #, kde-format 13773 msgid "&Restore" 13774 msgstr "&Врати" 13775 13776 #: kdeui/ksystemtrayicon.cpp:226 13777 #, kde-format 13778 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13779 msgstr "<qt>Дали навистина сакате да ја напуштите <b>%1</b>?</qt>" 13780 13781 #: kdeui/ksystemtrayicon.cpp:229 13782 #, kde-format 13783 msgid "Confirm Quit From System Tray" 13784 msgstr "Потврда за напуштање од системската лента" 13785 13786 #: kdeui/kundostack.cpp:47 13787 #, kde-format 13788 msgid "Redo" 13789 msgstr "Повтори" 13790 13791 #: kdeui/kundostack.cpp:66 13792 #, kde-format 13793 msgid "Undo" 13794 msgstr "Врати" 13795 13796 #: kdeui/kuniqueapplication.cpp:79 13797 #, kde-format 13798 msgid "Do not run in the background." 13799 msgstr "Не се извршува во заднина." 13800 13801 #: kdeui/kuniqueapplication.cpp:81 13802 #, kde-format 13803 msgid "Internally added if launched from Finder" 13804 msgstr "Се додава внатрешно ако е стартувано од Finder" 13805 13806 #: kio/kcommentwidget.cpp:68 13807 #, fuzzy, kde-format 13808 #| msgid "Add Entry..." 13809 msgctxt "@label" 13810 msgid "Add Comment..." 13811 msgstr "Додај елемент..." 13812 13813 #: kio/kcommentwidget.cpp:74 13814 #, fuzzy, kde-format 13815 #| msgid "Change &Icon..." 13816 msgctxt "@label" 13817 msgid "Change..." 13818 msgstr "Измени &икона..." 13819 13820 #: kio/kcommentwidget.cpp:128 13821 #, fuzzy, kde-format 13822 #| msgid "Comment" 13823 msgctxt "@title:window" 13824 msgid "Change Comment" 13825 msgstr "Коментар" 13826 13827 #: kio/kcommentwidget.cpp:129 13828 #, fuzzy, kde-format 13829 #| msgid "Comment" 13830 msgctxt "@title:window" 13831 msgid "Add Comment" 13832 msgstr "Коментар" 13833 13834 #: kio/kdevicelistmodel.cpp:115 13835 #, kde-format 13836 msgid "Device name" 13837 msgstr "Име на уред" 13838 13839 #: kio/kdirselectdialog.cpp:136 13840 #, kde-format 13841 msgctxt "folder name" 13842 msgid "New Folder" 13843 msgstr "Нова папка" 13844 13845 #: kio/kdirselectdialog.cpp:141 13846 #, kde-format 13847 msgctxt "@title:window" 13848 msgid "New Folder" 13849 msgstr "Нова папка" 13850 13851 #: kio/kdirselectdialog.cpp:142 13852 #, kde-format 13853 msgctxt "@label:textbox" 13854 msgid "" 13855 "Create new folder in:\n" 13856 "%1" 13857 msgstr "" 13858 "Креирање нова папка во:\n" 13859 "%1" 13860 13861 #: kio/kdirselectdialog.cpp:172 13862 #, kde-format 13863 msgid "A file or folder named %1 already exists." 13864 msgstr "Веќе постои датотека или папка со име %1." 13865 13866 #: kio/kdirselectdialog.cpp:175 13867 #, kde-format 13868 msgid "You do not have permission to create that folder." 13869 msgstr "Немате дозволи за создавање на таа папка." 13870 13871 #: kio/kdirselectdialog.cpp:290 13872 #, kde-format 13873 msgctxt "@title:window" 13874 msgid "Select Folder" 13875 msgstr "Избор на папка" 13876 13877 #: kio/kdirselectdialog.cpp:299 13878 #, kde-format 13879 msgctxt "@action:button" 13880 msgid "New Folder..." 13881 msgstr "Нова папка..." 13882 13883 #: kio/kdirselectdialog.cpp:345 13884 #, kde-format 13885 msgctxt "@action:inmenu" 13886 msgid "New Folder..." 13887 msgstr "Нова папка..." 13888 13889 #: kio/kdirselectdialog.cpp:352 13890 #, fuzzy, kde-format 13891 #| msgid "Move to Trash" 13892 msgctxt "@action:inmenu" 13893 msgid "Move to Trash" 13894 msgstr "Преместување во корпа" 13895 13896 #: kio/kdirselectdialog.cpp:359 13897 #, kde-format 13898 msgctxt "@action:inmenu" 13899 msgid "Delete" 13900 msgstr "Избриши" 13901 13902 #: kio/kdirselectdialog.cpp:368 13903 #, kde-format 13904 msgctxt "@option:check" 13905 msgid "Show Hidden Folders" 13906 msgstr "Покажи скриени папки" 13907 13908 #: kio/kdirselectdialog.cpp:375 13909 #, kde-format 13910 msgctxt "@action:inmenu" 13911 msgid "Properties" 13912 msgstr "Својства" 13913 13914 #: kio/kfiledialog.cpp:132 13915 #, kde-format 13916 msgid "*|All files" 13917 msgstr "*|Сите датотеки" 13918 13919 #: kio/kfiledialog.cpp:332 13920 #, kde-format 13921 msgid "All Supported Files" 13922 msgstr "Сите поддржани датотеки" 13923 13924 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13925 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13926 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13927 #, kde-format 13928 msgid "Open" 13929 msgstr "Отвори" 13930 13931 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13932 #: kio/kfiledialog.cpp:838 13933 #, kde-format 13934 msgid "Save As" 13935 msgstr "Зачувај како" 13936 13937 #: kio/kfilemetadataprovider.cpp:245 13938 #, kde-format 13939 msgctxt "@item:intable" 13940 msgid "%1 item" 13941 msgid_plural "%1 items" 13942 msgstr[0] "" 13943 msgstr[1] "" 13944 msgstr[2] "" 13945 13946 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13947 #, fuzzy, kde-format 13948 msgctxt "@label" 13949 msgid "Comment" 13950 msgstr "Коментар" 13951 13952 #: kio/kfilemetadataprovider.cpp:447 13953 #, fuzzy, kde-format 13954 #| msgid "Modified:" 13955 msgctxt "@label" 13956 msgid "Modified" 13957 msgstr "Променето:" 13958 13959 #: kio/kfilemetadataprovider.cpp:448 13960 #, fuzzy, kde-format 13961 #| msgid "Owner" 13962 msgctxt "@label" 13963 msgid "Owner" 13964 msgstr "Сопственик" 13965 13966 #: