Warning, /frameworks/kdelibs4support/po/mai/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Maithili 0002 # Copyright (C) YEAR This_file_is_part_of_KDE 0003 # This file is distributed under the same license as the PACKAGE package. 0004 # 0005 # Sangeeta Kumari <sangeeta09@gmail.com>, 2008. 0006 msgid "" 0007 msgstr "" 0008 "Project-Id-Version: kdelibs4\n" 0009 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0010 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0011 "PO-Revision-Date: 2008-12-03 15:06+0530\n" 0012 "Last-Translator: Sangeeta Kumari <sangeeta09@gmail.com>\n" 0013 "Language-Team: Maithili <maithili.sf.net>\n" 0014 "Language: mai\n" 0015 "MIME-Version: 1.0\n" 0016 "Content-Type: text/plain; charset=UTF-8\n" 0017 "Content-Transfer-Encoding: 8bit\n" 0018 "Plural-Forms: nplurals=2; plural=(n!=1);\n" 0019 "\n" 0020 "\n" 0021 "\n" 0022 "\n" 0023 "X-Generator: KBabel 1.11.4\n" 0024 0025 #, kde-format 0026 msgctxt "NAME OF TRANSLATORS" 0027 msgid "Your names" 0028 msgstr "संगीता कुमारी" 0029 0030 #, kde-format 0031 msgctxt "EMAIL OF TRANSLATORS" 0032 msgid "Your emails" 0033 msgstr "sangeeta09@gmail.com" 0034 0035 #, kde-format 0036 msgctxt "color" 0037 msgid "AliceBlue" 0038 msgstr "एलाइस नीला" 0039 0040 #, kde-format 0041 msgctxt "color" 0042 msgid "AntiqueWhite" 0043 msgstr "एन्टीक-सफेद" 0044 0045 #, kde-format 0046 msgctxt "color" 0047 msgid "AntiqueWhite1" 0048 msgstr "एन्टीक-सफेद1" 0049 0050 #, kde-format 0051 msgctxt "color" 0052 msgid "AntiqueWhite2" 0053 msgstr "एन्टीक-सफेद2" 0054 0055 #, kde-format 0056 msgctxt "color" 0057 msgid "AntiqueWhite3" 0058 msgstr "एन्टीक-सफेद3" 0059 0060 #, kde-format 0061 msgctxt "color" 0062 msgid "AntiqueWhite4" 0063 msgstr "एन्टीक-सफेद4 " 0064 0065 #, kde-format 0066 msgctxt "color" 0067 msgid "BlanchedAlmond" 0068 msgstr "ब्लाँच्ड-बादामी" 0069 0070 #, kde-format 0071 msgctxt "color" 0072 msgid "BlueViolet" 0073 msgstr "बैंगनी" 0074 0075 #, kde-format 0076 msgctxt "color" 0077 msgid "CadetBlue" 0078 msgstr "केडेट-नीला" 0079 0080 #, kde-format 0081 msgctxt "color" 0082 msgid "CadetBlue1" 0083 msgstr "केडेट-नीला" 0084 0085 #, kde-format 0086 msgctxt "color" 0087 msgid "CadetBlue2" 0088 msgstr "केडेट-नीला2" 0089 0090 #, kde-format 0091 msgctxt "color" 0092 msgid "CadetBlue3" 0093 msgstr "केडेट-नीला3" 0094 0095 #, kde-format 0096 msgctxt "color" 0097 msgid "CadetBlue4" 0098 msgstr "केडेट-नीला" 0099 0100 #, kde-format 0101 msgctxt "color" 0102 msgid "CornflowerBlue" 0103 msgstr "कॉर्नफ्लावर-नीला" 0104 0105 #, kde-format 0106 msgctxt "color" 0107 msgid "DarkBlue" 0108 msgstr "गहरा नीलाः" 0109 0110 #, kde-format 0111 msgctxt "color" 0112 msgid "DarkCyan" 0113 msgstr "गहरा स्याह" 0114 0115 #, kde-format 0116 msgctxt "color" 0117 msgid "DarkGoldenrod" 0118 msgstr "गहरा सुनहला" 0119 0120 #, kde-format 0121 msgctxt "color" 0122 msgid "DarkGoldenrod1" 0123 msgstr "गहरा सुनहला1" 0124 0125 #, kde-format 0126 msgctxt "color" 0127 msgid "DarkGoldenrod2" 0128 msgstr "गहरा सुनहला2" 0129 0130 #, kde-format 0131 msgctxt "color" 0132 msgid "DarkGoldenrod3" 0133 msgstr "गहरा सुनहला3" 0134 0135 #, kde-format 0136 msgctxt "color" 0137 msgid "DarkGoldenrod4" 0138 msgstr "गहरा सुनहला4" 0139 0140 #, kde-format 0141 msgctxt "color" 0142 msgid "DarkGray" 0143 msgstr "गाढ़ा धूसर" 0144 0145 #, kde-format 0146 msgctxt "color" 0147 msgid "DarkGreen" 0148 msgstr "गहरा हरा" 0149 0150 #, kde-format 0151 msgctxt "color" 0152 msgid "DarkGrey" 0153 msgstr "गाढ़ा धूसर" 0154 0155 #, kde-format 0156 msgctxt "color" 0157 msgid "DarkKhaki" 0158 msgstr "गहरा-खाकी" 0159 0160 #, kde-format 0161 msgctxt "color" 0162 msgid "DarkMagenta" 0163 msgstr "मजेंटा" 0164 0165 #, kde-format 0166 msgctxt "color" 0167 msgid "DarkOliveGreen" 0168 msgstr "गहरा-जैतूनी-हरा1" 0169 0170 #, kde-format 0171 msgctxt "color" 0172 msgid "DarkOliveGreen1" 0173 msgstr "गहरा-जैतूनी-हरा1" 0174 0175 #, kde-format 0176 msgctxt "color" 0177 msgid "DarkOliveGreen2" 0178 msgstr "गहरा-जैतूनी-हरा2" 0179 0180 #, kde-format 0181 msgctxt "color" 0182 msgid "DarkOliveGreen3" 0183 msgstr "गहरा-जैतूनी-हरा1" 0184 0185 #, kde-format 0186 msgctxt "color" 0187 msgid "DarkOliveGreen4" 0188 msgstr "गहरा-जैतूनी-हरा1" 0189 0190 #, kde-format 0191 msgctxt "color" 0192 msgid "DarkOrange" 0193 msgstr "नारंगी" 0194 0195 #, kde-format 0196 msgctxt "color" 0197 msgid "DarkOrange1" 0198 msgstr "नारंगी" 0199 0200 #, kde-format 0201 msgctxt "color" 0202 msgid "DarkOrange2" 0203 msgstr "नारंगी" 0204 0205 #, kde-format 0206 msgctxt "color" 0207 msgid "DarkOrange3" 0208 msgstr "नारंगी" 0209 0210 #, kde-format 0211 msgctxt "color" 0212 msgid "DarkOrange4" 0213 msgstr "नारंगी" 0214 0215 #, kde-format 0216 msgctxt "color" 0217 msgid "DarkOrchid" 0218 msgstr "ज्यादा गहरा" 0219 0220 #, kde-format 0221 msgctxt "color" 0222 msgid "DarkOrchid1" 0223 msgstr "गहरा आर्किड1" 0224 0225 #, kde-format 0226 msgctxt "color" 0227 msgid "DarkOrchid2" 0228 msgstr "गहरा आर्किड2" 0229 0230 #, kde-format 0231 msgctxt "color" 0232 msgid "DarkOrchid3" 0233 msgstr "गहरा आर्किड3" 0234 0235 #, kde-format 0236 msgctxt "color" 0237 msgid "DarkOrchid4" 0238 msgstr "गहरा आर्किड4" 0239 0240 #, kde-format 0241 msgctxt "color" 0242 msgid "DarkRed" 0243 msgstr "गहरा लाल" 0244 0245 #, kde-format 0246 msgctxt "color" 0247 msgid "DarkSalmon" 0248 msgstr "गहरा-गेरूऑ" 0249 0250 #, kde-format 0251 msgctxt "color" 0252 msgid "DarkSeaGreen" 0253 msgstr "गहरा-समुद्री-हरा" 0254 0255 #, kde-format 0256 msgctxt "color" 0257 msgid "DarkSeaGreen1" 0258 msgstr "गहरा-समुद्री-हरा1" 0259 0260 #, kde-format 0261 msgctxt "color" 0262 msgid "DarkSeaGreen2" 0263 msgstr "गहरा-समुद्री-हरा2" 0264 0265 #, kde-format 0266 msgctxt "color" 0267 msgid "DarkSeaGreen3" 0268 msgstr "गहरा-समुद्री-हरा3" 0269 0270 #, kde-format 0271 msgctxt "color" 0272 msgid "DarkSeaGreen4" 0273 msgstr "गहरा-समुद्री-हरा4" 0274 0275 #, kde-format 0276 msgctxt "color" 0277 msgid "DarkSlateBlue" 0278 msgstr "स्लेटी-नीला1" 0279 0280 #, kde-format 0281 msgctxt "color" 0282 msgid "DarkSlateGray" 0283 msgstr "गाढ़ा धूसर" 0284 0285 #, kde-format 0286 msgctxt "color" 0287 msgid "DarkSlateGray1" 0288 msgstr "गहरा-स्लेटी-ग्रे1" 0289 0290 #, kde-format 0291 msgctxt "color" 0292 msgid "DarkSlateGray2" 0293 msgstr "गहरा-स्लेटी-ग्रे2" 0294 0295 #, kde-format 0296 msgctxt "color" 0297 msgid "DarkSlateGray3" 0298 msgstr "गहरा-स्लेटी-ग्रे3" 0299 0300 #, kde-format 0301 msgctxt "color" 0302 msgid "DarkSlateGray4" 0303 msgstr "गहरा-स्लेटी-ग्रे1" 0304 0305 #, kde-format 0306 msgctxt "color" 0307 msgid "DarkSlateGrey" 0308 msgstr "गहरा-स्लेटी-ग्रे1" 0309 0310 #, kde-format 0311 msgctxt "color" 0312 msgid "DarkTurquoise" 0313 msgstr "गहरा टर्क्वाइज" 0314 0315 #, kde-format 0316 msgctxt "color" 0317 msgid "DarkViolet" 0318 msgstr "बैंगनी" 0319 0320 #, kde-format 0321 msgctxt "color" 0322 msgid "DeepPink" 0323 msgstr "गहरा" 0324 0325 #, kde-format 0326 msgctxt "color" 0327 msgid "DeepPink1" 0328 msgstr "गहरा" 0329 0330 #, kde-format 0331 msgctxt "color" 0332 msgid "DeepPink2" 0333 msgstr "गहरा" 0334 0335 #, kde-format 0336 msgctxt "color" 0337 msgid "DeepPink3" 0338 msgstr "गहरा" 0339 0340 #, kde-format 0341 msgctxt "color" 0342 msgid "DeepPink4" 0343 msgstr "गहरा" 0344 0345 #, kde-format 0346 msgctxt "color" 0347 msgid "DeepSkyBlue" 0348 msgstr "गहरा नीला" 0349 0350 #, kde-format 0351 msgctxt "color" 0352 msgid "DeepSkyBlue1" 0353 msgstr "गहरा नीला" 0354 0355 #, kde-format 0356 msgctxt "color" 0357 msgid "DeepSkyBlue2" 0358 msgstr "गहरा नीला" 0359 0360 #, kde-format 0361 msgctxt "color" 0362 msgid "DeepSkyBlue3" 0363 msgstr "गहरा नीला" 0364 0365 #, kde-format 0366 msgctxt "color" 0367 msgid "DeepSkyBlue4" 0368 msgstr "गहरा नीला" 0369 0370 #, kde-format 0371 msgctxt "color" 0372 msgid "DimGray" 0373 msgstr "धूसर" 0374 0375 #, kde-format 0376 msgctxt "color" 0377 msgid "DimGrey" 0378 msgstr "डिम-ग्रे" 0379 0380 #, kde-format 0381 msgctxt "color" 0382 msgid "DodgerBlue" 0383 msgstr "गहरा नीला" 0384 0385 #, kde-format 0386 msgctxt "color" 0387 msgid "DodgerBlue1" 0388 msgstr "गहरा नीला" 0389 0390 #, kde-format 0391 msgctxt "color" 0392 msgid "DodgerBlue2" 0393 msgstr "गहरा नीला" 0394 0395 #, kde-format 0396 msgctxt "color" 0397 msgid "DodgerBlue3" 0398 msgstr "गहरा नीला" 0399 0400 #, kde-format 0401 msgctxt "color" 0402 msgid "DodgerBlue4" 0403 msgstr "गहरा नीला" 0404 0405 #, kde-format 0406 msgctxt "color" 0407 msgid "FloralWhite" 0408 msgstr "फ्लोरल-सफेद" 0409 0410 #, kde-format 0411 msgctxt "color" 0412 msgid "ForestGreen" 0413 msgstr "जंगल" 0414 0415 #, kde-format 0416 msgctxt "color" 0417 msgid "GhostWhite" 0418 msgstr "के-घोस्ट-व्यू" 0419 0420 #, kde-format 0421 msgctxt "color" 0422 msgid "GreenYellow" 0423 msgstr "पीला" 0424 0425 #, kde-format 0426 msgctxt "color" 0427 msgid "HotPink" 0428 msgstr "गर्म-गुलाबी" 0429 0430 #, kde-format 0431 msgctxt "color" 0432 msgid "HotPink1" 0433 msgstr "गर्म-गुलाबी1" 0434 0435 #, kde-format 0436 msgctxt "color" 0437 msgid "HotPink2" 0438 msgstr "गर्म-गुलाबी2" 0439 0440 #, kde-format 0441 msgctxt "color" 0442 msgid "HotPink3" 0443 msgstr "गर्म-गुलाबी3" 0444 0445 #, kde-format 0446 msgctxt "color" 0447 msgid "HotPink4" 0448 msgstr "गर्म-गुलाबी4" 0449 0450 #, kde-format 0451 msgctxt "color" 0452 msgid "IndianRed" 0453 msgstr "भारतीयलाल" 0454 0455 #, kde-format 0456 msgctxt "color" 0457 msgid "IndianRed1" 0458 msgstr "इंडियन-रेड1" 0459 0460 #, kde-format 0461 msgctxt "color" 0462 msgid "IndianRed2" 0463 msgstr "इंडियन/माहे" 0464 0465 #, kde-format 0466 msgctxt "color" 0467 msgid "IndianRed3" 0468 msgstr "इंडियन/माहे" 0469 0470 #, kde-format 0471 msgctxt "color" 0472 msgid "IndianRed4" 0473 msgstr "इंडियन/माहे" 0474 0475 #, kde-format 0476 msgctxt "color" 0477 msgid "LavenderBlush" 0478 msgstr "लैवेण्डर-ब्लश" 0479 0480 #, kde-format 0481 msgctxt "color" 0482 msgid "LavenderBlush1" 0483 msgstr "लैवेण्डर-ब्लश1" 0484 0485 #, kde-format 0486 msgctxt "color" 0487 msgid "LavenderBlush2" 0488 msgstr "लैवेण्डर-ब्लश2" 0489 0490 #, kde-format 0491 msgctxt "color" 0492 msgid "LavenderBlush3" 0493 msgstr "लैवेण्डर-ब्लश3" 0494 0495 #, kde-format 0496 msgctxt "color" 0497 msgid "LavenderBlush4" 0498 msgstr "लैवेण्डर-ब्लश4" 0499 0500 #, kde-format 0501 msgctxt "color" 0502 msgid "LawnGreen" 0503 msgstr "हरा" 0504 0505 #, kde-format 0506 msgctxt "color" 0507 msgid "LemonChiffon" 0508 msgstr "लेमन-शिफॉन" 0509 0510 #, kde-format 0511 msgctxt "color" 0512 msgid "LemonChiffon1" 0513 msgstr "लेमन-शिफॉन1" 0514 0515 #, kde-format 0516 msgctxt "color" 0517 msgid "LemonChiffon2" 0518 msgstr "लेमन-शिफॉन2" 0519 0520 #, kde-format 0521 msgctxt "color" 0522 msgid "LemonChiffon3" 0523 msgstr "लेमन-शिफॉन3" 0524 0525 #, kde-format 0526 msgctxt "color" 0527 msgid "LemonChiffon4" 0528 msgstr "लेमन-शिफॉन4" 0529 0530 #, kde-format 0531 msgctxt "color" 0532 msgid "LightBlue" 0533 msgstr "हल्का" 0534 0535 #, kde-format 0536 msgctxt "color" 0537 msgid "LightBlue1" 0538 msgstr "हल्का" 0539 0540 #, kde-format 0541 msgctxt "color" 0542 msgid "LightBlue2" 0543 msgstr "हल्का" 0544 0545 #, kde-format 0546 msgctxt "color" 0547 msgid "LightBlue3" 0548 msgstr "हल्का" 0549 0550 #, kde-format 0551 msgctxt "color" 0552 msgid "LightBlue4" 0553 msgstr "हल्का" 0554 0555 #, kde-format 0556 msgctxt "color" 0557 msgid "LightCoral" 0558 msgstr "हल्के रंग" 0559 0560 #, kde-format 0561 msgctxt "color" 0562 msgid "LightCyan" 0563 msgstr "हल्का" 0564 0565 #, kde-format 0566 msgctxt "color" 0567 msgid "LightCyan1" 0568 msgstr "हल्का-स्यान1" 0569 0570 #, kde-format 0571 msgctxt "color" 0572 msgid "LightCyan2" 0573 msgstr "हल्का-स्यान2" 0574 0575 #, kde-format 0576 msgctxt "color" 0577 msgid "LightCyan3" 0578 msgstr "हल्का-स्यान3" 0579 0580 #, kde-format 0581 msgctxt "color" 0582 msgid "LightCyan4" 0583 msgstr "हल्का-स्यान4" 0584 0585 #, kde-format 0586 msgctxt "color" 0587 msgid "LightGoldenrod" 0588 msgstr "हल्का-सुनहरादंड" 0589 0590 #, kde-format 0591 msgctxt "color" 0592 msgid "LightGoldenrod1" 0593 msgstr "हल्का-सुनहरादंड1" 0594 0595 #, kde-format 0596 msgctxt "color" 0597 msgid "LightGoldenrod2" 0598 msgstr "हल्का-सुनहरादंड2" 0599 0600 #, kde-format 0601 msgctxt "color" 0602 msgid "LightGoldenrod3" 0603 msgstr "हल्का-सुनहरादंड3" 0604 0605 #, kde-format 0606 msgctxt "color" 0607 msgid "LightGoldenrod4" 0608 msgstr "हल्का-सुनहरादंड" 0609 0610 #, kde-format 0611 msgctxt "color" 0612 msgid "LightGoldenrodYellow" 0613 msgstr "हल्का-सुनहरादंड-पीला" 0614 0615 #, kde-format 0616 msgctxt "color" 0617 msgid "LightGray" 0618 msgstr "हल्का धूसर" 0619 0620 #, kde-format 0621 msgctxt "color" 0622 msgid "LightGreen" 0623 msgstr "हल्का हरा" 0624 0625 #, kde-format 0626 msgctxt "color" 0627 msgid "LightGrey" 0628 msgstr "हल्का धूसर" 0629 0630 #, kde-format 0631 msgctxt "color" 0632 msgid "LightPink" 0633 msgstr "बिजली-गिरना" 0634 0635 #, kde-format 0636 msgctxt "color" 0637 msgid "LightPink1" 0638 msgstr "बिजली-गिरना" 0639 0640 #, kde-format 0641 msgctxt "color" 0642 msgid "LightPink2" 0643 msgstr "बिजली-गिरना" 0644 0645 #, kde-format 0646 msgctxt "color" 0647 msgid "LightPink3" 0648 msgstr "बिजली-गिरना" 0649 0650 #, kde-format 0651 msgctxt "color" 0652 msgid "LightPink4" 0653 msgstr "बिजली-गिरना" 0654 0655 #, kde-format 0656 msgctxt "color" 0657 msgid "LightSalmon" 0658 msgstr "हल्का-गेरूऑ" 0659 0660 #, kde-format 0661 msgctxt "color" 0662 msgid "LightSalmon1" 0663 msgstr "हल्का-गेरूऑ1" 0664 0665 #, kde-format 0666 msgctxt "color" 0667 msgid "LightSalmon2" 0668 msgstr "हल्का-गेरूऑ2" 0669 0670 #, kde-format 0671 msgctxt "color" 0672 msgid "LightSalmon3" 0673 msgstr "हल्का-गेरूऑ" 0674 0675 #, kde-format 0676 msgctxt "color" 0677 msgid "LightSalmon4" 0678 msgstr "हल्का-गेरूऑ" 0679 0680 #, kde-format 0681 msgctxt "color" 0682 msgid "LightSeaGreen" 0683 msgstr "हल्का हरा" 0684 0685 #, kde-format 0686 msgctxt "color" 0687 msgid "LightSkyBlue" 0688 msgstr "हल्का-आसमानी" 0689 0690 #, kde-format 0691 msgctxt "color" 0692 msgid "LightSkyBlue1" 0693 msgstr "हल्का-आसमानी1" 0694 0695 #, kde-format 0696 msgctxt "color" 0697 msgid "LightSkyBlue2" 0698 msgstr "हल्का-आसमानी2" 0699 0700 #, kde-format 0701 msgctxt "color" 0702 msgid "LightSkyBlue3" 0703 msgstr "हल्का-आसमानी3" 0704 0705 #, kde-format 0706 msgctxt "color" 0707 msgid "LightSkyBlue4" 0708 msgstr "हल्का-आसमानी" 0709 0710 #, kde-format 0711 msgctxt "color" 0712 msgid "LightSlateBlue" 0713 msgstr "हल्का-स्लेटी-नीला" 0714 0715 #, kde-format 0716 msgctxt "color" 0717 msgid "LightSlateGray" 0718 msgstr "हल्का-स्लेटी-ग्रे" 0719 0720 #, kde-format 0721 msgctxt "color" 0722 msgid "LightSlateGrey" 0723 msgstr "हल्का-स्लेटी-ग्रे" 0724 0725 #, kde-format 0726 msgctxt "color" 0727 msgid "LightSteelBlue" 0728 msgstr "हल्का-स्टील-ब्लू" 0729 0730 #, kde-format 0731 msgctxt "color" 0732 msgid "LightSteelBlue1" 0733 msgstr "हल्का-स्टील-ब्लू1" 0734 0735 #, kde-format 0736 msgctxt "color" 0737 msgid "LightSteelBlue2" 0738 msgstr "हल्का-स्टील-ब्लू12" 0739 0740 #, kde-format 0741 msgctxt "color" 0742 msgid "LightSteelBlue3" 0743 msgstr "हल्का-स्टील-ब्लू13" 0744 0745 #, kde-format 0746 msgctxt "color" 0747 msgid "LightSteelBlue4" 0748 msgstr "हल्का-स्टील-ब्लू14" 0749 0750 #, kde-format 0751 msgctxt "color" 0752 msgid "LightYellow" 0753 msgstr "हल्का-पीला" 0754 0755 #, kde-format 0756 msgctxt "color" 0757 msgid "LightYellow1" 0758 msgstr "हल्का-पीला1" 0759 0760 #, kde-format 0761 msgctxt "color" 0762 msgid "LightYellow2" 0763 msgstr "हल्का-पीला2" 0764 0765 #, kde-format 0766 msgctxt "color" 0767 msgid "LightYellow3" 0768 msgstr "हल्का-पीला3" 0769 0770 #, kde-format 0771 msgctxt "color" 0772 msgid "LightYellow4" 0773 msgstr "हल्का-पीला4" 0774 0775 #, kde-format 0776 msgctxt "color" 0777 msgid "LimeGreen" 0778 msgstr "हरा" 0779 0780 #, kde-format 0781 msgctxt "color" 0782 msgid "MediumAquamarine" 0783 msgstr "मध्यम-अक्वॉमरीन" 0784 0785 #, kde-format 0786 msgctxt "color" 0787 msgid "MediumBlue" 0788 msgstr "मध्यमनीला" 0789 0790 #, kde-format 0791 msgctxt "color" 0792 msgid "MediumOrchid" 0793 msgstr "मध्यम-ऑर्चिड" 0794 0795 #, kde-format 0796 msgctxt "color" 0797 msgid "MediumOrchid1" 0798 msgstr "मध्यम-ऑर्चिड" 0799 0800 #, kde-format 0801 msgctxt "color" 0802 msgid "MediumOrchid2" 0803 msgstr "मध्यम-ऑर्चिड" 0804 0805 #, kde-format 0806 msgctxt "color" 0807 msgid "MediumOrchid3" 0808 msgstr "मध्यम-ऑर्चिड" 0809 0810 #, kde-format 0811 msgctxt "color" 0812 msgid "MediumOrchid4" 0813 msgstr "मध्यम-ऑर्चिड" 0814 0815 #, kde-format 0816 msgctxt "color" 0817 msgid "MediumPurple" 0818 msgstr "मध्यम-जामुनी" 0819 0820 #, kde-format 0821 msgctxt "color" 0822 msgid "MediumPurple1" 0823 msgstr "मध्यम-जामुनी1" 0824 0825 #, kde-format 0826 msgctxt "color" 0827 msgid "MediumPurple2" 0828 msgstr "मध्यम-जामुनी2" 0829 0830 #, kde-format 0831 msgctxt "color" 0832 msgid "MediumPurple3" 0833 msgstr "मध्यम-जामुनी3" 0834 0835 #, kde-format 0836 msgctxt "color" 0837 msgid "MediumPurple4" 0838 msgstr "मध्यम-जामुनी" 0839 0840 #, kde-format 0841 msgctxt "color" 0842 msgid "MediumSeaGreen" 0843 msgstr "प्रसंग चयन" 0844 0845 #, kde-format 0846 msgctxt "color" 0847 msgid "MediumSlateBlue" 0848 msgstr "मध्यम-स्लेटी-नीला" 0849 0850 #, kde-format 0851 msgctxt "color" 0852 msgid "MediumSpringGreen" 0853 msgstr "प्रसंग चयन" 0854 0855 #, kde-format 0856 msgctxt "color" 0857 msgid "MediumTurquoise" 0858 msgstr "मध्यम आउटलाइन" 0859 0860 #, kde-format 0861 msgctxt "color" 0862 msgid "MediumVioletRed" 0863 msgstr "मध्यम फ़ॉन्ट" 0864 0865 #, kde-format 0866 msgctxt "color" 0867 msgid "MidnightBlue" 0868 msgstr "मध्यरात्रि (&M)" 0869 0870 #, kde-format 0871 msgctxt "color" 0872 msgid "MintCream" 0873 msgstr "मिंट-क्रीम" 0874 0875 #, kde-format 0876 msgctxt "color" 0877 msgid "MistyRose" 0878 msgstr "मिस्टी-रोज़" 0879 0880 #, kde-format 0881 msgctxt "color" 0882 msgid "MistyRose1" 0883 msgstr "मिस्टी-रोज़1" 0884 0885 #, kde-format 0886 msgctxt "color" 0887 msgid "MistyRose2" 0888 msgstr "मिस्टी-रोज़2" 0889 0890 #, kde-format 0891 msgctxt "color" 0892 msgid "MistyRose3" 0893 msgstr "मिस्टी-रोज़3" 0894 0895 #, kde-format 0896 msgctxt "color" 0897 msgid "MistyRose4" 0898 msgstr "मिस्टी-रोज़4" 0899 0900 #, kde-format 0901 msgctxt "color" 0902 msgid "NavajoWhite" 0903 msgstr "नवाजो-सफेद" 0904 0905 #, kde-format 0906 msgctxt "color" 0907 msgid "NavajoWhite1" 0908 msgstr "नवाजो-सफेद1" 0909 0910 #, kde-format 0911 msgctxt "color" 0912 msgid "NavajoWhite2" 0913 msgstr "नवाजो-सफेद1" 0914 0915 #, kde-format 0916 msgctxt "color" 0917 msgid "NavajoWhite3" 0918 msgstr "नवाजो-सफेद1" 0919 0920 #, kde-format 0921 msgctxt "color" 0922 msgid "NavajoWhite4" 0923 msgstr "नवाजो-सफेद" 0924 0925 #, kde-format 0926 msgctxt "color" 0927 msgid "NavyBlue" 0928 msgstr "नीला" 0929 0930 #, kde-format 0931 msgctxt "color" 0932 msgid "OldLace" 0933 msgstr "ओल्ड-लेस" 0934 0935 #, kde-format 0936 msgctxt "color" 0937 msgid "OliveDrab" 0938 msgstr "लाइव" 0939 0940 #, kde-format 0941 msgctxt "color" 0942 msgid "OliveDrab1" 0943 msgstr "जैतूनड्रैब1" 0944 0945 #, kde-format 0946 msgctxt "color" 0947 msgid "OliveDrab2" 0948 msgstr "जैतूनड्रैब2" 0949 0950 #, kde-format 0951 msgctxt "color" 0952 msgid "OliveDrab3" 0953 msgstr "जैतूनड्रैब3" 0954 0955 #, kde-format 0956 msgctxt "color" 0957 msgid "OliveDrab4" 0958 msgstr "जैतूनड्रैब4" 0959 0960 #, kde-format 0961 msgctxt "color" 0962 msgid "OrangeRed" 0963 msgstr "नारंगी लाल" 0964 0965 #, kde-format 0966 msgctxt "color" 0967 msgid "OrangeRed1" 0968 msgstr "नारंगी लाल1" 0969 0970 #, kde-format 0971 msgctxt "color" 0972 msgid "OrangeRed2" 0973 msgstr "नारंगी लाल2" 0974 0975 #, kde-format 0976 msgctxt "color" 0977 msgid "OrangeRed3" 0978 msgstr "नारंगी लाल3" 0979 0980 #, kde-format 0981 msgctxt "color" 0982 msgid "OrangeRed4" 0983 msgstr "नारंगी लाल4" 0984 0985 #, kde-format 0986 msgctxt "color" 0987 msgid "PaleGoldenrod" 0988 msgstr "फ़ीका-स्वर्णदण्ड" 0989 0990 #, kde-format 0991 msgctxt "color" 0992 msgid "PaleGreen" 0993 msgstr "हरा" 0994 0995 #, kde-format 0996 msgctxt "color" 0997 msgid "PaleGreen1" 0998 msgstr "फ़ीका-हरा1" 0999 1000 #, kde-format 1001 msgctxt "color" 1002 msgid "PaleGreen2" 1003 msgstr "फ़ीका-हरा2" 1004 1005 #, kde-format 1006 msgctxt "color" 1007 msgid "PaleGreen3" 1008 msgstr "फ़ीका-हरा3" 1009 1010 #, kde-format 1011 msgctxt "color" 1012 msgid "PaleGreen4" 1013 msgstr "हरा" 1014 1015 #, kde-format 1016 msgctxt "color" 1017 msgid "PaleTurquoise" 1018 msgstr "फ़ीका-टर्किश" 1019 1020 #, kde-format 1021 msgctxt "color" 1022 msgid "PaleTurquoise1" 1023 msgstr "फ़ीका-टर्किश" 1024 1025 #, kde-format 1026 msgctxt "color" 1027 msgid "PaleTurquoise2" 1028 msgstr "फ़ीका-टर्किश" 1029 1030 #, kde-format 1031 msgctxt "color" 1032 msgid "PaleTurquoise3" 1033 msgstr "फ़ीका-टर्किश" 1034 1035 #, kde-format 1036 msgctxt "color" 1037 msgid "PaleTurquoise4" 1038 msgstr "फ़ीका-टर्किश" 1039 1040 #, kde-format 1041 msgctxt "color" 1042 msgid "PaleVioletRed" 1043 msgstr "फ़ीका-बैंगनी-लाल" 1044 1045 #, kde-format 1046 msgctxt "color" 1047 msgid "PaleVioletRed1" 1048 msgstr "फ़ीका-बैंगनी-लाल1" 1049 1050 #, kde-format 1051 msgctxt "color" 1052 msgid "PaleVioletRed2" 1053 msgstr "फ़ीका-बैंगनी-लाल2" 1054 1055 #, kde-format 1056 msgctxt "color" 1057 msgid "PaleVioletRed3" 1058 msgstr "फ़ीका-बैंगनी-लाल3" 1059 1060 #, kde-format 1061 msgctxt "color" 1062 msgid "PaleVioletRed4" 1063 msgstr "फ़ीका-बैंगनी-लाल" 1064 1065 #, kde-format 1066 msgctxt "color" 1067 msgid "PapayaWhip" 1068 msgstr "पापाया-व्हिप" 1069 1070 #, kde-format 1071 msgctxt "color" 1072 msgid "PeachPuff" 1073 msgstr "पीच-पफ़" 1074 1075 #, kde-format 1076 msgctxt "color" 1077 msgid "PeachPuff1" 1078 msgstr "पीच-पफ़1" 1079 1080 #, kde-format 1081 msgctxt "color" 1082 msgid "PeachPuff2" 1083 msgstr "पीच-पफ़2" 1084 1085 #, kde-format 1086 msgctxt "color" 1087 msgid "PeachPuff3" 1088 msgstr "पीच-पफ़3" 1089 1090 #, kde-format 1091 msgctxt "color" 1092 msgid "PeachPuff4" 1093 msgstr "पीच-पफ़4" 1094 1095 #, kde-format 1096 msgctxt "color" 1097 msgid "PowderBlue" 1098 msgstr "पाउडर-नीला" 1099 1100 #, kde-format 1101 msgctxt "color" 1102 msgid "RosyBrown" 1103 msgstr "रोजी-ब्राउन" 1104 1105 #, kde-format 1106 msgctxt "color" 1107 msgid "RosyBrown1" 1108 msgstr "रोजी-ब्राउन1" 1109 1110 #, kde-format 1111 msgctxt "color" 1112 msgid "RosyBrown2" 1113 msgstr "रोजी-ब्राउन2" 1114 1115 #, kde-format 1116 msgctxt "color" 1117 msgid "RosyBrown3" 1118 msgstr "रोजी-ब्राउन3" 1119 1120 #, kde-format 1121 msgctxt "color" 1122 msgid "RosyBrown4" 1123 msgstr "रोजी-ब्राउन4" 1124 1125 #, kde-format 1126 msgctxt "color" 1127 msgid "RoyalBlue" 1128 msgstr "रॉयल फ्लश" 1129 1130 #, kde-format 1131 msgctxt "color" 1132 msgid "RoyalBlue1" 1133 msgstr "रॉयल फ्लश" 1134 1135 #, kde-format 1136 msgctxt "color" 1137 msgid "RoyalBlue2" 1138 msgstr "रॉयल फ्लश" 1139 1140 #, kde-format 1141 msgctxt "color" 1142 msgid "RoyalBlue3" 1143 msgstr "रॉयल फ्लश" 1144 1145 #, kde-format 1146 msgctxt "color" 1147 msgid "RoyalBlue4" 1148 msgstr "रॉयल फ्लश" 1149 1150 #, kde-format 1151 msgctxt "color" 1152 msgid "SaddleBrown" 1153 msgstr "सैडल भूरा" 1154 1155 #, kde-format 1156 msgctxt "color" 1157 msgid "SandyBrown" 1158 msgstr "भूराः" 1159 1160 #, kde-format 1161 msgctxt "color" 1162 msgid "SeaGreen" 1163 msgstr "हरा" 1164 1165 #, kde-format 1166 msgctxt "color" 1167 msgid "SeaGreen1" 1168 msgstr "हरा" 1169 1170 #, kde-format 1171 msgctxt "color" 1172 msgid "SeaGreen2" 1173 msgstr "हरा" 1174 1175 #, kde-format 1176 msgctxt "color" 1177 msgid "SeaGreen3" 1178 msgstr "हरा" 1179 1180 #, kde-format 1181 msgctxt "color" 1182 msgid "SeaGreen4" 1183 msgstr "हरा" 1184 1185 #, kde-format 1186 msgctxt "color" 1187 msgid "SkyBlue" 1188 msgstr "नीला" 1189 1190 #, kde-format 1191 msgctxt "color" 1192 msgid "SkyBlue1" 1193 msgstr "नीला" 1194 1195 #, kde-format 1196 msgctxt "color" 1197 msgid "SkyBlue2" 1198 msgstr "नीला" 1199 1200 #, kde-format 1201 msgctxt "color" 1202 msgid "SkyBlue3" 1203 msgstr "नीला" 1204 1205 #, kde-format 1206 msgctxt "color" 1207 msgid "SkyBlue4" 1208 msgstr "नीला" 1209 1210 #, kde-format 1211 msgctxt "color" 1212 msgid "SlateBlue" 1213 msgstr "स्लेटी-नीला1" 1214 1215 #, kde-format 1216 msgctxt "color" 1217 msgid "SlateBlue1" 1218 msgstr "स्लेटी-नीला1" 1219 1220 #, kde-format 1221 msgctxt "color" 1222 msgid "SlateBlue2" 1223 msgstr "स्लेटी-नीला2" 1224 1225 #, kde-format 1226 msgctxt "color" 1227 msgid "SlateBlue3" 1228 msgstr "स्लेटी-नीला1" 1229 1230 #, kde-format 1231 msgctxt "color" 1232 msgid "SlateBlue4" 1233 msgstr "स्लेटी-नीला1" 1234 1235 #, kde-format 1236 msgctxt "color" 1237 msgid "SlateGray" 1238 msgstr "स्लेटी-ग्रे" 1239 1240 #, kde-format 1241 msgctxt "color" 1242 msgid "SlateGray1" 1243 msgstr "स्लेटी-ग्रे1" 1244 1245 #, kde-format 1246 msgctxt "color" 1247 msgid "SlateGray2" 1248 msgstr "स्लेटी-ग्रे2" 1249 1250 #, kde-format 1251 msgctxt "color" 1252 msgid "SlateGray3" 1253 msgstr "स्लेटी-ग्रे3" 1254 1255 #, kde-format 1256 msgctxt "color" 1257 msgid "SlateGray4" 1258 msgstr "स्लेटी-ग्रे4" 1259 1260 #, kde-format 1261 msgctxt "color" 1262 msgid "SlateGrey" 1263 msgstr "स्लेटी-ग्रे" 1264 1265 #, kde-format 1266 msgctxt "color" 1267 msgid "SpringGreen" 1268 msgstr "स्प्रिंगीनेस" 1269 1270 #, kde-format 1271 msgctxt "color" 1272 msgid "SpringGreen1" 1273 msgstr "स्प्रिंगीनेस" 1274 1275 #, kde-format 1276 msgctxt "color" 1277 msgid "SpringGreen2" 1278 msgstr "स्प्रिंगीनेस" 1279 1280 #, kde-format 1281 msgctxt "color" 1282 msgid "SpringGreen3" 1283 msgstr "स्प्रिंगीनेस" 1284 1285 #, kde-format 1286 msgctxt "color" 1287 msgid "SpringGreen4" 1288 msgstr "स्प्रिंगीनेस" 1289 1290 #, kde-format 1291 msgctxt "color" 1292 msgid "SteelBlue" 1293 msgstr "गहरा नीला" 1294 1295 #, kde-format 1296 msgctxt "color" 1297 msgid "SteelBlue1" 1298 msgstr "गहरा नीला" 1299 1300 #, kde-format 1301 msgctxt "color" 1302 msgid "SteelBlue2" 1303 msgstr "गहरा नीला" 1304 1305 #, kde-format 1306 msgctxt "color" 1307 msgid "SteelBlue3" 1308 msgstr "गहरा नीला" 1309 1310 #, kde-format 1311 msgctxt "color" 1312 msgid "SteelBlue4" 1313 msgstr "गहरा नीला" 1314 1315 #, kde-format 1316 msgctxt "color" 1317 msgid "VioletRed" 1318 msgstr "बैंगनी" 1319 1320 #, kde-format 1321 msgctxt "color" 1322 msgid "VioletRed1" 1323 msgstr "बैंगनी" 1324 1325 #, kde-format 1326 msgctxt "color" 1327 msgid "VioletRed2" 1328 msgstr "बैंगनी" 1329 1330 #, kde-format 1331 msgctxt "color" 1332 msgid "VioletRed3" 1333 msgstr "बैंगनी" 1334 1335 #, kde-format 1336 msgctxt "color" 1337 msgid "VioletRed4" 1338 msgstr "बैंगनी" 1339 1340 #, kde-format 1341 msgctxt "color" 1342 msgid "WhiteSmoke" 1343 msgstr "धुँधला-सफेद" 1344 1345 #, kde-format 1346 msgctxt "color" 1347 msgid "YellowGreen" 1348 msgstr "पीला" 1349 1350 #, kde-format 1351 msgctxt "color" 1352 msgid "aquamarine" 1353 msgstr "अक्वॉमरीन" 1354 1355 #, kde-format 1356 msgctxt "color" 1357 msgid "aquamarine1" 1358 msgstr "अक्वॉमरीन1" 1359 1360 #, kde-format 1361 msgctxt "color" 1362 msgid "aquamarine2" 1363 msgstr "अक्वॉमरीन2" 1364 1365 #, kde-format 1366 msgctxt "color" 1367 msgid "aquamarine3" 1368 msgstr "अक्वॉमरीन3" 1369 1370 #, kde-format 1371 msgctxt "color" 1372 msgid "aquamarine4" 1373 msgstr "अक्वॉमरीन" 1374 1375 #, kde-format 1376 msgctxt "color" 1377 msgid "azure" 1378 msgstr "एजुएर" 1379 1380 #, kde-format 1381 msgctxt "color" 1382 msgid "azure1" 1383 msgstr "एजुएर1" 1384 1385 #, kde-format 1386 msgctxt "color" 1387 msgid "azure2" 1388 msgstr "एजुएर2" 1389 1390 #, kde-format 1391 msgctxt "color" 1392 msgid "azure3" 1393 msgstr "एजुएर3" 1394 1395 #, kde-format 1396 msgctxt "color" 1397 msgid "azure4" 1398 msgstr "एजुएर4" 1399 1400 #, kde-format 1401 msgctxt "color" 1402 msgid "beige" 1403 msgstr "बीज" 1404 1405 #, kde-format 1406 msgctxt "color" 1407 msgid "bisque" 1408 msgstr "बास्क" 1409 1410 #, kde-format 1411 msgctxt "color" 1412 msgid "bisque1" 1413 msgstr "बास्क" 1414 1415 #, kde-format 1416 msgctxt "color" 1417 msgid "bisque2" 1418 msgstr "बास्क" 1419 1420 #, kde-format 1421 msgctxt "color" 1422 msgid "bisque3" 1423 msgstr "बास्क" 1424 1425 #, kde-format 1426 msgctxt "color" 1427 msgid "bisque4" 1428 msgstr "बास्क" 1429 1430 #, kde-format 1431 msgctxt "color" 1432 msgid "black" 1433 msgstr "काला" 1434 1435 #, kde-format 1436 msgctxt "color" 1437 msgid "blue" 1438 msgstr "नीलाः" 1439 1440 #, kde-format 1441 msgctxt "color" 1442 msgid "blue1" 1443 msgstr "नीलाः" 1444 1445 #, kde-format 1446 msgctxt "color" 1447 msgid "blue2" 1448 msgstr "नीलाः" 1449 1450 #, kde-format 1451 msgctxt "color" 1452 msgid "blue3" 1453 msgstr "नीलाः" 1454 1455 #, kde-format 1456 msgctxt "color" 1457 msgid "blue4" 1458 msgstr "नीलाः" 1459 1460 #, kde-format 1461 msgctxt "color" 1462 msgid "brown" 1463 msgstr "भूराः" 1464 1465 #, kde-format 1466 msgctxt "color" 1467 msgid "brown1" 1468 msgstr "भूराः" 1469 1470 #, kde-format 1471 msgctxt "color" 1472 msgid "brown2" 1473 msgstr "भूराः" 1474 1475 #, kde-format 1476 msgctxt "color" 1477 msgid "brown3" 1478 msgstr "भूराः" 1479 1480 #, kde-format 1481 msgctxt "color" 1482 msgid "brown4" 1483 msgstr "भूराः" 1484 1485 #, kde-format 1486 msgctxt "color" 1487 msgid "burlywood" 1488 msgstr "बर्ली-वुड" 1489 1490 #, kde-format 1491 msgctxt "color" 1492 msgid "burlywood1" 1493 msgstr "बर्ली-वुड1" 1494 1495 #, kde-format 1496 msgctxt "color" 1497 msgid "burlywood2" 1498 msgstr "बर्ली-वुड2" 1499 1500 #, kde-format 1501 msgctxt "color" 1502 msgid "burlywood3" 1503 msgstr "बर्ली-वुड3" 1504 1505 #, kde-format 1506 msgctxt "color" 1507 msgid "burlywood4" 1508 msgstr "बर्ली-वुड" 1509 1510 #, kde-format 1511 msgctxt "color" 1512 msgid "chartreuse" 1513 msgstr "चार्टरेयूस" 1514 1515 #, kde-format 1516 msgctxt "color" 1517 msgid "chartreuse1" 1518 msgstr "चार्टरेयूस1" 1519 1520 #, kde-format 1521 msgctxt "color" 1522 msgid "chartreuse2" 1523 msgstr "चार्टरेयूस2" 1524 1525 #, kde-format 1526 msgctxt "color" 1527 msgid "chartreuse3" 1528 msgstr "चार्टरेयूस3" 1529 1530 #, kde-format 1531 msgctxt "color" 1532 msgid "chartreuse4" 1533 msgstr "चार्टरेयूस4" 1534 1535 #, kde-format 1536 msgctxt "color" 1537 msgid "chocolate" 1538 msgstr "चाकलेट" 1539 1540 #, kde-format 1541 msgctxt "color" 1542 msgid "chocolate1" 1543 msgstr "चाकलेट1" 1544 1545 #, kde-format 1546 msgctxt "color" 1547 msgid "chocolate2" 1548 msgstr "चाकलेट2" 1549 1550 #, kde-format 1551 msgctxt "color" 1552 msgid "chocolate3" 1553 msgstr "चाकलेट3" 1554 1555 #, kde-format 1556 msgctxt "color" 1557 msgid "chocolate4" 1558 msgstr "चाकलेट4" 1559 1560 #, kde-format 1561 msgctxt "color" 1562 msgid "coral" 1563 msgstr "मूंगा" 1564 1565 #, kde-format 1566 msgctxt "color" 1567 msgid "coral1" 1568 msgstr "मूंगा" 1569 1570 #, kde-format 1571 msgctxt "color" 1572 msgid "coral2" 1573 msgstr "मूंगा" 1574 1575 #, kde-format 1576 msgctxt "color" 1577 msgid "coral3" 1578 msgstr "मूंगा" 1579 1580 #, kde-format 1581 msgctxt "color" 1582 msgid "coral4" 1583 msgstr "मूंगा" 1584 1585 #, kde-format 1586 msgctxt "color" 1587 msgid "cornsilk" 1588 msgstr "कॉर्न-सिल्क" 1589 1590 #, kde-format 1591 msgctxt "color" 1592 msgid "cornsilk1" 1593 msgstr "कार्न-सिल्क1" 1594 1595 #, kde-format 1596 msgctxt "color" 1597 msgid "cornsilk2" 1598 msgstr "कार्नसिल्क2" 1599 1600 #, kde-format 1601 msgctxt "color" 1602 msgid "cornsilk3" 1603 msgstr "कार्नसिल्क3" 1604 1605 #, kde-format 1606 msgctxt "color" 1607 msgid "cornsilk4" 1608 msgstr "कार्नसिल्क4" 1609 1610 #, kde-format 1611 msgctxt "color" 1612 msgid "cyan" 1613 msgstr "स्याह" 1614 1615 #, kde-format 1616 msgctxt "color" 1617 msgid "cyan1" 1618 msgstr "स्याह1" 1619 1620 #, kde-format 1621 msgctxt "color" 1622 msgid "cyan2" 1623 msgstr "स्याह2" 1624 1625 #, kde-format 1626 msgctxt "color" 1627 msgid "cyan3" 1628 msgstr "स्याह3" 1629 1630 #, kde-format 1631 msgctxt "color" 1632 msgid "cyan4" 1633 msgstr "स्याह4" 1634 1635 #, kde-format 1636 msgctxt "color" 1637 msgid "firebrick" 1638 msgstr "आगिकईँट" 1639 1640 #, kde-format 1641 msgctxt "color" 1642 msgid "firebrick1" 1643 msgstr "आगिकईँट1" 1644 1645 #, kde-format 1646 msgctxt "color" 1647 msgid "firebrick2" 1648 msgstr "आगिकईँट2" 1649 1650 #, kde-format 1651 msgctxt "color" 1652 msgid "firebrick3" 1653 msgstr "आगिकईँट3" 1654 1655 #, kde-format 1656 msgctxt "color" 1657 msgid "firebrick4" 1658 msgstr "आगिकईँट4" 1659 1660 #, kde-format 1661 msgctxt "color" 1662 msgid "gainsboro" 1663 msgstr "gainsboro" 1664 1665 #, kde-format 1666 msgctxt "color" 1667 msgid "gold" 1668 msgstr "सुनहला" 1669 1670 #, kde-format 1671 msgctxt "color" 1672 msgid "gold1" 1673 msgstr "सुनहला1" 1674 1675 #, kde-format 1676 msgctxt "color" 1677 msgid "gold2" 1678 msgstr "सुनहला2" 1679 1680 #, kde-format 1681 msgctxt "color" 1682 msgid "gold3" 1683 msgstr "सुनहला3" 1684 1685 #, kde-format 1686 msgctxt "color" 1687 msgid "gold4" 1688 msgstr "सुनहला4" 1689 1690 #, kde-format 1691 msgctxt "color" 1692 msgid "goldenrod" 1693 msgstr "सुनहलाछड़" 1694 1695 #, kde-format 1696 msgctxt "color" 