kio/kfilemetadataprovider.cpp:449 13967 #, fuzzy, kde-format 13968 #| msgctxt "@title:column" 13969 #| msgid "Permissions" 13970 msgctxt "@label" 13971 msgid "Permissions" 13972 msgstr "Дозволи" 13973 13974 #: kio/kfilemetadataprovider.cpp:450 13975 #, fuzzy, kde-format 13976 #| msgid "Sorting" 13977 msgctxt "@label" 13978 msgid "Rating" 13979 msgstr "Подредување" 13980 13981 #: kio/kfilemetadataprovider.cpp:451 13982 #, fuzzy, kde-format 13983 #| msgctxt "@title:column" 13984 #| msgid "Size" 13985 msgctxt "@label" 13986 msgid "Size" 13987 msgstr "Големина" 13988 13989 #: kio/kfilemetadataprovider.cpp:452 13990 #, fuzzy, kde-format 13991 #| msgctxt "KFile System Bookmarks" 13992 #| msgid "Trash" 13993 msgctxt "@label" 13994 msgid "Tags" 13995 msgstr "Корпа" 13996 13997 #: kio/kfilemetadataprovider.cpp:453 13998 #, fuzzy, kde-format 13999 #| msgid "Size:" 14000 msgctxt "@label" 14001 msgid "Total Size" 14002 msgstr "Големина:" 14003 14004 #: kio/kfilemetadataprovider.cpp:454 14005 #, fuzzy, kde-format 14006 #| msgid "Type" 14007 msgctxt "@label" 14008 msgid "Type" 14009 msgstr "Тип" 14010 14011 #: kio/kfilemetadatareaderprocess.cpp:234 14012 #, kde-format 14013 msgid "KFileMetaDataReader" 14014 msgstr "" 14015 14016 #: kio/kfilemetadatareaderprocess.cpp:236 14017 #, kde-format 14018 msgid "KFileMetaDataReader can be used to read metadata from a file" 14019 msgstr "" 14020 14021 #: kio/kfilemetadatareaderprocess.cpp:238 14022 #, kde-format 14023 msgid "(C) 2011, Peter Penz" 14024 msgstr "" 14025 14026 #: kio/kfilemetadatareaderprocess.cpp:239 14027 #, kde-format 14028 msgid "Peter Penz" 14029 msgstr "" 14030 14031 #: kio/kfilemetadatareaderprocess.cpp:239 14032 #, kde-format 14033 msgid "Current maintainer" 14034 msgstr "" 14035 14036 #: kio/kfilemetadatareaderprocess.cpp:244 14037 #, kde-format 14038 msgid "Only the meta data that is part of the file is read" 14039 msgstr "" 14040 14041 #: kio/kfilemetadatareaderprocess.cpp:245 14042 #, kde-format 14043 msgid "List of URLs where the meta-data should be read from" 14044 msgstr "" 14045 14046 #: kio/kfilemetainfowidget.cpp:161 14047 #, kde-format 14048 msgid "<Error>" 14049 msgstr "<Грешка>" 14050 14051 #: kio/kfiletreeview.cpp:192 14052 #, kde-format 14053 msgid "Show Hidden Folders" 14054 msgstr "Покажи скриени папки" 14055 14056 #: kio/kimageio.cpp:46 14057 #, kde-format 14058 msgid "All Pictures" 14059 msgstr "Сите слики" 14060 14061 #: kio/kmetaprops.cpp:57 14062 #, kde-format 14063 msgctxt "@title:window" 14064 msgid "Configure Shown Data" 14065 msgstr "" 14066 14067 #: kio/kmetaprops.cpp:60 14068 #, kde-format 14069 msgctxt "@label::textbox" 14070 msgid "Select which data should be shown:" 14071 msgstr "" 14072 14073 #: kio/kmetaprops.cpp:123 14074 #, fuzzy, kde-format 14075 #| msgid "Calculating..." 14076 msgctxt "@action:button" 14077 msgid "Configure..." 14078 msgstr "Пресметувам..." 14079 14080 #: kio/kmetaprops.cpp:133 14081 #, fuzzy, kde-format 14082 #| msgid "Information" 14083 msgctxt "@title:tab" 14084 msgid "Information" 14085 msgstr "Информација" 14086 14087 #: kio/knfotranslator.cpp:40 14088 #, fuzzy, kde-format 14089 #| msgid "Created:" 14090 msgctxt "@label creation date" 14091 msgid "Created" 14092 msgstr "Создадено:" 14093 14094 #: kio/knfotranslator.cpp:41 14095 #, fuzzy, kde-format 14096 #| msgctxt "@title:column" 14097 #| msgid "Size" 14098 msgctxt "@label file content size" 14099 msgid "Size" 14100 msgstr "Големина" 14101 14102 #: kio/knfotranslator.cpp:42 14103 #, kde-format 14104 msgctxt "@label file depends from" 14105 msgid "Depends" 14106 msgstr "" 14107 14108 #: kio/knfotranslator.cpp:43 14109 #, fuzzy, kde-format 14110 #| msgid "Description" 14111 msgctxt "@label" 14112 msgid "Description" 14113 msgstr "Опис" 14114 14115 #: kio/knfotranslator.cpp:44 14116 #, fuzzy, kde-format 14117 #| msgctxt "@title:tab File properties" 14118 #| msgid "&General" 14119 msgctxt "@label Software used to generate content" 14120 msgid "Generator" 14121 msgstr "&Општо" 14122 14123 #: kio/knfotranslator.cpp:45 14124 #, kde-format 14125 msgctxt "" 14126 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14127 msgid "Has Part" 14128 msgstr "" 14129 14130 #: kio/knfotranslator.cpp:46 14131 #, kde-format 14132 msgctxt "" 14133 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14134 "nie#hasLogicalPart" 14135 msgid "Has Logical Part" 14136 msgstr "" 14137 14138 #: kio/knfotranslator.cpp:47 14139 #, fuzzy, kde-format 14140 #| msgid "Parent Folder" 14141 msgctxt "@label parent directory" 14142 msgid "Part of" 14143 msgstr "Родителска папка" 14144 14145 #: kio/knfotranslator.cpp:48 14146 #, kde-format 14147 msgctxt "@label" 14148 msgid "Keyword" 14149 msgstr "" 14150 14151 #: kio/knfotranslator.cpp:49 14152 #, fuzzy, kde-format 14153 #| msgid "Modified:" 14154 msgctxt "@label modified date of file" 14155 msgid "Modified" 14156 msgstr "Променето:" 14157 14158 #: kio/knfotranslator.cpp:50 14159 #, fuzzy, kde-format 14160 #| msgid "Mime Type" 14161 msgctxt "@label" 14162 msgid "MIME Type" 14163 msgstr "MIME-тип" 14164 14165 #: kio/knfotranslator.cpp:51 14166 #, fuzzy, kde-format 14167 #| msgid "Contents:" 14168 msgctxt "@label" 14169 msgid "Content" 14170 msgstr "Содржина:" 14171 14172 #: kio/knfotranslator.cpp:52 14173 #, fuzzy, kde-format 14174 #| msgid "created on %1" 14175 msgctxt "@label" 14176 msgid "Related To" 14177 msgstr "создадено на %1" 14178 14179 #: kio/knfotranslator.cpp:53 14180 #, fuzzy, kde-format 14181 #| msgctxt "The receiver of the SSL certificate" 14182 #| msgid "Subject" 14183 msgctxt "@label" 14184 msgid "Subject" 14185 msgstr "Наслов" 14186 14187 #: kio/knfotranslator.cpp:54 14188 #, fuzzy, kde-format 14189 #| msgid "File" 14190 msgctxt "@label music title" 14191 msgid "Title" 14192 msgstr "Датотека" 14193 14194 #: kio/knfotranslator.cpp:55 14195 #, kde-format 14196 msgctxt "@label file URL" 14197 msgid "File Location" 14198 msgstr "" 14199 14200 #: kio/knfotranslator.cpp:56 14201 #, fuzzy, kde-format 14202 #| msgid "Created:" 14203 msgctxt "@label" 14204 msgid "Creator" 14205 msgstr "Создадено:" 14206 14207 #: kio/knfotranslator.cpp:57 14208 #, kde-format 14209 msgctxt "@label" 14210 msgid "Average Bitrate" 14211 msgstr "" 14212 14213 #: kio/knfotranslator.cpp:58 14214 #, kde-format 14215 msgctxt "@label" 14216 msgid "Channels" 14217 msgstr "" 14218 14219 #: kio/knfotranslator.cpp:59 14220 #, fuzzy, kde-format 14221 #| msgid "Categories" 14222 msgctxt "@label number of characters" 14223 msgid "Characters" 14224 msgstr "Категории" 14225 14226 #: kio/knfotranslator.cpp:60 14227 #, fuzzy, kde-format 14228 #| msgid "C&onnect" 14229 msgctxt "@label" 14230 msgid "Codec" 14231 msgstr "П&оврзи" 14232 14233 #: kio/knfotranslator.cpp:61 14234 #, kde-format 14235 msgctxt "@label" 14236 msgid "Color Depth" 14237 msgstr "" 14238 14239 #: kio/knfotranslator.cpp:62 14240 #, fuzzy, kde-format 14241 #| msgctxt "The destination of a file operation" 14242 #| msgid "Destination" 14243 msgctxt "@label" 14244 msgid "Duration" 14245 msgstr "Одредиште" 14246 14247 #: kio/knfotranslator.cpp:63 14248 #, fuzzy, kde-format 14249 #| msgid "Device name" 14250 msgctxt "@label" 14251 msgid "Filename" 14252 msgstr "Име на уред" 14253 14254 #: kio/knfotranslator.cpp:64 14255 #, kde-format 14256 msgctxt "@label" 14257 msgid "Hash" 14258 msgstr "" 14259 14260 #: kio/knfotranslator.cpp:65 14261 #, kde-format 14262 msgctxt "@label" 14263 msgid "Height" 14264 msgstr "" 14265 14266 #: kio/knfotranslator.cpp:66 14267 #, kde-format 14268 msgctxt "@label" 14269 msgid "Interlace Mode" 14270 msgstr "" 14271 14272 #: kio/knfotranslator.cpp:67 14273 #, fuzzy, kde-format 14274 #| msgid "Link" 14275 msgctxt "@label number of lines" 14276 msgid "Lines" 14277 msgstr "Врска" 14278 14279 #: kio/knfotranslator.cpp:68 14280 #, kde-format 14281 msgctxt "@label" 14282 msgid "Programming Language" 14283 msgstr "" 14284 14285 #: kio/knfotranslator.cpp:69 14286 #, kde-format 14287 msgctxt "@label" 14288 msgid "Sample Rate" 14289 msgstr "" 14290 14291 #: kio/knfotranslator.cpp:70 14292 #, fuzzy, kde-format 14293 #| msgid "Write" 14294 msgctxt "@label" 14295 msgid "Width" 14296 msgstr "Запишување" 14297 14298 #: kio/knfotranslator.cpp:71 14299 #, kde-format 14300 msgctxt "@label number of words" 14301 msgid "Words" 14302 msgstr "" 14303 14304 #: kio/knfotranslator.cpp:72 14305 #, kde-format 14306 msgctxt "@label EXIF aperture value" 14307 msgid "Aperture" 14308 msgstr "" 14309 14310 #: kio/knfotranslator.cpp:73 14311 #, kde-format 14312 msgctxt "@label EXIF" 14313 msgid "Exposure Bias Value" 14314 msgstr "" 14315 14316 #: kio/knfotranslator.cpp:74 14317 #, fuzzy, kde-format 14318 #| msgid "Exposure:" 14319 msgctxt "@label EXIF" 14320 msgid "Exposure Time" 14321 msgstr "Изложеност:" 14322 14323 #: kio/knfotranslator.cpp:75 14324 #, fuzzy, kde-format 14325 #| msgid "Class" 14326 msgctxt "@label EXIF" 14327 msgid "Flash" 14328 msgstr "Класа" 14329 14330 #: kio/knfotranslator.cpp:76 14331 #, kde-format 14332 msgctxt "@label EXIF" 14333 msgid "Focal Length" 14334 msgstr "" 14335 14336 #: kio/knfotranslator.cpp:77 14337 #, kde-format 14338 msgctxt "@label EXIF" 14339 msgid "Focal Length 35 mm" 14340 msgstr "" 14341 14342 #: kio/knfotranslator.cpp:78 14343 #, kde-format 14344 msgctxt "@label EXIF" 14345 msgid "ISO Speed Ratings" 14346 msgstr "" 14347 14348 #: kio/knfotranslator.cpp:79 14349 #, fuzzy, kde-format 14350 #| msgid "Mask" 14351 msgctxt "@label EXIF" 14352 msgid "Make" 14353 msgstr "Маска" 14354 14355 #: kio/knfotranslator.cpp:80 14356 #, kde-format 14357 msgctxt "@label EXIF" 14358 msgid "Metering Mode" 14359 msgstr "" 14360 14361 #: kio/knfotranslator.cpp:81 14362 #, kde-format 14363 msgctxt "@label EXIF" 14364 msgid "Model" 14365 msgstr "" 14366 14367 #: kio/knfotranslator.cpp:82 14368 #, fuzzy, kde-format 14369 #| msgid "Organization:" 14370 msgctxt "@label EXIF" 14371 msgid "Orientation" 14372 msgstr "Организација:" 14373 14374 #: kio/knfotranslator.cpp:83 14375 #, kde-format 14376 msgctxt "@label EXIF" 14377 msgid "White Balance" 14378 msgstr "" 14379 14380 #: kio/knfotranslator.cpp:84 14381 #, fuzzy, kde-format 14382 #| msgid "Directory" 14383 msgctxt "@label video director" 14384 msgid "Director" 14385 msgstr "Папка" 14386 14387 #: kio/knfotranslator.cpp:85 