1697 msgid "goldenrod1" 1698 msgstr "सुनहलाछड़1" 1699 1700 #, kde-format 1701 msgctxt "color" 1702 msgid "goldenrod2" 1703 msgstr "सुनहलाछड़2" 1704 1705 #, kde-format 1706 msgctxt "color" 1707 msgid "goldenrod3" 1708 msgstr "सुनहलाछड़3" 1709 1710 #, kde-format 1711 msgctxt "color" 1712 msgid "goldenrod4" 1713 msgstr "सुनहलाछड़4" 1714 1715 #, kde-format 1716 msgctxt "color" 1717 msgid "green" 1718 msgstr "हरिहर" 1719 1720 #, kde-format 1721 msgctxt "color" 1722 msgid "green1" 1723 msgstr "हरिहर1" 1724 1725 #, kde-format 1726 msgctxt "color" 1727 msgid "green2" 1728 msgstr "हरिहर2" 1729 1730 #, kde-format 1731 msgctxt "color" 1732 msgid "green3" 1733 msgstr "हरिहर3" 1734 1735 #, kde-format 1736 msgctxt "color" 1737 msgid "green4" 1738 msgstr "हरिहर4" 1739 1740 #, kde-format 1741 msgctxt "color" 1742 msgid "honeydew" 1743 msgstr "मौधबूंद" 1744 1745 #, kde-format 1746 msgctxt "color" 1747 msgid "honeydew1" 1748 msgstr "मौधबूंद1" 1749 1750 #, kde-format 1751 msgctxt "color" 1752 msgid "honeydew2" 1753 msgstr "मौधबूंद2" 1754 1755 #, kde-format 1756 msgctxt "color" 1757 msgid "honeydew3" 1758 msgstr "मौधबूंद3" 1759 1760 #, kde-format 1761 msgctxt "color" 1762 msgid "honeydew4" 1763 msgstr "मौधबूंद4" 1764 1765 #, kde-format 1766 msgctxt "color" 1767 msgid "ivory" 1768 msgstr "आइवरी" 1769 1770 #, kde-format 1771 msgctxt "color" 1772 msgid "ivory1" 1773 msgstr "आइवरी1" 1774 1775 #, kde-format 1776 msgctxt "color" 1777 msgid "ivory2" 1778 msgstr "आइवरी2" 1779 1780 #, kde-format 1781 msgctxt "color" 1782 msgid "ivory3" 1783 msgstr "आइवरी3" 1784 1785 #, kde-format 1786 msgctxt "color" 1787 msgid "ivory4" 1788 msgstr "आइवरी4" 1789 1790 #, kde-format 1791 msgctxt "color" 1792 msgid "khaki" 1793 msgstr "खाकी" 1794 1795 #, kde-format 1796 msgctxt "color" 1797 msgid "khaki1" 1798 msgstr "खाकी1" 1799 1800 #, kde-format 1801 msgctxt "color" 1802 msgid "khaki2" 1803 msgstr "खाकी2" 1804 1805 #, kde-format 1806 msgctxt "color" 1807 msgid "khaki3" 1808 msgstr "खाकी3" 1809 1810 #, kde-format 1811 msgctxt "color" 1812 msgid "khaki4" 1813 msgstr "खाकी4" 1814 1815 #, kde-format 1816 msgctxt "color" 1817 msgid "lavender" 1818 msgstr "लैवेंडर" 1819 1820 #, kde-format 1821 msgctxt "color" 1822 msgid "linen" 1823 msgstr "लाइलन" 1824 1825 #, kde-format 1826 msgctxt "color" 1827 msgid "magenta" 1828 msgstr "मैंजेटा" 1829 1830 #, kde-format 1831 msgctxt "color" 1832 msgid "magenta1" 1833 msgstr "मैंजेटा1" 1834 1835 #, kde-format 1836 msgctxt "color" 1837 msgid "magenta2" 1838 msgstr "मैंजेटा2" 1839 1840 #, kde-format 1841 msgctxt "color" 1842 msgid "magenta3" 1843 msgstr "मैंजेटा3" 1844 1845 #, kde-format 1846 msgctxt "color" 1847 msgid "magenta4" 1848 msgstr "मैंजेटा4" 1849 1850 #, kde-format 1851 msgctxt "color" 1852 msgid "maroon" 1853 msgstr "मेरून" 1854 1855 #, kde-format 1856 msgctxt "color" 1857 msgid "maroon1" 1858 msgstr "मेरून1" 1859 1860 #, kde-format 1861 msgctxt "color" 1862 msgid "maroon2" 1863 msgstr "मेरून2" 1864 1865 #, kde-format 1866 msgctxt "color" 1867 msgid "maroon3" 1868 msgstr "मेरून3" 1869 1870 #, kde-format 1871 msgctxt "color" 1872 msgid "maroon4" 1873 msgstr "मेरून4" 1874 1875 #, kde-format 1876 msgctxt "color" 1877 msgid "moccasin" 1878 msgstr "मोकासिन" 1879 1880 #, kde-format 1881 msgctxt "color" 1882 msgid "navy" 1883 msgstr "नेवी" 1884 1885 #, kde-format 1886 msgctxt "color" 1887 msgid "orange" 1888 msgstr "नारंगी" 1889 1890 #, kde-format 1891 msgctxt "color" 1892 msgid "orange1" 1893 msgstr "नारंगी1" 1894 1895 #, kde-format 1896 msgctxt "color" 1897 msgid "orange2" 1898 msgstr "नारंगी2" 1899 1900 #, kde-format 1901 msgctxt "color" 1902 msgid "orange3" 1903 msgstr "नारंगी3" 1904 1905 #, kde-format 1906 msgctxt "color" 1907 msgid "orange4" 1908 msgstr "नारंगी4" 1909 1910 #, kde-format 1911 msgctxt "color" 1912 msgid "orchid" 1913 msgstr "आर्किड" 1914 1915 #, kde-format 1916 msgctxt "color" 1917 msgid "orchid1" 1918 msgstr "आर्किड1" 1919 1920 #, kde-format 1921 msgctxt "color" 1922 msgid "orchid2" 1923 msgstr "आर्किड2" 1924 1925 #, kde-format 1926 msgctxt "color" 1927 msgid "orchid3" 1928 msgstr "आर्किड3" 1929 1930 #, kde-format 1931 msgctxt "color" 1932 msgid "orchid4" 1933 msgstr "आर्किड4" 1934 1935 #, kde-format 1936 msgctxt "color" 1937 msgid "peru" 1938 msgstr "पेरू" 1939 1940 #, kde-format 1941 msgctxt "color" 1942 msgid "pink" 1943 msgstr "गुलाबी" 1944 1945 #, kde-format 1946 msgctxt "color" 1947 msgid "pink1" 1948 msgstr "गुलाबी1" 1949 1950 #, kde-format 1951 msgctxt "color" 1952 msgid "pink2" 1953 msgstr "गुलाबी2" 1954 1955 #, kde-format 1956 msgctxt "color" 1957 msgid "pink3" 1958 msgstr "गुलाबी3" 1959 1960 #, kde-format 1961 msgctxt "color" 1962 msgid "pink4" 1963 msgstr "गुलाबी4" 1964 1965 #, kde-format 1966 msgctxt "color" 1967 msgid "plum" 1968 msgstr "प्लम" 1969 1970 #, kde-format 1971 msgctxt "color" 1972 msgid "plum1" 1973 msgstr "प्लम1" 1974 1975 #, kde-format 1976 msgctxt "color" 1977 msgid "plum2" 1978 msgstr "प्लम2" 1979 1980 #, kde-format 1981 msgctxt "color" 1982 msgid "plum3" 1983 msgstr "प्लम3" 1984 1985 #, kde-format 1986 msgctxt "color" 1987 msgid "plum4" 1988 msgstr "प्लम4" 1989 1990 #, kde-format 1991 msgctxt "color" 1992 msgid "purple" 1993 msgstr "बैंगनी" 1994 1995 #, kde-format 1996 msgctxt "color" 1997 msgid "purple1" 1998 msgstr "बैंगनी1" 1999 2000 #, kde-format 2001 msgctxt "color" 2002 msgid "purple2" 2003 msgstr "बैंगनी2" 2004 2005 #, kde-format 2006 msgctxt "color" 2007 msgid "purple3" 2008 msgstr "बैंगनी3" 2009 2010 #, kde-format 2011 msgctxt "color" 2012 msgid "purple4" 2013 msgstr "बैंगनी4" 2014 2015 #, fuzzy, kde-format 2016 msgctxt "color" 2017 msgid "red" 2018 msgstr "बुध" 2019 2020 #, kde-format 2021 msgctxt "color" 2022 msgid "red1" 2023 msgstr "लाल1" 2024 2025 #, kde-format 2026 msgctxt "color" 2027 msgid "red2" 2028 msgstr "लाल2" 2029 2030 #, kde-format 2031 msgctxt "color" 2032 msgid "red3" 2033 msgstr "लाल3" 2034 2035 #, kde-format 2036 msgctxt "color" 2037 msgid "red4" 2038 msgstr "लाल4" 2039 2040 #, kde-format 2041 msgctxt "color" 2042 msgid "salmon" 2043 msgstr "सालमन" 2044 2045 #, kde-format 2046 msgctxt "color" 2047 msgid "salmon1" 2048 msgstr "सालमन1" 2049 2050 #, kde-format 2051 msgctxt "color" 2052 msgid "salmon2" 2053 msgstr "सालमन2" 2054 2055 #, kde-format 2056 msgctxt "color" 2057 msgid "salmon3" 2058 msgstr "सालमन3" 2059 2060 #, kde-format 2061 msgctxt "color" 2062 msgid "salmon4" 2063 msgstr "सालमन4" 2064 2065 #, kde-format 2066 msgctxt "color" 2067 msgid "seashell" 2068 msgstr "समुद्रीकवच" 2069 2070 #, kde-format 2071 msgctxt "color" 2072 msgid "seashell1" 2073 msgstr "समुद्रीकवच1" 2074 2075 #, kde-format 2076 msgctxt "color" 2077 msgid "seashell2" 2078 msgstr "समुद्रीकवच2" 2079 2080 #, kde-format 2081 msgctxt "color" 2082 msgid "seashell3" 2083 msgstr "समुद्रीकवच3" 2084 2085 #, kde-format 2086 msgctxt "color" 2087 msgid "seashell4" 2088 msgstr "समुद्रीकवच4" 2089 2090 #, kde-format 2091 msgctxt "color" 2092 msgid "sienna" 2093 msgstr "सियना" 2094 2095 #, kde-format 2096 msgctxt "color" 2097 msgid "sienna1" 2098 msgstr "सियना1" 2099 2100 #, kde-format 2101 msgctxt "color" 2102 msgid "sienna2" 2103 msgstr "सियना2" 2104 2105 #, kde-format 2106 msgctxt "color" 2107 msgid "sienna3" 2108 msgstr "सियना3" 2109 2110 #, kde-format 2111 msgctxt "color" 2112 msgid "sienna4" 2113 msgstr "सियना4" 2114 2115 #, kde-format 2116 msgctxt "color" 2117 msgid "snow" 2118 msgstr "बरफ" 2119 2120 #, kde-format 2121 msgctxt "color" 2122 msgid "snow1" 2123 msgstr "बरफ1" 2124 2125 #, kde-format 2126 msgctxt "color" 2127 msgid "snow2" 2128 msgstr "बरफ2" 2129 2130 #, kde-format 2131 msgctxt "color" 2132 msgid "snow3" 2133 msgstr "बरफ3" 2134 2135 #, kde-format 2136 msgctxt "color" 2137 msgid "snow4" 2138 msgstr "बरफ4" 2139 2140 #, fuzzy, kde-format 2141 msgctxt "color" 2142 msgid "tan" 2143 msgstr "जनवरी" 2144 2145 #, kde-format 2146 msgctxt "color" 2147 msgid "tan1" 2148 msgstr "टैन1" 2149 2150 #, kde-format 2151 msgctxt "color" 2152 msgid "tan2" 2153 msgstr "टैन2" 2154 2155 #, kde-format 2156 msgctxt "color" 2157 msgid "tan3" 2158 msgstr "टैन3" 2159 2160 #, kde-format 2161 msgctxt "color" 2162 msgid "tan4" 2163 msgstr "टैन4" 2164 2165 #, kde-format 2166 msgctxt "color" 2167 msgid "thistle" 2168 msgstr "thistle" 2169 2170 #, kde-format 2171 msgctxt "color" 2172 msgid "thistle1" 2173 msgstr "thistle1" 2174 2175 #, kde-format 2176 msgctxt "color" 2177 msgid "thistle2" 2178 msgstr "thistle2" 2179 2180 #, kde-format 2181 msgctxt "color" 2182 msgid "thistle3" 2183 msgstr "thistle3" 2184 2185 #, kde-format 2186 msgctxt "color" 2187 msgid "thistle4" 2188 msgstr "thistle4" 2189 2190 #, kde-format 2191 msgctxt "color" 2192 msgid "tomato" 2193 msgstr "टमाटर" 2194 2195 #, kde-format 2196 msgctxt "color" 2197 msgid "tomato1" 2198 msgstr "टमाटर1" 2199 2200 #, kde-format 2201 msgctxt "color" 2202 msgid "tomato2" 2203 msgstr "टमाटर2" 2204 2205 #, kde-format 2206 msgctxt "color" 2207 msgid "tomato3" 2208 msgstr "टमाटर3" 2209 2210 #, kde-format 2211 msgctxt "color" 2212 msgid "tomato4" 2213 msgstr "टमाटर4" 2214 2215 #, kde-format 2216 msgctxt "color" 2217 msgid "turquoise" 2218 msgstr "टर्कवाइज" 2219 2220 #, kde-format 2221 msgctxt "color" 2222 msgid "turquoise1" 2223 msgstr "टर्कवाइज1" 2224 2225 #, kde-format 2226 msgctxt "color" 2227 msgid "turquoise2" 2228 msgstr "टर्कवाइज2" 2229 2230 #, kde-format 2231 msgctxt "color" 2232 msgid "turquoise3" 2233 msgstr "टर्कवाइज3" 2234 2235 #, kde-format 2236 msgctxt "color" 2237 msgid "turquoise4" 2238 msgstr "टर्कवाइज4" 2239 2240 #, kde-format 2241 msgctxt "color" 2242 msgid "violet" 2243 msgstr "बैंगनी" 2244 2245 #, kde-format 2246 msgctxt "color" 2247 msgid "wheat" 2248 msgstr "गेंहुआ" 2249 2250 #, kde-format 2251 msgctxt "color" 2252 msgid "wheat1" 2253 msgstr "गेंहुआ1" 2254 2255 #, kde-format 2256 msgctxt "color" 2257 msgid "wheat2" 2258 msgstr "गेंहुआ2" 2259 2260 #, kde-format 2261 msgctxt "color" 2262 msgid "wheat3" 2263 msgstr "गेंहुआ3" 2264 2265 #, kde-format 2266 msgctxt "color" 2267 msgid "wheat4" 2268 msgstr "गेंहुआ4" 2269 2270 #, kde-format 2271 msgctxt "color" 2272 msgid "white" 2273 msgstr "उज्जर" 2274 2275 #, kde-format 2276 msgctxt "color" 2277 msgid "yellow" 2278 msgstr "पीअर" 2279 2280 #, kde-format 2281 msgctxt "color" 2282 msgid "yellow1" 2283 msgstr "पीअर1" 2284 2285 #, kde-format 2286 msgctxt "color" 2287 msgid "yellow2" 2288 msgstr "पीअर2" 2289 2290 #, kde-format 2291 msgctxt "color" 2292 msgid "yellow3" 2293 msgstr "पीअर3" 2294 2295 #, kde-format 2296 msgctxt "color" 2297 msgid "yellow4" 2298 msgstr "पीअर4" 2299 2300 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2301 #, kde-format 2302 msgid "Debug Settings" 2303 msgstr "डिबग बिन्यास" 2304 2305 #: kdebugdialog/kdebugdialog.cpp:59 2306 #, kde-format 2307 msgid "File" 2308 msgstr "फाइल" 2309 2310 #: kdebugdialog/kdebugdialog.cpp:60 2311 #, kde-format 2312 msgid "Message Box" 2313 msgstr "संदेश बक्सा" 2314 