14388 #, fuzzy, kde-format 14389 #| msgctxt "@title:tab File properties" 14390 #| msgid "&General" 14391 msgctxt "@label music genre" 14392 msgid "Genre" 14393 msgstr "&Општо" 14394 14395 #: kio/knfotranslator.cpp:86 14396 #, kde-format 14397 msgctxt "@label music album" 14398 msgid "Album" 14399 msgstr "" 14400 14401 #: kio/knfotranslator.cpp:87 14402 #, kde-format 14403 msgctxt "@label" 14404 msgid "Performer" 14405 msgstr "" 14406 14407 #: kio/knfotranslator.cpp:88 14408 #, fuzzy, kde-format 14409 #| msgid "&Release '%1'" 14410 msgctxt "@label" 14411 msgid "Release Date" 14412 msgstr "Ос&лободи „%1“" 14413 14414 #: kio/knfotranslator.cpp:89 14415 #, kde-format 14416 msgctxt "@label music track number" 14417 msgid "Track" 14418 msgstr "" 14419 14420 #: kio/knfotranslator.cpp:90 14421 #, fuzzy, kde-format 14422 #| msgid "URL Resource Invalid" 14423 msgctxt "@label resource created time" 14424 msgid "Resource Created" 14425 msgstr "Невалиден URL-ресурс" 14426 14427 #: kio/knfotranslator.cpp:91 14428 #, fuzzy, kde-format 14429 #| msgctxt "The source of a file operation" 14430 #| msgid "Source" 14431 msgctxt "@label" 14432 msgid "Sub Resource" 14433 msgstr "Извор" 14434 14435 #: kio/knfotranslator.cpp:92 14436 #, fuzzy, kde-format 14437 #| msgid "Modified:" 14438 msgctxt "@label resource last modified" 14439 msgid "Resource Modified" 14440 msgstr "Променето:" 14441 14442 #: kio/knfotranslator.cpp:93 14443 #, fuzzy, kde-format 14444 #| msgid "Sorting" 14445 msgctxt "@label" 14446 msgid "Numeric Rating" 14447 msgstr "Подредување" 14448 14449 #: kio/knfotranslator.cpp:94 14450 #, kde-format 14451 msgctxt "@label" 14452 msgid "Copied From" 14453 msgstr "" 14454 14455 #: kio/knfotranslator.cpp:95 14456 #, kde-format 14457 msgctxt "@label" 14458 msgid "First Usage" 14459 msgstr "" 14460 14461 #: kio/knfotranslator.cpp:96 14462 #, kde-format 14463 msgctxt "@label" 14464 msgid "Last Usage" 14465 msgstr "" 14466 14467 #: kio/knfotranslator.cpp:97 14468 #, fuzzy, kde-format 14469 #| msgid "Comment" 14470 msgctxt "@label" 14471 msgid "Usage Count" 14472 msgstr "Коментар" 14473 14474 #: kio/knfotranslator.cpp:98 14475 #, kde-format 14476 msgctxt "@label" 14477 msgid "Unix File Group" 14478 msgstr "" 14479 14480 #: kio/knfotranslator.cpp:99 14481 #, kde-format 14482 msgctxt "@label" 14483 msgid "Unix File Mode" 14484 msgstr "" 14485 14486 #: kio/knfotranslator.cpp:100 14487 #, fuzzy, kde-format 14488 #| msgid "Open file dialog" 14489 msgctxt "@label" 14490 msgid "Unix File Owner" 14491 msgstr "Дијалог за отворање на датотека" 14492 14493 #: kio/knfotranslator.cpp:101 14494 #, fuzzy, kde-format 14495 #| msgid "Type" 14496 msgctxt "@label file type" 14497 msgid "Type" 14498 msgstr "Тип" 14499 14500 #: kio/knfotranslator.cpp:102 14501 #, kde-format 14502 msgctxt "@label Number of fuzzy translations" 14503 msgid "Fuzzy Translations" 14504 msgstr "" 14505 14506 #: kio/knfotranslator.cpp:103 14507 #, kde-format 14508 msgctxt "@label Name of last translator" 14509 msgid "Last Translator" 14510 msgstr "" 14511 14512 #: kio/knfotranslator.cpp:104 14513 #, kde-format 14514 msgctxt "@label Number of obsolete translations" 14515 msgid "Obsolete Translations" 14516 msgstr "" 14517 14518 #: kio/knfotranslator.cpp:105 14519 #, kde-format 14520 msgctxt "@label" 14521 msgid "Translation Source Date" 14522 msgstr "" 14523 14524 #: kio/knfotranslator.cpp:106 14525 #, kde-format 14526 msgctxt "@label Number of total translations" 14527 msgid "Total Translations" 14528 msgstr "" 14529 14530 #: kio/knfotranslator.cpp:107 14531 #, fuzzy, kde-format 14532 #| msgid "Trusted:" 14533 msgctxt "@label Number of translated strings" 14534 msgid "Translated" 14535 msgstr "Доверливо:" 14536 14537 #: kio/knfotranslator.cpp:108 14538 #, kde-format 14539 msgctxt "@label" 14540 msgid "Translation Date" 14541 msgstr "" 14542 14543 #: kio/knfotranslator.cpp:109 14544 #, kde-format 14545 msgctxt "@label Number of untranslated strings" 14546 msgid "Untranslated" 14547 msgstr "" 14548 14549 #: kio/kpreviewprops.cpp:51 14550 #, kde-format 14551 msgid "P&review" 14552 msgstr "П&реглед" 14553 14554 #: kio/kscan.cpp:49 14555 #, kde-format 14556 msgid "Acquire Image" 14557 msgstr "Преземи слика" 14558 14559 #: kio/kscan.cpp:97 14560 #, kde-format 14561 msgid "OCR Image" 14562 msgstr "OCR на слика" 14563 14564 #: kio/netaccess.cpp:102 14565 #, kde-format 14566 msgid "File '%1' is not readable" 14567 msgstr "Датотеката „%1“ не е читлива" 14568 14569 #: kio/netaccess.cpp:435 14570 #, kde-format 14571 msgid "ERROR: Unknown protocol '%1'" 14572 msgstr "ГРЕШКА: Непознат протокол „%1“" 14573 14574 #: kio/passworddialog.cpp:56 14575 #, kde-format 14576 msgid "Authorization Dialog" 14577 msgstr "Дијалог за авторизација" 14578 14579 #: kioslave/metainfo/metainfo.cpp:98 14580 #, kde-format 14581 msgid "No metainfo for %1" 14582 msgstr "Нема метаподатоци за %1" 14583 14584 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14585 #: kssl/kcm/cacertificates.ui:24 14586 #, fuzzy, kde-format 14587 #| msgid "Organization:" 14588 msgid "Organization / Common Name" 14589 msgstr "Организација:" 14590 14591 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14592 #: kssl/kcm/cacertificates.ui:29 14593 #, fuzzy, kde-format 14594 #| msgid "Organizational unit:" 14595 msgid "Organizational Unit" 14596 msgstr "Единица од организацијата:" 14597 14598 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14599 #: kssl/kcm/cacertificates.ui:42 14600 #, kde-format 14601 msgid "Display..." 14602 msgstr "" 14603 14604 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14605 #: kssl/kcm/cacertificates.ui:68 14606 #, fuzzy, kde-format 14607 #| msgid "disable XIM" 14608 msgid "Disable" 14609 msgstr "оневозможи XIM" 14610 14611 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14612 #: kssl/kcm/cacertificates.ui:78 14613 #, fuzzy, kde-format 14614 #| msgid "Emblems" 14615 msgid "Enable" 14616 msgstr "Амблеми" 14617 14618 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14619 #: kssl/kcm/cacertificates.ui:104 14620 #, kde-format 14621 msgid "Remove" 14622 msgstr "Отстрани" 14623 14624 #. i18n: ectx: property (text), widget (QPushButton, add) 14625 #: kssl/kcm/cacertificates.ui:111 14626 #, kde-format 14627 msgid "Add..." 14628 msgstr "Додај..." 14629 14630 #: kssl/kcm/cacertificatespage.cpp:140 14631 #, fuzzy, kde-format 14632 #| msgid "Send certificate" 14633 msgid "System certificates" 14634 msgstr "Испрати сертификат" 14635 14636 #: kssl/kcm/cacertificatespage.cpp:147 14637 #, fuzzy, kde-format 14638 #| msgid "Send certificate" 14639 msgid "User-added certificates" 14640 msgstr "Испрати сертификат" 14641 14642 #: kssl/kcm/cacertificatespage.cpp:302 14643 #, fuzzy, kde-format 14644 #| msgid "Certificate" 14645 msgid "Pick Certificates" 14646 msgstr "Сертификат" 14647 14648 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14649 #: kssl/kcm/displaycert.ui:23 14650 #, fuzzy, kde-format 14651 #| msgid "Security Information" 14652 msgid "<b>Subject Information</b>" 14653 msgstr "Информации за безбедноста" 14654 14655 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14656 #: kssl/kcm/displaycert.ui:39 14657 #, fuzzy, kde-format 14658 #| msgid " <b>[Cross Domain]</b>" 14659 msgid "<b>Issuer Information</b>" 14660 msgstr " <b>[меѓу домени]</b>" 14661 14662 #. i18n: ectx: property (text), widget (QLabel, label) 14663 #: kssl/kcm/displaycert.ui:55 14664 #, fuzzy, kde-format 14665 #| msgid "<b>%1</b>" 14666 msgid "<b>Other</b>" 14667 msgstr "<b>%1</b>" 14668 14669 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14670 #: kssl/kcm/displaycert.ui:64 14671 #, fuzzy, kde-format 14672 #| msgid "Validity period:" 14673 msgid "Validity period" 14674 msgstr "Период на валидност:" 14675 14676 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14677 #: kssl/kcm/displaycert.ui:78 14678 #, fuzzy, kde-format 14679 #| msgid "Serial number:" 14680 msgid "Serial number" 14681 msgstr "Сериски број:" 14682 14683 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14684 #: kssl/kcm/displaycert.ui:92 14685 #, fuzzy, kde-format 14686 #| msgid "MD5 digest:" 14687 msgid "MD5 digest" 14688 msgstr "MD5-преглед:" 14689 14690 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14691 #: kssl/kcm/displaycert.ui:106 14692 #, fuzzy, kde-format 14693 #| msgid "SHA1 digest:" 14694 msgid "SHA1 digest" 14695 msgstr "SHA1-преглед:" 14696 14697 #: kssl/kcm/displaycertdialog.cpp:73 14698 #, kde-format 14699 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14700 msgid "%1 to %2" 14701 msgstr "%1 на %2" 14702 14703 #: kssl/kcm/kcmssl.cpp:37 14704 #, fuzzy, kde-format 14705 #| msgid "Reload configuration file" 14706 msgid "SSL Configuration Module" 14707 msgstr "Превчитај ја конфигурациската датотека" 14708 14709 #: kssl/kcm/kcmssl.cpp:39 14710 #, kde-format 14711 msgid "Copyright 2010 Andreas Hartmetz" 14712 msgstr "" 14713 14714 #: kssl/kcm/kcmssl.cpp:40 14715 #, kde-format 14716 msgid "Andreas Hartmetz" 14717 msgstr "" 14718 14719 #: kssl/kcm/kcmssl.cpp:52 14720 #, fuzzy, kde-format 14721 #| msgid "Link" 14722 msgid "SSL Signers" 14723 msgstr "Врска" 14724 14725 #: kssl/ksslcertificate.cpp:202 14726 #, kde-format 14727 msgid "Signature Algorithm: " 14728 msgstr "Алгоритам за сигнатура:" 14729 14730 #: kssl/ksslcertificate.cpp:203 14731 #, kde-format 14732 msgid "Unknown" 14733 msgstr "Непознато" 14734 14735 #: kssl/ksslcertificate.cpp:206 14736 #, kde-format 14737 msgid "Signature Contents:" 14738 msgstr "Содржина на сигнатура:" 14739 14740 #: kssl/ksslcertificate.cpp:341 14741 #, kde-format 14742 msgctxt "Unknown" 14743 msgid "Unknown key algorithm" 14744 msgstr "Непознат алгоритам за клуч" 14745 14746 #: kssl/ksslcertificate.cpp:347 14747 #, kde-format 14748 msgid "Key type: RSA (%1 bit)" 14749 msgstr "Тип клуч: RSA (%1 бита)" 14750 14751 #: kssl/ksslcertificate.cpp:349 14752 #, kde-format 14753 msgid "Modulus: " 14754 msgstr "Остаток:" 14755 14756 #: kssl/ksslcertificate.cpp:362 14757 #, kde-format 14758 msgid "Exponent: 0x" 14759 msgstr "Експонент: 0x" 14760 14761 #: kssl/ksslcertificate.cpp:374 14762 #, kde-format 14763 msgid "Key type: DSA (%1 bit)" 14764 msgstr "Тип клуч: DSA (%1 бита)" 14765 14766 #: kssl/ksslcertificate.cpp:376 14767 #, kde-format 14768 msgid "Prime: " 14769 msgstr "Прост број:" 14770 14771 #: kssl/ksslcertificate.cpp:389 14772 #, kde-format 14773 msgid "160 bit prime factor: " 14774 msgstr "160-битен фактор на прост број: " 14775 14776 #: kssl/ksslcertificate.cpp:417 14777 #, kde-format 14778 msgid "Public key: " 14779 msgstr "Јавен клуч:" 14780 14781 #: kssl/ksslcertificate.cpp:1065 14782 #, kde-format 14783 msgid "The certificate is valid." 