2315 #: kdebugdialog/kdebugdialog.cpp:61 2316 #, kde-format 2317 msgid "Shell" 2318 msgstr "शेल" 2319 2320 #: kdebugdialog/kdebugdialog.cpp:62 2321 #, kde-format 2322 msgid "Syslog" 2323 msgstr "सिसलाग" 2324 2325 #: kdebugdialog/kdebugdialog.cpp:63 2326 #, kde-format 2327 msgid "None" 2328 msgstr "किछु नहि" 2329 2330 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2331 #: kdebugdialog/kdebugdialog.ui:48 2332 #, kde-format 2333 msgid "Information" 2334 msgstr "सूचना" 2335 2336 #. i18n: ectx: property (text), widget (QLabel, label_2) 2337 #. i18n: ectx: property (text), widget (QLabel, label_8) 2338 #. i18n: ectx: property (text), widget (QLabel, label_4) 2339 #. i18n: ectx: property (text), widget (QLabel, label_6) 2340 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2341 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2342 #, kde-format 2343 msgid "Output to:" 2344 msgstr "आउटपुट केँ:" 2345 2346 #. i18n: ectx: property (text), widget (QLabel, label_3) 2347 #. i18n: ectx: property (text), widget (QLabel, label_9) 2348 #. i18n: ectx: property (text), widget (QLabel, label_5) 2349 #. i18n: ectx: property (text), widget (QLabel, label_7) 2350 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2351 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2352 #, kde-format 2353 msgid "Filename:" 2354 msgstr "फाइलनाम:" 2355 2356 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2357 #: kdebugdialog/kdebugdialog.ui:83 2358 #, kde-format 2359 msgid "Error" 2360 msgstr "त्रुटि" 2361 2362 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2363 #: kdebugdialog/kdebugdialog.ui:118 2364 #, kde-format 2365 msgid "Abort on fatal errors" 2366 msgstr "गंभीर त्रुटि आबै पर छोड दिअ'" 2367 2368 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2369 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2370 #, kde-format 2371 msgid "Disable all debug output" 2372 msgstr "" 2373 2374 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2375 #: kdebugdialog/kdebugdialog.ui:145 2376 #, kde-format 2377 msgid "Warning" 2378 msgstr "चेतावनी" 2379 2380 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2381 #: kdebugdialog/kdebugdialog.ui:180 2382 #, kde-format 2383 msgid "Fatal Error" 2384 msgstr "गंभीर त्रुटि" 2385 2386 #: kdebugdialog/klistdebugdialog.cpp:69 2387 #, kde-format 2388 msgid "&Select All" 2389 msgstr "सभटा चुनू (&S)" 2390 2391 #: kdebugdialog/klistdebugdialog.cpp:70 2392 #, kde-format 2393 msgid "&Deselect All" 2394 msgstr "सभटा केँ विचुनलका करु (&D)" 2395 2396 #: kdebugdialog/main.cpp:100 2397 #, kde-format 2398 msgid "KDebugDialog" 2399 msgstr "के-डिबग-संवाद" 2400 2401 #: kdebugdialog/main.cpp:101 2402 #, kde-format 2403 msgid "A dialog box for setting preferences for debug output" 2404 msgstr "डिबग आउटपुट क' लेल प्राथमिकतासभसँ बिन्यासित करबा क' एकटा समाद बक्सा." 2405 2406 #: kdebugdialog/main.cpp:102 2407 #, fuzzy, kde-format 2408 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2409 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2410 msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2411 2412 #: kdebugdialog/main.cpp:103 2413 #, kde-format 2414 msgid "David Faure" 2415 msgstr "डेविड फाउरे" 2416 2417 #: kdebugdialog/main.cpp:103 2418 #, kde-format 2419 msgid "Maintainer" 2420 msgstr "अनुरक्षक" 2421 2422 #: kdebugdialog/main.cpp:108 2423 #, kde-format 2424 msgid "Show the fully-fledged dialog instead of the default list dialog" 2425 msgstr "डिफाल्ट सूची समाद केर बदला संपूर्ण समाद देखाबू." 2426 2427 #: kdebugdialog/main.cpp:109 2428 #, kde-format 2429 msgid "Turn area on" 2430 msgstr "क्षेत्र चालू करू" 2431 2432 #: kdebugdialog/main.cpp:110 2433 #, kde-format 2434 msgid "Turn area off" 2435 msgstr "क्षेत्र बन्न करू" 2436 2437 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2438 #, kde-format 2439 msgid "no error" 2440 msgstr "कोनो त्रुटि नहि" 2441 2442 #: kdecore/k3resolver.cpp:534 2443 #, kde-format 2444 msgid "requested family not supported for this host name" 2445 msgstr "ई होस्ट नाम क' लेल निवेदित परिवार समर्थित नहि अछि" 2446 2447 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2448 #, kde-format 2449 msgid "temporary failure in name resolution" 2450 msgstr "नाम रिसोल्यूशन मे अस्थायी असफलता" 2451 2452 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2453 #, kde-format 2454 msgid "non-recoverable failure in name resolution" 2455 msgstr "नाम रिसोल्यूशन मे रिकवरी अयोग्य असफलता" 2456 2457 #: kdecore/k3resolver.cpp:537 2458 #, kde-format 2459 msgid "invalid flags" 2460 msgstr "अवैध फ्लैग्स" 2461 2462 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2463 #, kde-format 2464 msgid "memory allocation failure" 2465 msgstr "मेमोरी एलोकेशन असफलता" 2466 2467 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2468 #, kde-format 2469 msgid "name or service not known" 2470 msgstr "नाम अथवा सेवा ज्ञात नहि अछि" 2471 2472 #: kdecore/k3resolver.cpp:540 2473 #, kde-format 2474 msgid "requested family not supported" 2475 msgstr "निवेदित परिवार समर्थित नहि अछि" 2476 2477 #: kdecore/k3resolver.cpp:541 2478 #, kde-format 2479 msgid "requested service not supported for this socket type" 2480 msgstr "ई साकेट प्रकार क' लेल निवेदित सेवा समर्थित नहि अछि" 2481 2482 #: kdecore/k3resolver.cpp:542 2483 #, kde-format 2484 msgid "requested socket type not supported" 2485 msgstr "निवेदित साकेट प्रकार समर्थित नहि अछि" 2486 2487 #: kdecore/k3resolver.cpp:543 2488 #, kde-format 2489 msgid "unknown error" 2490 msgstr "अनचिन्ह त्रुटि" 2491 2492 #: kdecore/k3resolver.cpp:545 2493 #, kde-format 2494 msgctxt "1: the i18n'ed system error code, from errno" 2495 msgid "system error: %1" 2496 msgstr "तंत्र त्रुटि: %1" 2497 2498 #: kdecore/k3resolver.cpp:556 2499 #, kde-format 2500 msgid "request was canceled" 2501 msgstr "निवेदन रद कएल गेल छल" 2502 2503 #: kdecore/k3socketaddress.cpp:631 2504 #, kde-format 2505 msgctxt "1: the unknown socket address family number" 2506 msgid "Unknown family %1" 2507 msgstr "अनचिन्ह परिवार %1" 2508 2509 #: kdecore/k3socketbase.cpp:215 2510 #, kde-format 2511 msgctxt "Socket error code NoError" 2512 msgid "no error" 2513 msgstr "कोनो त्रुटि नहि" 2514 2515 #: kdecore/k3socketbase.cpp:220 2516 #, kde-format 2517 msgctxt "Socket error code LookupFailure" 2518 msgid "name lookup has failed" 2519 msgstr "नाम लुकअप असफल" 2520 2521 #: kdecore/k3socketbase.cpp:225 2522 #, kde-format 2523 msgctxt "Socket error code AddressInUse" 2524 msgid "address already in use" 2525 msgstr "पता पहिने सँ उपयोग मे अछि" 2526 2527 #: kdecore/k3socketbase.cpp:230 2528 #, kde-format 2529 msgctxt "Socket error code AlreadyBound" 2530 msgid "socket is already bound" 2531 msgstr "साकेट पहिने सँ बाउण्ड अछि" 2532 2533 #: kdecore/k3socketbase.cpp:235 2534 #, kde-format 2535 msgctxt "Socket error code AlreadyCreated" 2536 msgid "socket is already created" 2537 msgstr "साकेट पहिने सँ बनाएल गेल अछि" 2538 2539 #: kdecore/k3socketbase.cpp:240 2540 #, kde-format 2541 msgctxt "Socket error code NotBound" 2542 msgid "socket is not bound" 2543 msgstr "साकेट बाउण्ड नहि अछि" 2544 2545 #: kdecore/k3socketbase.cpp:245 2546 #, kde-format 2547 msgctxt "Socket error code NotCreated" 2548 msgid "socket has not been created" 2549 msgstr "साकेट बनाएल नहि जाए सकल" 2550 2551 #: kdecore/k3socketbase.cpp:250 2552 #, kde-format 2553 msgctxt "Socket error code WouldBlock" 2554 msgid "operation would block" 2555 msgstr "काज रोक देल जएताह" 2556 2557 #: kdecore/k3socketbase.cpp:255 2558 #, kde-format 2559 msgctxt "Socket error code ConnectionRefused" 2560 msgid "connection actively refused" 2561 msgstr "कनेक्शन सक्रिय रूपेँ अस्वीकृत" 2562 2563 #: kdecore/k3socketbase.cpp:260 2564 #, kde-format 2565 msgctxt "Socket error code ConnectionTimedOut" 2566 msgid "connection timed out" 2567 msgstr "कनेक्शन टाइम आउट" 2568 2569 #: kdecore/k3socketbase.cpp:265 2570 #, kde-format 2571 msgctxt "Socket error code InProgress" 2572 msgid "operation is already in progress" 2573 msgstr "प्रक्रिया पहिने सँ प्रगति मे अछि" 2574 2575 #: kdecore/k3socketbase.cpp:270 2576 #, kde-format 2577 msgctxt "Socket error code NetFailure" 2578 msgid "network failure occurred" 2579 msgstr "नेटवर्क असफल भ' गेल" 2580 2581 #: kdecore/k3socketbase.cpp:275 2582 #, kde-format 2583 msgctxt "Socket error code NotSupported" 2584 msgid "operation is not supported" 2585 msgstr "प्रक्रिया समर्थित नहि अछि" 2586 2587 #: kdecore/k3socketbase.cpp:280 2588 #, kde-format 2589 msgctxt "Socket error code Timeout" 2590 msgid "timed operation timed out" 2591 msgstr "समयबद्ध प्रक्रिया टाइम आउट भ' गेल" 2592 2593 #: kdecore/k3socketbase.cpp:285 2594 #, kde-format 2595 msgctxt "Socket error code UnknownError" 2596 msgid "an unknown/unexpected error has happened" 2597 msgstr "एक अनचिन्ह/अप्रत्याशित त्रुटि भेल" 2598 2599 #: kdecore/k3socketbase.cpp:290 2600 #, kde-format 2601 msgctxt "Socket error code RemotelyDisconnected" 2602 msgid "remote host closed connection" 2603 msgstr "रिमोट होस्ट द्वारा कनेक्शन बन्न कएल गेल" 2604 2605 #: kdecore/k4aboutdata.cpp:267 2606 #, kde-format 2607 msgid "" 2608 "No licensing terms for this program have been specified.\n" 2609 "Please check the documentation or the source for any\n" 2610 "licensing terms.\n" 2611 msgstr "" 2612 2613 #: kdecore/k4aboutdata.cpp:273 2614 #, kde-format 2615 msgid "This program is distributed under the terms of the %1." 2616 msgstr "" 2617 2618 #: kdecore/k4aboutdata.cpp:297 2619 #, kde-format 2620 msgctxt "@item license (short name)" 2621 msgid "GPL v2" 2622 msgstr "जीपीएल सं.२" 2623 2624 #: kdecore/k4aboutdata.cpp:298 2625 #, kde-format 2626 msgctxt "@item license" 2627 msgid "GNU General Public License Version 2" 2628 msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण २" 2629 2630 #: kdecore/k4aboutdata.cpp:301 2631 #, kde-format 2632 msgctxt "@item license (short name)" 2633 msgid "LGPL v2" 2634 msgstr "एलजीपीएल सं.२" 2635 2636 #: kdecore/k4aboutdata.cpp:302 2637 #, kde-format 2638 msgctxt "@item license" 2639 msgid "GNU Lesser General Public License Version 2" 2640 msgstr "जीएनयू लेसर जनरल पब्लिक लाइसेंस संस्करण २" 2641 2642 #: kdecore/k4aboutdata.cpp:305 2643 #, kde-format 2644 msgctxt "@item license (short name)" 2645 msgid "BSD License" 2646 msgstr "बीएसडी लाइसेंस" 2647 2648 #: kdecore/k4aboutdata.cpp:306 2649 #, kde-format 2650 msgctxt "@item license" 2651 msgid "BSD License" 2652 msgstr "बीएसडी लाइसेंस" 2653 2654 #: kdecore/k4aboutdata.cpp:309 2655 #, kde-format 2656 msgctxt "@item license (short name)" 2657 msgid "Artistic License" 2658 msgstr "आर्टिस्टिक लाइसेंस" 2659 2660 #: kdecore/k4aboutdata.cpp:310 2661 #, kde-format 2662 msgctxt "@item license" 2663 msgid "Artistic License" 2664 msgstr "आर्टिस्टिक लाइसेंस" 2665 2666 #: kdecore/k4aboutdata.cpp:313 2667 #, kde-format 2668 msgctxt "@item license (short name)" 2669 msgid "QPL v1.0" 2670 msgstr "क्यूपीएल सं.1.0" 2671 2672 #: kdecore/k4aboutdata.cpp:314 2673 #, kde-format 2674 msgctxt "@item license" 2675 msgid "Q Public License" 2676 msgstr "क्यू पब्लिक लाइसेंस" 2677 2678 #: kdecore/k4aboutdata.cpp:317 2679 #, kde-format 2680 msgctxt "@item license (short name)" 2681 msgid "GPL v3" 2682 msgstr "जीपीएल सं.