14784 msgstr "Сертификатот е валиден." 14785 14786 #: kssl/ksslcertificate.cpp:1067 14787 #, kde-format 14788 msgid "" 14789 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14790 "Authority) certificate can not be found." 14791 msgstr "" 14792 "Преземањето на сертификатот на издавачот не успеа. Тоа значи дека " 14793 "сертификатот на авторитетот за сертификати (CA) не може да биде пронајден." 14794 14795 #: kssl/ksslcertificate.cpp:1069 14796 #, kde-format 14797 msgid "" 14798 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14799 "CA's (Certificate Authority) CRL can not be found." 14800 msgstr "" 14801 "Преземањето на листата со отповикани сертификати (Certificate Revocation " 14802 "List) не успеа. Тоа значи дека листата со отповикани сертификати на " 14803 "авторитетот за сертификати (CA) не може да биде пронајдена." 14804 14805 #: kssl/ksslcertificate.cpp:1071 14806 #, kde-format 14807 msgid "" 14808 "The decryption of the certificate's signature failed. This means it could " 14809 "not even be calculated as opposed to just not matching the expected result." 14810 msgstr "" 14811 "Декриптирањето на потписот на сертификатот не успеа. Тоа значи дека не " 14812 "можело дури ни да се пресмета, наспроти несовпаѓањето на очекуваниот " 14813 "резултат." 14814 14815 #: kssl/ksslcertificate.cpp:1073 14816 #, kde-format 14817 msgid "" 14818 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14819 "This means it could not even be calculated as opposed to just not matching " 14820 "the expected result." 14821 msgstr "" 14822 "Декриптирањето на потписот на CRL (листа со отповикани сертификати, " 14823 "Certificate Revocation List) не успеа. Тоа значи дека не можело дури ни да " 14824 "се пресмета, наспроти несовпаѓањето на очекуваниот резултат." 14825 14826 #: kssl/ksslcertificate.cpp:1075 14827 #, kde-format 14828 msgid "" 14829 "The decoding of the public key of the issuer failed. This means that the " 14830 "CA's (Certificate Authority) certificate can not be used to verify the " 14831 "certificate you wanted to use." 14832 msgstr "" 14833 "Декодирањето на јавниот клуч на издавачот не успеа. Тоа значи дека " 14834 "сертификатот на авторитетот за сертификати не може да се користи за " 14835 "верификација на сертификатот што сакате да го користите." 14836 14837 #: kssl/ksslcertificate.cpp:1077 14838 #, kde-format 14839 msgid "" 14840 "The certificate's signature is invalid. This means that the certificate can " 14841 "not be verified." 14842 msgstr "" 14843 "Потписот на сертификатот не е валиден. Тоа значи дека сертификатот не може " 14844 "да биде верификуван." 14845 14846 #: kssl/ksslcertificate.cpp:1079 14847 #, kde-format 14848 msgid "" 14849 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14850 "that the CRL can not be verified." 14851 msgstr "" 14852 "Потписот на листата со отповикани сертификати не е валиден. Тоа значи дека " 14853 "листата не може да биде верификувана." 14854 14855 #: kssl/ksslcertificate.cpp:1081 14856 #, kde-format 14857 msgid "The certificate is not valid, yet." 14858 msgstr "Сертификатот не е сѐ уште валиден." 14859 14860 #: kssl/ksslcertificate.cpp:1083 14861 #, kde-format 14862 msgid "The certificate is not valid, any more." 14863 msgstr "Сертификатот не е повеќе валиден." 14864 14865 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14866 #, kde-format 14867 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14868 msgstr "Листата со отповикани сертификати не е сѐ уште валидна." 14869 14870 #: kssl/ksslcertificate.cpp:1089 14871 #, kde-format 14872 msgid "The time format of the certificate's 'notBefore' field is invalid." 14873 msgstr "Форматот за време на полето „notBefore“ од сертификатот не е валиден." 14874 14875 #: kssl/ksslcertificate.cpp:1091 14876 #, kde-format 14877 msgid "The time format of the certificate's 'notAfter' field is invalid." 14878 msgstr "Форматот за време на полето „notAfter“ од сертификатот не е валиден." 14879 14880 #: kssl/ksslcertificate.cpp:1093 14881 #, kde-format 14882 msgid "" 14883 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14884 "field is invalid." 14885 msgstr "" 14886 "Форматот за време на полето „lastUpdate“ од листата со отповикани " 14887 "сертификати не е валиден." 14888 14889 #: kssl/ksslcertificate.cpp:1095 14890 #, kde-format 14891 msgid "" 14892 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14893 "field is invalid." 14894 msgstr "" 14895 "Форматот за време на полето „nextUpdate“ од листата со отповикани " 14896 "сертификати не е валиден." 14897 14898 #: kssl/ksslcertificate.cpp:1097 14899 #, kde-format 14900 msgid "The OpenSSL process ran out of memory." 14901 msgstr "На процесот OpenSSL му снема меморија." 14902 14903 #: kssl/ksslcertificate.cpp:1099 14904 #, kde-format 14905 msgid "" 14906 "The certificate is self-signed and not in the list of trusted certificates. " 14907 "If you want to accept this certificate, import it into the list of trusted " 14908 "certificates." 14909 msgstr "" 14910 "Сертификатот е самопотпишан и го нема во листата на доверливи сертификати. " 14911 "Ако сакате да го прифатите овој сертификат, внесете го во листата на " 14912 "доверливи сертификати." 14913 14914 #: kssl/ksslcertificate.cpp:1102 14915 #, kde-format 14916 msgid "" 14917 "The certificate is self-signed. While the trust chain could be built up, the " 14918 "root CA's (Certificate Authority) certificate can not be found." 14919 msgstr "" 14920 "Сертификатот е самопотпишан. Иако може да се изгради синџир на доверба, не " 14921 "може да биде пронајден сертификатот на коренскиот авторитет за сертификати." 14922 14923 #: kssl/ksslcertificate.cpp:1104 14924 #, kde-format 14925 msgid "" 14926 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14927 "your trust chain is broken." 14928 msgstr "" 14929 "Сертификатот на авторитетот за сертификати не може да биде пронајден. " 14930 "Најверојатно е прекинат вашиот синџир на доверба." 14931 14932 #: kssl/ksslcertificate.cpp:1106 14933 #, kde-format 14934 msgid "" 14935 "The certificate can not be verified as it is the only certificate in the " 14936 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14937 "to import it into the list of trusted certificates." 14938 msgstr "" 14939 "Сертификатот не може да биде верификуван бидејќи е единствен сертификат во " 14940 "синџирот на доверба и не е самопотпишан. Ако сами го потпишете сертификатот, " 14941 "осигурете се дека сте го внеле во листата на доверливи сертификати." 14942 14943 #: kssl/ksslcertificate.cpp:1108 14944 #, kde-format 14945 msgid "The certificate chain is longer than the maximum depth specified." 14946 msgstr "Синџирот со сертификати е подолг од максималната наведена големина." 14947 14948 #: kssl/ksslcertificate.cpp:1111 14949 #, kde-format 14950 msgid "The certificate has been revoked." 14951 msgstr "Сертификатот е отповикан." 14952 14953 #: kssl/ksslcertificate.cpp:1113 14954 #, kde-format 14955 msgid "The certificate's CA (Certificate Authority) is invalid." 14956 msgstr "Авторитетот за сертификати (CA) на сертификатот не е валиден." 14957 14958 #: kssl/ksslcertificate.cpp:1115 14959 #, kde-format 14960 msgid "" 14961 "The length of the trust chain exceeded one of the CA's (Certificate " 14962 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14963 msgstr "" 14964 "Должината на синџирот на доверба е поголема од еден од параметрите " 14965 "„pathlength“ на авторитетот за сертификати, што ги прави сите наредни " 14966 "потписи невалидни." 14967 14968 #: kssl/ksslcertificate.cpp:1117 14969 #, kde-format 14970 msgid "" 14971 "The certificate has not been signed for the purpose you tried to use it for. " 14972 "This means the CA (Certificate Authority) does not allow this usage." 14973 msgstr "" 14974 "Сертификатот не е потпишан за употребата за која се обидовте да го " 14975 "користите. Тоа значи дека авторитетот за сертификати (CA) не ја дозволува " 14976 "оваа употреба." 14977 14978 #: kssl/ksslcertificate.cpp:1120 14979 #, kde-format 14980 msgid "" 14981 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14982 "to use this certificate for." 14983 msgstr "" 14984 "Коренскиот авторитет за сертификати не е доверлив за целта за која се " 14985 "обидовте да го употребите." 14986 14987 #: kssl/ksslcertificate.cpp:1123 14988 #, kde-format 14989 msgid "" 14990 "The root CA (Certificate Authority) has been marked to be rejected for the " 14991 "purpose you tried to use it for." 14992 msgstr "" 14993 "Коренскиот авторитет за сертификати е означен да биде одбиен за целта за " 14994 "која се обидовте да го употребите." 14995 14996 #: kssl/ksslcertificate.cpp:1125 14997 #, kde-format 14998 msgid "" 14999 "The certificate's CA (Certificate Authority) does not match the CA name of " 15000 "the certificate." 15001 msgstr "" 15002 "Сертификатот на авторитетот за сертификати не се совпаѓа со името на " 15003 "авторитетот во сертификатот." 15004 15005 #: kssl/ksslcertificate.cpp:1127 15006 #, kde-format 15007 msgid "" 15008 "The CA (Certificate Authority) certificate's key ID does not match the key " 15009 "ID in the 'Issuer' section of the certificate you are trying to use." 15010 msgstr "" 15011 "Идент. на клуч од сертификатот на авторитетот за сертификати не се совпаѓа " 15012 "со идент. на клуч во одделот „Издавач“ од сертификатот што се обидувате да " 15013 "го употребите." 15014 15015 #: kssl/ksslcertificate.cpp:1129 15016 #, kde-format 15017 msgid "" 15018 "The CA (Certificate Authority) certificate's key ID and name do not match " 15019 "the key ID and name in the 'Issuer' section of the certificate you are " 15020 "trying to use." 15021 msgstr "" 15022 "Идент. на клуч и името од сертификатот на авторитетот за сертификати не се " 15023 "совпаѓа со идент. на клуч и името во одделот „Издавач“ од сертификатот што " 15024 "се обидувате да го употребите." 15025 15026 #: kssl/ksslcertificate.cpp:1131 15027 #, kde-format 15028 msgid "" 15029 "The certificate's CA (Certificate Authority) is not allowed to sign " 15030 "certificates." 15031 msgstr "" 15032 "Сертификатот на авторитетот за сертификати не е дозволено да потпишува " 15033 "сертификати." 15034 15035 #: kssl/ksslcertificate.cpp:1133 15036 #, kde-format 15037 msgid "OpenSSL could not be verified." 15038 msgstr "OpenSSL не можеше да биде верификуван." 15039 15040 #: kssl/ksslcertificate.cpp:1137 15041 #, kde-format 15042 msgid "" 15043 "The signature test for this certificate failed. This could mean that the " 15044 "signature of this certificate or any in its trust path are invalid, could " 15045 "not be decoded or that the CRL (Certificate Revocation List) could not be " 15046 "verified. If you see this message, please let the author of the software you " 15047 "are using know that he or she should use the new, more specific error " 15048 "messages." 15049 msgstr "" 15050 "Тестот за потпишување за овој сертификат не успеа. Тоа може да значи дека " 15051 "потписот на овој сертификат или некој во неговата патека на доверба е " 15052 "невалиден, не може да биде декодиран или дека листата со отповикани " 15053 "сертификати CRL (Certificate Revocation List) не може да биде верификувана. " 15054 "Ако ја видите поракава, информирајте го авторот на софтверот што го " 15055 "користите дека би требало да ги користи новите поконкретни пораки за грешки." 15056 15057 #: kssl/ksslcertificate.cpp:1139 15058 #, kde-format 15059 msgid "" 15060 "This certificate, any in its trust path or its CA's (Certificate Authority) " 15061 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 15062 "valid yet or not valid any more. If you see this message, please let the " 15063 "author of the software you are using know that he or she should use the new, " 15064 "more specific error messages." 15065 msgstr "" 15066 15067 #: kssl/ksslcertificate.cpp:1145 15068 #, kde-format 15069 msgid "" 15070 "Certificate signing authority root files could not be found so the " 15071 "certificate is not verified." 15072 msgstr "" 15073 "Главните датотеки на авторитетот за потпишување на сертификатот не беа " 15074 "пронајдени и затоа сертификатот не е верификуван." 15075 15076 #: kssl/ksslcertificate.cpp:1147 15077 #, kde-format 15078 msgid "SSL support was not found." 15079 msgstr "Не е пронајдена поддршка за SSL." 15080 15081 #: kssl/ksslcertificate.cpp:1149 15082 #, kde-format 15083 msgid "Private key test failed." 15084 msgstr "Тестот на приватниот клуч не успеа." 15085 15086 #: kssl/ksslcertificate.cpp:1151 15087 #, kde-format 15088 msgid "The certificate has not been issued for this host." 15089 msgstr "Сертификатот не е издаден за овој компјутер." 15090 15091 #: kssl/ksslcertificate.cpp:1153 15092 #, kde-format 15093 msgid "This certificate is not relevant." 15094 msgstr "Овој сертификат не е релевантен." 15095 15096 #: kssl/ksslcertificate.cpp:1158 15097 #, kde-format 15098 msgid "The certificate is invalid." 15099 msgstr "Сертификатот не е валиден." 15100 15101 #: kssl/ksslutils.cpp:90 15102 #, kde-format 15103 msgid "GMT" 15104 msgstr "GMT" 15105 15106 #, fuzzy 15107 #~ msgctxt "color" 15108 #~ msgid "hot" 15109 #~ msgstr "Thl" 15110 15111 #, fuzzy 15112 #~ msgctxt "color" 15113 #~ msgid "sea" 15114 #~ msgstr "Пауза" 15115 15116 #, fuzzy 15117 #~ msgctxt "@item Calendar system" 15118 #~ msgid "Gregorian (Proleptic)" 15119 #~ msgstr "Грегоријански" 15120 15121 #, fuzzy 15122 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15123 #~ msgid "of Mes" 15124 #~ msgstr "од Meh" 15125 15126 #, fuzzy 15127 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15128 #~ msgid "of Ter" 15129 #~ msgstr "од Tir" 15130 15131 #, fuzzy 15132 #~ msgctxt "Ethiopian month 1 - ShortName" 15133 #~ msgid "Mes" 15134 #~ msgstr "Да" 15135 15136 #, fuzzy 15137 #~ msgctxt "Ethiopian month 5 - LongName" 15138 #~ msgid "Ter" 15139 #~ msgstr "вто" 15140 15141 #, fuzzy 15142 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15143 #~ msgid "Ham" 15144 #~ msgstr "am" 15145 15146 #, fuzzy 15147 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15148 #~ msgid "Arb" 15149 #~ msgstr "Arb" 15150 15151 #, fuzzy 15152 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15153 #~ msgid "Rob" 15154 #~ msgstr "Задача" 15155 15156 #, fuzzy 15157 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15158 #~ msgid "Arb" 15159 #~ msgstr "Arb" 15160 15161 #~ msgctxt "of May long" 15162 #~ msgid "of May" 15163 #~ msgstr "од мај" 15164 15165 #~ msgctxt "May long" 15166 #~ msgid "May" 15167 #~ msgstr "мај" 15168 15169 #~ msgid "R. Thaani" 15170 #~ msgstr "R. Thaani" 15171 15172 #~ msgid "J. Thaani" 15173 #~ msgstr "J. Thaani" 15174 15175 #~ msgid "Hijjah" 15176 #~ msgstr "Hijjah" 15177 15178 #~ msgctxt "of Tir long" 15179 #~ msgid "of Tir" 15180 #~ msgstr "од Tir" 15181 15182 #~ msgctxt "of Dei long" 15183 #~ msgid "of Dei" 15184 #~ msgstr "од Dei" 15185 15186 #~ msgctxt "Tir long" 15187 #~ msgid "Tir" 15188 #~ msgstr "Tir" 15189 15190 #~ msgctxt "Dei long" 15191 #~ msgid "Dei" 15192 #~ msgstr "Dei" 15193 15194 #~ msgctxt "Shanbe short" 15195 #~ msgid "shn" 15196 #~ msgstr "shn"