३" 2683 2684 #: kdecore/k4aboutdata.cpp:318 2685 #, kde-format 2686 msgctxt "@item license" 2687 msgid "GNU General Public License Version 3" 2688 msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण ३" 2689 2690 #: kdecore/k4aboutdata.cpp:321 2691 #, kde-format 2692 msgctxt "@item license (short name)" 2693 msgid "LGPL v3" 2694 msgstr "एलजीपीएल सं.३" 2695 2696 #: kdecore/k4aboutdata.cpp:322 2697 #, kde-format 2698 msgctxt "@item license" 2699 msgid "GNU Lesser General Public License Version 3" 2700 msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण ३" 2701 2702 #: kdecore/k4aboutdata.cpp:326 2703 #, kde-format 2704 msgctxt "@item license" 2705 msgid "Custom" 2706 msgstr "पसंदीदा" 2707 2708 #: kdecore/k4aboutdata.cpp:329 2709 #, kde-format 2710 msgctxt "@item license" 2711 msgid "Not specified" 2712 msgstr "निर्दिष्ट नहि" 2713 2714 #: kdecore/k4aboutdata.cpp:891 2715 #, kde-format 2716 msgctxt "replace this with information about your translation team" 2717 msgid "" 2718 "<p>KDE is translated into many languages thanks to the work of the " 2719 "translation teams all over the world.</p><p>For more information on KDE " 2720 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2721 "org</a></p>" 2722 msgstr "" 2723 "<p>केडीइ बहुते भाषासभ मे अनूदित अछि. एहि क' लेल विश्व भर केर अनुवादकसभक टोली केँ " 2724 "हार्दिक धन्यवाद.</p><p>केडीइ केर अंतर्राष्ट्रीयकरण केर संबंध मे आओर बेसी जानकारी क' लेल " 2725 "एतय जाउ: <a href=\"http://l10n.kde.org\">http://l10n.kde.org</a></p>" 2726 2727 #: kdecore/kcalendarsystem.cpp:108 2728 #, kde-format 2729 msgctxt "@item Calendar system" 2730 msgid "Gregorian" 2731 msgstr "ग्रेगोरियन" 2732 2733 #: kdecore/kcalendarsystem.cpp:110 2734 #, fuzzy, kde-format 2735 msgctxt "@item Calendar system" 2736 msgid "Coptic" 2737 msgstr "कोप्टिक" 2738 2739 #: kdecore/kcalendarsystem.cpp:112 2740 #, fuzzy, kde-format 2741 msgctxt "@item Calendar system" 2742 msgid "Ethiopian" 2743 msgstr "इथियोपिक" 2744 2745 #: kdecore/kcalendarsystem.cpp:114 2746 #, kde-format 2747 msgctxt "@item Calendar system" 2748 msgid "Hebrew" 2749 msgstr "हिब्रू" 2750 2751 #: kdecore/kcalendarsystem.cpp:116 2752 #, kde-format 2753 msgctxt "@item Calendar system" 2754 msgid "Islamic / Hijri (Civil)" 2755 msgstr "" 2756 2757 #: kdecore/kcalendarsystem.cpp:118 2758 #, kde-format 2759 msgctxt "@item Calendar system" 2760 msgid "Indian National" 2761 msgstr "" 2762 2763 #: kdecore/kcalendarsystem.cpp:120 2764 #, kde-format 2765 msgctxt "@item Calendar system" 2766 msgid "Jalali" 2767 msgstr "जलाली" 2768 2769 #: kdecore/kcalendarsystem.cpp:122 2770 #, kde-format 2771 msgctxt "@item Calendar system" 2772 msgid "Japanese" 2773 msgstr "" 2774 2775 #: kdecore/kcalendarsystem.cpp:124 2776 #, fuzzy, kde-format 2777 msgctxt "@item Calendar system" 2778 msgid "Julian" 2779 msgstr "जनवरी" 2780 2781 #: kdecore/kcalendarsystem.cpp:126 2782 #, kde-format 2783 msgctxt "@item Calendar system" 2784 msgid "Taiwanese" 2785 msgstr "" 2786 2787 #: kdecore/kcalendarsystem.cpp:128 2788 #, fuzzy, kde-format 2789 #| msgid "R. Thaani" 2790 msgctxt "@item Calendar system" 2791 msgid "Thai" 2792 msgstr "र. उस्सानी" 2793 2794 #: kdecore/kcalendarsystem.cpp:131 2795 #, kde-format 2796 msgctxt "@item Calendar system" 2797 msgid "Invalid Calendar Type" 2798 msgstr "अवैध कैलेण्डर प्रकार" 2799 2800 #: kdecore/kcalendarsystem.cpp:1495 2801 #, kde-format 2802 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2803 msgid "-" 2804 msgstr "" 2805 2806 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2807 #: kio/kfilemetadataprovider.cpp:199 2808 #, kde-format 2809 msgid "Today" 2810 msgstr "आइ" 2811 2812 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2813 #: kio/kfilemetadataprovider.cpp:202 2814 #, kde-format 2815 msgid "Yesterday" 2816 msgstr "कालि" 2817 2818 #: kdecore/kcalendarsystemcoptic.cpp:45 2819 #, kde-format 2820 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2821 msgid "Anno Martyrum" 2822 msgstr "" 2823 2824 #: kdecore/kcalendarsystemcoptic.cpp:46 2825 #, kde-format 2826 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2827 msgid "AM" 2828 msgstr "" 2829 2830 #: kdecore/kcalendarsystemcoptic.cpp:47 2831 #, kde-format 2832 msgctxt "" 2833 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2834 msgid "%Ey %EC" 2835 msgstr "" 2836 2837 #: kdecore/kcalendarsystemcoptic.cpp:153 2838 #, kde-format 2839 msgctxt "Coptic month 1 - KLocale::NarrowName" 2840 msgid "T" 2841 msgstr "" 2842 2843 #: kdecore/kcalendarsystemcoptic.cpp:155 2844 #, kde-format 2845 msgctxt "Coptic month 2 - KLocale::NarrowName" 2846 msgid "P" 2847 msgstr "" 2848 2849 #: kdecore/kcalendarsystemcoptic.cpp:157 2850 #, kde-format 2851 msgctxt "Coptic month 3 - KLocale::NarrowName" 2852 msgid "H" 2853 msgstr "" 2854 2855 #: kdecore/kcalendarsystemcoptic.cpp:159 2856 #, kde-format 2857 msgctxt "Coptic month 4 - KLocale::NarrowName" 2858 msgid "K" 2859 msgstr "" 2860 2861 #: kdecore/kcalendarsystemcoptic.cpp:161 2862 #, kde-format 2863 msgctxt "Coptic month 5 - KLocale::NarrowName" 2864 msgid "T" 2865 msgstr "" 2866 2867 #: kdecore/kcalendarsystemcoptic.cpp:163 2868 #, kde-format 2869 msgctxt "Coptic month 6 - KLocale::NarrowName" 2870 msgid "M" 2871 msgstr "" 2872 2873 #: kdecore/kcalendarsystemcoptic.cpp:165 2874 #, kde-format 2875 msgctxt "Coptic month 7 - KLocale::NarrowName" 2876 msgid "P" 2877 msgstr "" 2878 2879 #: kdecore/kcalendarsystemcoptic.cpp:167 2880 #, kde-format 2881 msgctxt "Coptic month 8 - KLocale::NarrowName" 2882 msgid "P" 2883 msgstr "" 2884 2885 #: kdecore/kcalendarsystemcoptic.cpp:169 2886 #, kde-format 2887 msgctxt "Coptic month 9 - KLocale::NarrowName" 2888 msgid "P" 2889 msgstr "" 2890 2891 #: kdecore/kcalendarsystemcoptic.cpp:171 2892 #, kde-format 2893 msgctxt "Coptic month 10 - KLocale::NarrowName" 2894 msgid "P" 2895 msgstr "" 2896 2897 #: kdecore/kcalendarsystemcoptic.cpp:173 2898 #, kde-format 2899 msgctxt "Coptic month 11 - KLocale::NarrowName" 2900 msgid "E" 2901 msgstr "" 2902 2903 #: kdecore/kcalendarsystemcoptic.cpp:175 2904 #, kde-format 2905 msgctxt "Coptic month 12 - KLocale::NarrowName" 2906 msgid "M" 2907 msgstr "" 2908 2909 #: kdecore/kcalendarsystemcoptic.cpp:177 2910 #, kde-format 2911 msgctxt "Coptic month 13 - KLocale::NarrowName" 2912 msgid "K" 2913 msgstr "" 2914 2915 #: kdecore/kcalendarsystemcoptic.cpp:186 2916 #, fuzzy, kde-format 2917 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2918 msgid "of Tho" 2919 msgstr "खोर क' " 2920 2921 #: kdecore/kcalendarsystemcoptic.cpp:188 2922 #, fuzzy, kde-format 2923 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2924 msgid "of Pao" 2925 msgstr "तमुज क' " 2926 2927 #: kdecore/kcalendarsystemcoptic.cpp:190 2928 #, fuzzy, kde-format 2929 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2930 msgid "of Hat" 2931 msgstr "शवत क' " 2932 2933 #: kdecore/kcalendarsystemcoptic.cpp:192 2934 #, fuzzy, kde-format 2935 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2936 msgid "of Kia" 2937 msgstr "निसान क' " 2938 2939 #: kdecore/kcalendarsystemcoptic.cpp:194 2940 #, fuzzy, kde-format 2941 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2942 msgid "of Tob" 2943 msgstr "फरवरी क' " 2944 2945 #: kdecore/kcalendarsystemcoptic.cpp:196 2946 #, fuzzy, kde-format 2947 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2948 msgid "of Mes" 2949 msgstr "मेह क' " 2950 2951 #: kdecore/kcalendarsystemcoptic.cpp:198 2952 #, fuzzy, kde-format 2953 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2954 msgid "of Par" 2955 msgstr "मार्च क' " 2956 2957 #: kdecore/kcalendarsystemcoptic.cpp:200 2958 #, fuzzy, kde-format 2959 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2960 msgid "of Pam" 2961 msgstr "तमुज क' " 2962 2963 #: kdecore/kcalendarsystemcoptic.cpp:202 2964 #, fuzzy, kde-format 2965 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2966 msgid "of Pas" 2967 msgstr "बाह क' " 2968 2969 #: kdecore/kcalendarsystemcoptic.cpp:204 2970 #, fuzzy, kde-format 2971 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2972 msgid "of Pan" 2973 msgstr "जनवरी क' " 2974 2975 #: kdecore/kcalendarsystemcoptic.cpp:206 2976 #, fuzzy, kde-format 2977 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2978 msgid "of Epe" 2979 msgstr "फरवरी क' " 2980 2981 #: kdecore/kcalendarsystemcoptic.cpp:208 2982 #, fuzzy, kde-format 2983 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2984 msgid "of Meo" 2985 msgstr "मोर क' " 2986 2987 #: kdecore/kcalendarsystemcoptic.cpp:210 2988 #, fuzzy, kde-format 2989 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 2990 msgid "of Kou" 2991 msgstr "खोर क' " 2992 2993 #: kdecore/kcalendarsystemcoptic.cpp:219 2994 #, fuzzy, kde-format 2995 msgctxt "Coptic month 1 - KLocale::ShortName" 2996 msgid "Tho" 2997 msgstr "मंगल" 2998 2999 #: kdecore/kcalendarsystemcoptic.cpp:221 3000 #, fuzzy, kde-format 3001 msgctxt "Coptic month 2 - KLocale::ShortName" 3002 msgid "Pao" 3003 msgstr "ठहरू" 3004 3005 #: kdecore/kcalendarsystemcoptic.cpp:223 3006 #, fuzzy, kde-format 3007 msgctxt "Coptic month 3 - KLocale::ShortName" 3008 msgid "Hat" 3009 msgstr "शनि" 3010 3011 #: kdecore/kcalendarsystemcoptic.cpp:225 3012 #, fuzzy, kde-format 3013 msgctxt "Coptic month 4 - KLocale::ShortName" 3014 msgid "Kia" 3015 msgstr "गुरु" 3016 3017 #: kdecore/kcalendarsystemcoptic.cpp:227 3018 #, fuzzy, kde-format 3019 msgctxt "Coptic month 5 - KLocale::ShortName" 3020 msgid "Tob" 3021 msgstr "काज" 3022 3023 #: kdecore/kcalendarsystemcoptic.cpp:229 3024 #, fuzzy, kde-format 3025 msgctxt "Coptic month 6 - KLocale::ShortName" 3026 msgid "Mes" 3027 msgstr "हँ" 3028 3029 #: kdecore/kcalendarsystemcoptic.cpp:231 3030 #, fuzzy, kde-format 3031 msgctxt "Coptic month 7 - KLocale::ShortName" 3032 msgid "Par" 3033 msgstr "मार्च" 3034 3035 #: kdecore/kcalendarsystemcoptic.cpp:233 3036 #, fuzzy, kde-format 3037 msgctxt "Coptic month 8 - KLocale::ShortName" 3038 msgid "Pam" 3039 msgstr "पूर्वाह्न" 3040 3041 #: kdecore/kcalendarsystemcoptic.cpp:235 3042 #, fuzzy, kde-format 3043 msgctxt "Coptic month 9 - KLocale::ShortName" 3044 msgid "Pas" 3045 msgstr "पृष्ठसभ" 3046 3047 #: kdecore/kcalendarsystemcoptic.cpp:237 3048 #, fuzzy, kde-format 3049 msgctxt "Coptic month 10 - KLocale::ShortName" 3050 msgid "Pan" 3051 msgstr "जनवरी" 3052 3053 #: kdecore/kcalendarsystemcoptic.cpp:239 3054 #, fuzzy, kde-format 3055 msgctxt "Coptic month 11 - KLocale::ShortName" 3056 msgid "Epe" 3057 msgstr "एस्केप" 3058 3059 #: kdecore/kcalendarsystemcoptic.cpp:241 3060 #, fuzzy, kde-format 3061 msgctxt "Coptic month 12 - KLocale::ShortName" 3062 msgid "Meo" 3063 msgstr "सोम" 3064 3065 #: kdecore/kcalendarsystemcoptic.cpp:243 3066 #, fuzzy, kde-format 3067 msgctxt "Coptic month 12 - KLocale::ShortName" 3068 msgid "Kou" 3069 msgstr "खोर" 3070 3071 #: kdecore/kcalendarsystemcoptic.cpp:252 3072 #, fuzzy, kde-format 3073 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3074 msgid "of Thoout" 3075 msgstr "खोर क' " 3076 3077 #: kdecore/kcalendarsystemcoptic.cpp:254 3078 #, fuzzy, kde-format 3079 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3080 msgid "of Paope" 3081 msgstr "तमुज क' " 3082 3083 #: kdecore/kcalendarsystemcoptic.cpp:256 3084 #, fuzzy, kde-format 3085 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3086 msgid "of Hathor" 3087 msgstr "जिल्हज क' " 3088 3089 #: kdecore/kcalendarsystemcoptic.cpp:258 3090 #, fuzzy, kde-format 3091 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3092 msgid "of Kiahk" 3093 msgstr "खोर क' " 3094 3095 #: kdecore/kcalendarsystemcoptic.cpp:260 3096 #, fuzzy, kde-format 3097 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3098 msgid "of Tobe" 3099 msgstr "अक्टूबर क' " 3100 3101 #: kdecore/kcalendarsystemcoptic.cpp:262 3102 #, fuzzy, kde-format 3103 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3104 msgid "of Meshir" 3105 msgstr "मेहर क' " 3106 3107 #: kdecore/kcalendarsystemcoptic.cpp:264 3108 #, fuzzy, kde-format 3109 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3110 msgid "of Paremhotep" 3111 msgstr "पैरामीटर" 3112 3113 #: kdecore/kcalendarsystemcoptic.cpp:266 3114 #, fuzzy, kde-format 3115 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3116 msgid "of Parmoute" 3117 msgstr "तमुज क' " 3118 3119 #: kdecore/kcalendarsystemcoptic.cpp:268 3120 #, fuzzy, kde-format 3121 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3122 msgid "of Pashons" 3123 msgstr "बाह क' " 3124 3125 #: kdecore/kcalendarsystemcoptic.cpp:270 3126 #, fuzzy, kde-format 3127 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3128 msgid "of Paone" 3129 msgstr "जनवरी क' " 3130 3131 #: kdecore/kcalendarsystemcoptic.cpp:272 3132 #, fuzzy, kde-format 3133 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3134 msgid "of Epep" 3135 msgstr "सित. क' " 3136 3137 #: kdecore/kcalendarsystemcoptic.cpp:274 3138 #, fuzzy, kde-format 3139 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3140 msgid "of Mesore" 3141 msgstr "मोर क' " 3142 3143 #: kdecore/kcalendarsystemcoptic.cpp:276 3144 #, fuzzy, kde-format 3145 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3146 msgid "of Kouji nabot" 3147 msgstr "फरवरी क' " 3148 3149 #: kdecore/kcalendarsystemcoptic.cpp:285 3150 #, fuzzy, kde-format 3151 msgctxt "Coptic month 1 - KLocale::LongName" 3152 msgid "Thoout" 3153 msgstr "गुरू" 3154 3155 #: kdecore/kcalendarsystemcoptic.cpp:287 3156 #, fuzzy, kde-format 3157 msgctxt "Coptic month 2 - KLocale::LongName" 3158 msgid "Paope" 3159 msgstr "गुण" 3160 3161 #: kdecore/kcalendarsystemcoptic.cpp:289 3162 #, fuzzy, kde-format 3163 msgctxt "Coptic month 3 - KLocale::LongName" 3164 msgid "Hathor" 3165 msgstr "लेखक" 3166 3167 #: kdecore/kcalendarsystemcoptic.cpp:291 3168 #, fuzzy, kde-format 3169 msgctxt "Coptic month 4 - KLocale::LongName" 3170 msgid "Kiahk" 3171 msgstr "खोर क' " 3172 3173 #: kdecore/kcalendarsystemcoptic.cpp:293 3174 #, fuzzy, kde-format 3175 msgctxt "Coptic month 5 - KLocale::LongName" 3176 msgid "Tobe" 3177 msgstr "काज" 3178 3179 #: kdecore/kcalendarsystemcoptic.cpp:295 3180 #, fuzzy, kde-format 3181 msgctxt "Coptic month 6 - KLocale::LongName" 3182 msgid "Meshir" 3183 msgstr "मेहर" 3184 3185 #: kdecore/kcalendarsystemcoptic.cpp:297 3186 #, fuzzy, kde-format 3187 msgctxt "Coptic month 7 - KLocale::LongName" 3188 msgid "Paremhotep" 3189 msgstr "पैरामीटर" 3190 3191 #: kdecore/kcalendarsystemcoptic.cpp:299 3192 #, fuzzy, kde-format 3193 msgctxt "Coptic month 8 - KLocale::LongName" 3194 msgid "Parmoute" 3195 msgstr "पैरामीटर" 3196 3197 #: kdecore/kcalendarsystemcoptic.cpp:301 3198 #, fuzzy, kde-format 3199 msgctxt "Coptic month 9 - KLocale::LongName" 3200 msgid "Pashons" 3201 msgstr "ठहरू" 3202 3203 #: kdecore/kcalendarsystemcoptic.cpp:303 3204 #, fuzzy, kde-format 3205 msgctxt "Coptic month 10 - KLocale::LongName" 3206 msgid "Paone" 3207 msgstr "किछु नहि" 3208 3209 #: kdecore/kcalendarsystemcoptic.cpp:305 3210 #, fuzzy, kde-format 3211 msgctxt "Coptic month 11 - KLocale::LongName" 3212 msgid "Epep" 3213 msgstr "एस्केप" 3214 3215 #: kdecore/kcalendarsystemcoptic.cpp:307 3216 #, fuzzy, kde-format 3217 msgctxt "Coptic month 12 - KLocale::LongName" 3218 msgid "Mesore" 3219 msgstr "घुराबू (&R)" 3220 3221 #: kdecore/kcalendarsystemcoptic.cpp:309 3222 #, fuzzy, kde-format 3223 msgctxt "Coptic month 12 - KLocale::LongName" 3224 msgid "Kouji nabot" 3225 msgstr "फरवरी क' " 3226 3227 #: kdecore/kcalendarsystemcoptic.cpp:324 3228 #, kde-format 3229 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3230 msgid "P" 3231 msgstr "" 3232 3233 #: kdecore/kcalendarsystemcoptic.cpp:326 3234 #, kde-format 3235 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3236 msgid "P" 3237 msgstr "" 3238 3239 #: kdecore/kcalendarsystemcoptic.cpp:328 3240 #, kde-format 3241 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3242 msgid "P" 3243 msgstr "" 3244 3245 #: kdecore/kcalendarsystemcoptic.cpp:330 3246 #, kde-format 3247 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3248 msgid "P" 3249 msgstr "" 3250 3251 #: kdecore/kcalendarsystemcoptic.cpp:332 3252 #, kde-format 3253 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3254 msgid "P" 3255 msgstr "" 3256 3257 #: kdecore/kcalendarsystemcoptic.cpp:334 3258 #, kde-format 3259 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3260 msgid "P" 3261 msgstr "" 3262 3263 #: kdecore/kcalendarsystemcoptic.cpp:336 3264 #, kde-format 3265 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3266 msgid "T" 3267 msgstr "" 3268 3269 #: kdecore/kcalendarsystemcoptic.cpp:345 3270 #, fuzzy, kde-format 3271 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3272 msgid "Pes" 3273 msgstr "पृष्ठसभ" 3274 3275 #: kdecore/kcalendarsystemcoptic.cpp:347 3276 #, fuzzy, kde-format 3277 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3278 msgid "Psh" 3279 msgstr "ठहरू" 3280 3281 #: kdecore/kcalendarsystemcoptic.cpp:349 3282 #, fuzzy, kde-format 3283 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3284 msgid "Pef" 3285 msgstr "पृष्ठसभ" 3286 3287 #: kdecore/kcalendarsystemcoptic.cpp:351 3288 #, kde-format 3289 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3290 msgid "Pti" 3291 msgstr "" 3292 3293 #: kdecore/kcalendarsystemcoptic.cpp:353 3294 #, fuzzy, kde-format 3295 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3296 msgid "Pso" 3297 msgstr "ठहरू" 3298 3299 #: kdecore/kcalendarsystemcoptic.cpp:355 3300 #, fuzzy, kde-format 3301 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3302 msgid "Psa" 3303 msgstr "ठहरू" 3304 3305 #: kdecore/kcalendarsystemcoptic.cpp:357 3306 #, kde-format 3307 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3308 msgid "Tky" 3309 msgstr "" 3310 3311 #: kdecore/kcalendarsystemcoptic.cpp:365 3312 #, fuzzy, kde-format 3313 msgctxt "Coptic weekday 1 - KLocale::LongName" 3314 msgid "Pesnau" 3315 msgstr "ठहरू" 3316 3317 #: kdecore/kcalendarsystemcoptic.cpp:367 3318 #, fuzzy, kde-format 3319 msgctxt "Coptic weekday 2 - KLocale::LongName" 3320 msgid "Pshoment" 3321 msgstr "टिप्पणी" 3322 3323 #: kdecore/kcalendarsystemcoptic.cpp:369 3324 #, kde-format 3325 msgctxt "Coptic weekday 3 - KLocale::LongName" 3326 msgid "Peftoou" 3327 msgstr "" 3328 3329 #: kdecore/kcalendarsystemcoptic.cpp:371 3330 #, kde-format 3331 msgctxt "Coptic weekday 4 - KLocale::LongName" 3332 msgid "Ptiou" 3333 msgstr "" 3334 3335 #: kdecore/kcalendarsystemcoptic.cpp:373 3336 #, fuzzy, kde-format 3337 msgctxt "Coptic weekday 5 - KLocale::LongName" 3338 msgid "Psoou" 3339 msgstr "ठहरू" 3340 3341 #: kdecore/kcalendarsystemcoptic.cpp:375 3342 #, kde-format 3343 msgctxt "Coptic weekday 6 - KLocale::LongName" 3344 msgid "Psabbaton" 3345 msgstr "" 3346 3347 #: kdecore/kcalendarsystemcoptic.cpp:377 3348 #, kde-format 3349 msgctxt "Coptic weekday 7 - KLocale::LongName" 3350 msgid "Tkyriakē" 3351 msgstr "" 3352 3353 #: kdecore/kcalendarsystemethiopian.cpp:50 3354 #, kde-format 3355 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3356 msgid "Amata Mehrat" 3357 msgstr "" 3358 3359 #: kdecore/kcalendarsystemethiopian.cpp:51 3360 #, kde-format 3361 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3362 msgid "AM" 3363 msgstr "" 3364 3365 #: kdecore/kcalendarsystemethiopian.cpp:52 3366 #, kde-format 3367 msgctxt "" 3368 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3369 msgid "%Ey %EC" 3370 msgstr "" 3371 3372 #: kdecore/kcalendarsystemethiopian.cpp:66 3373 #, kde-format 3374 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3375 msgid "M" 3376 msgstr "" 3377 3378 #: kdecore/kcalendarsystemethiopian.cpp:68 3379 #, kde-format 3380 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3381 msgid "T" 3382 msgstr "" 3383 3384 #: kdecore/kcalendarsystemethiopian.cpp:70 3385 #, kde-format 3386 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3387 msgid "H" 3388 msgstr "" 3389 3390 #: kdecore/kcalendarsystemethiopian.cpp:72 3391 #, kde-format 3392 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3393 msgid "T" 3394 msgstr "" 3395 3396 #: kdecore/kcalendarsystemethiopian.cpp:74 3397 #, kde-format 3398 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3399 msgid "T" 3400 msgstr "" 3401 3402 #: kdecore/kcalendarsystemethiopian.cpp:76 3403 #, kde-format 3404 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3405 msgid "Y" 3406 msgstr "" 3407 3408 #: kdecore/kcalendarsystemethiopian.cpp:78 3409 #, kde-format 3410 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3411 msgid "M" 3412 msgstr "" 3413 3414 #: kdecore/kcalendarsystemethiopian.cpp:80 3415 #, kde-format 3416 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3417 msgid "M" 3418 msgstr "" 3419 3420 #: kdecore/kcalendarsystemethiopian.cpp:82 3421 #, kde-format 3422 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3423 msgid "G" 3424 msgstr "" 3425 3426 #: kdecore/kcalendarsystemethiopian.cpp:84 3427 #, kde-format 3428 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3429 msgid "S" 3430 msgstr "" 3431 3432 #: kdecore/kcalendarsystemethiopian.cpp:86 3433 #, kde-format 3434 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3435 msgid "H" 3436 msgstr "" 3437 3438 #: kdecore/kcalendarsystemethiopian.cpp:88 3439 #, kde-format 3440 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3441 msgid "N" 3442 msgstr "" 3443 3444 #: kdecore/kcalendarsystemethiopian.cpp:90 3445 #, kde-format 3446 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3447 msgid "P" 3448 msgstr "" 3449 3450 #: kdecore/kcalendarsystemethiopian.cpp:99 3451 #, fuzzy, kde-format 3452 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3453 msgid "of Mes" 3454 msgstr "मेह क' " 3455 3456 #: kdecore/kcalendarsystemethiopian.cpp:101 3457 #, fuzzy, kde-format 3458 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3459 msgid "of Teq" 3460 msgstr "तेवेत क' " 3461 3462 #: kdecore/kcalendarsystemethiopian.cpp:103 3463 #, fuzzy, kde-format 3464 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3465 msgid "of Hed" 3466 msgstr "फरवरी क' " 3467 3468 #: kdecore/kcalendarsystemethiopian.cpp:105 3469 #, fuzzy, kde-format 3470 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3471 msgid "of Tah" 3472 msgstr "बाह क' " 3473 3474 #: kdecore/kcalendarsystemethiopian.cpp:107 3475 #, fuzzy, kde-format 3476 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3477 msgid "of Ter" 3478 msgstr "तिर क' " 3479 3480 #: kdecore/kcalendarsystemethiopian.cpp:109 3481 #, fuzzy, kde-format 3482 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3483 msgid "of Yak" 3484 msgstr "जनवरी क' " 3485 3486 #: kdecore/kcalendarsystemethiopian.cpp:111 3487 #, fuzzy, kde-format 3488 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3489 msgid "of Mag" 3490 msgstr "मार्च क' " 3491 3492 #: kdecore/kcalendarsystemethiopian.cpp:113 3493 #, fuzzy, kde-format 3494 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3495 msgid "of Miy" 3496 msgstr "मई क' " 3497 3498 #: kdecore/kcalendarsystemethiopian.cpp:115 3499 #, fuzzy, kde-format 3500 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3501 msgid "of Gen" 3502 msgstr "जनवरी क' " 3503 3504 #: kdecore/kcalendarsystemethiopian.cpp:117 3505 #, fuzzy, kde-format 3506 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3507 msgid "of Sen" 3508 msgstr "सित. क' " 3509 3510 #: kdecore/kcalendarsystemethiopian.cpp:119 3511 #, fuzzy, kde-format 3512 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3513 msgid "of Ham" 3514 msgstr "तमुज क' " 3515 3516 #: kdecore/kcalendarsystemethiopian.cpp:121 3517 #, fuzzy, kde-format 3518 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3519 msgid "of Neh" 3520 msgstr "मेह क' " 3521 3522 #: kdecore/kcalendarsystemethiopian.cpp:123 3523 #, fuzzy, kde-format 3524 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3525 msgid "of Pag" 3526 msgstr "तमुज क' " 3527 3528 #: kdecore/kcalendarsystemethiopian.cpp:132 3529 #, fuzzy, kde-format 3530 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3531 msgid "Mes" 3532 msgstr "हँ" 3533 3534 #: kdecore/kcalendarsystemethiopian.cpp:134 3535 #, fuzzy, kde-format 3536 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3537 msgid "Teq" 3538 msgstr "मंगल" 3539 3540 #: kdecore/kcalendarsystemethiopian.cpp:136 3541 #, fuzzy, kde-format 3542 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3543 msgid "Hed" 3544 msgstr "बुध" 3545 3546 #: kdecore/kcalendarsystemethiopian.cpp:138 3547 #, fuzzy, kde-format 3548 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3549 msgid "Tah" 3550 msgstr "मंगल" 3551 3552 #: kdecore/kcalendarsystemethiopian.cpp:140 3553 #, fuzzy, kde-format 3554 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3555 msgid "Ter" 3556 msgstr "मंगल" 3557 3558 #: kdecore/kcalendarsystemethiopian.cpp:142 3559 #, fuzzy, kde-format 3560 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3561 msgid "Yak" 3562 msgstr "जनवरी क' " 3563 3564 #: kdecore/kcalendarsystemethiopian.cpp:144 3565 #, fuzzy, kde-format 3566 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3567 msgid "Mag" 3568 msgstr "मार्च" 3569 3570 #: kdecore/kcalendarsystemethiopian.cpp:146 3571 #, fuzzy, kde-format 3572 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3573 msgid "Miy" 3574 msgstr "मई" 3575 3576 #: kdecore/kcalendarsystemethiopian.cpp:148 3577 #, fuzzy, kde-format 3578 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3579 msgid "Gen" 3580 msgstr "हरिअर:" 3581 3582 #: kdecore/kcalendarsystemethiopian.cpp:150 3583 #, fuzzy, kde-format 3584 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3585 msgid "Sen" 3586 msgstr "भेजू (&S)" 3587 3588 #: kdecore/kcalendarsystemethiopian.cpp:152 3589 #, fuzzy, kde-format 3590 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3591 msgid "Ham" 3592 msgstr "पूर्वाह्न" 3593 3594 #: kdecore/kcalendarsystemethiopian.cpp:154 3595 #, fuzzy, kde-format 3596 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3597 msgid "Neh" 3598 msgstr "मेह" 3599 3600 #: kdecore/kcalendarsystemethiopian.cpp:156 3601 #, fuzzy, kde-format 3602 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3603 msgid "Pag" 3604 msgstr "पृष्ठसभ" 3605 3606 #: kdecore/kcalendarsystemethiopian.cpp:165 3607 #, fuzzy, kde-format 3608 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3609 msgid "of Meskerem" 3610 msgstr "मेहर क' " 3611 3612 #: kdecore/kcalendarsystemethiopian.cpp:167 3613 #, fuzzy, kde-format 3614 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3615 msgid "of Tequemt" 3616 msgstr "तेवेत क' " 3617 3618 #: kdecore/kcalendarsystemethiopian.cpp:169 3619 #, fuzzy, kde-format 3620 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3621 msgid "of Hedar" 3622 msgstr "अदार क' " 3623 3624 #: kdecore/kcalendarsystemethiopian.cpp:171 3625 #, fuzzy, kde-format 3626 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3627 msgid "of Tahsas" 3628 msgstr "बहमान क' " 3629 3630 #: kdecore/kcalendarsystemethiopian.cpp:173 3631 #, fuzzy, kde-format 3632 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3633 msgid "of Ter" 3634 msgstr "तिर क' " 3635 3636 #: kdecore/kcalendarsystemethiopian.cpp:175 3637 #, fuzzy, kde-format 3638 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3639 msgid "of Yakatit" 3640 msgstr "फर क' " 3641 3642 #: kdecore/kcalendarsystemethiopian.cpp:177 3643 #, fuzzy, kde-format 3644 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3645 msgid "of Magabit" 3646 msgstr "रज्जब क' " 3647 3648 #: kdecore/kcalendarsystemethiopian.cpp:179 3649 #, fuzzy, kde-format 3650 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3651 msgid "of Miyazya" 3652 msgstr "मई क' " 3653 3654 #: kdecore/kcalendarsystemethiopian.cpp:181 3655 #, fuzzy, kde-format 3656 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3657 msgid "of Genbot" 3658 msgstr "फरवरी क' " 3659 3660 #: kdecore/kcalendarsystemethiopian.cpp:183 3661 #, fuzzy, kde-format 3662 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3663 msgid "of Sene" 3664 msgstr "सित. क' " 3665 3666 #: kdecore/kcalendarsystemethiopian.cpp:185 3667 #, fuzzy, kde-format 3668 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3669 msgid "of Hamle" 3670 msgstr "तमुज क' " 3671 3672 #: kdecore/kcalendarsystemethiopian.cpp:187 3673 #, fuzzy, kde-format 3674 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3675 msgid "of Nehase" 3676 msgstr "शाह क' " 3677 3678 #: kdecore/kcalendarsystemethiopian.cpp:189 3679 #, fuzzy, kde-format 3680 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3681 msgid "of Pagumen" 3682 msgstr "तमुज क' " 3683 3684 #: kdecore/kcalendarsystemethiopian.cpp:198 3685 #, fuzzy, kde-format 3686 msgctxt "Ethiopian month 1 - KLocale::LongName" 3687 msgid "Meskerem" 3688 msgstr "मेहर क' " 3689 3690 #: kdecore/kcalendarsystemethiopian.cpp:200 3691 #, fuzzy, kde-format 3692 msgctxt "Ethiopian month 2 - KLocale::LongName" 3693 msgid "Tequemt" 3694 msgstr "तेवत" 3695 3696 #: kdecore/kcalendarsystemethiopian.cpp:202 3697 #, fuzzy, kde-format 3698 msgctxt "Ethiopian month 3 - KLocale::LongName" 3699 msgid "Hedar" 3700 msgstr "अदर" 3701 3702 #: kdecore/kcalendarsystemethiopian.cpp:204 3703 #, fuzzy, kde-format 3704 msgctxt "Ethiopian month 4 - KLocale::LongName" 3705 msgid "Tahsas" 3706 msgstr "काज" 3707 3708 #: kdecore/kcalendarsystemethiopian.cpp:206 3709 #, fuzzy, kde-format 3710 msgctxt "Ethiopian month 5 - KLocale::LongName" 3711 msgid "Ter" 3712 msgstr "मंगल" 3713 3714 #: kdecore/kcalendarsystemethiopian.cpp:208 3715 #, fuzzy, kde-format 3716 msgctxt "Ethiopian month 6 - KLocale::LongName" 3717 msgid "Yakatit" 3718 msgstr "फर क' " 3719 3720 #: kdecore/kcalendarsystemethiopian.cpp:210 3721 #, fuzzy, kde-format 3722 msgctxt "Ethiopian month 7 - KLocale::LongName" 3723 msgid "Magabit" 3724 msgstr "रज्जब क' " 3725 3726 #: kdecore/kcalendarsystemethiopian.cpp:212 3727 #, fuzzy, kde-format 3728 msgctxt "Ethiopian month 8 - KLocale::LongName" 3729 msgid "Miyazya" 3730 msgstr "मई क' " 3731 3732 #: kdecore/kcalendarsystemethiopian.cpp:214 3733 #, fuzzy, kde-format 3734 msgctxt "Ethiopian month 9 - KLocale::LongName" 3735 msgid "Genbot" 3736 msgstr "फरवरी क' " 3737 3738 #: kdecore/kcalendarsystemethiopian.cpp:216 3739 #, fuzzy, kde-format 3740 msgctxt "Ethiopian month 10 - KLocale::LongName" 3741 msgid "Sene" 3742 msgstr "भेजू (&S)" 3743 3744 #: kdecore/kcalendarsystemethiopian.cpp:218 3745 #, fuzzy, kde-format 3746 msgctxt "Ethiopian month 11 - KLocale::LongName" 3747 msgid "Hamle" 3748 msgstr "नाम" 3749 3750 #: kdecore/kcalendarsystemethiopian.cpp:220 3751 #, fuzzy, kde-format 3752 msgctxt "Ethiopian month 12 - KLocale::LongName" 3753 msgid "Nehase" 3754 msgstr "नाम" 3755 3756 #: kdecore/kcalendarsystemethiopian.cpp:222 3757 #, fuzzy, kde-format 3758 msgctxt "Ethiopian month 13 - KLocale::LongName" 3759 msgid "Pagumen" 3760 msgstr "पृष्ठसभ" 3761 3762 #: kdecore/kcalendarsystemethiopian.cpp:236 3763 #, kde-format 3764 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3765 msgid "S" 3766 msgstr "" 3767 3768 #: kdecore/kcalendarsystemethiopian.cpp:238 3769 #, kde-format 3770 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3771 msgid "M" 3772 msgstr "" 3773 3774 #: kdecore/kcalendarsystemethiopian.cpp:240 3775 #, kde-format 3776 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3777 msgid "R" 3778 msgstr "" 3779 3780 #: kdecore/kcalendarsystemethiopian.cpp:242 3781 #, kde-format 3782 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3783 msgid "H" 3784 msgstr "" 3785 3786 #: kdecore/kcalendarsystemethiopian.cpp:244 3787 #, fuzzy, kde-format 3788 #| msgid "Av" 3789 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3790 msgid "A" 3791 msgstr "एव" 3792 3793 #: kdecore/kcalendarsystemethiopian.cpp:246 3794 #, kde-format 3795 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3796 msgid "Q" 3797 msgstr "" 3798 3799 #: kdecore/kcalendarsystemethiopian.cpp:248 3800 #, kde-format 3801 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3802 msgid "E" 3803 msgstr "" 3804 3805 #: kdecore/kcalendarsystemethiopian.cpp:257 3806 #, fuzzy, kde-format 3807 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3808 msgid "Seg" 3809 msgstr "सितंबर" 3810 3811 #: kdecore/kcalendarsystemethiopian.cpp:259 3812 #, fuzzy, kde-format 3813 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3814 msgid "Mak" 3815 msgstr "मार्च" 3816 3817 #: kdecore/kcalendarsystemethiopian.cpp:261 3818 #, fuzzy, kde-format 3819 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3820 msgid "Rob" 3821 msgstr "काज" 3822 3823 #: kdecore/kcalendarsystemethiopian.cpp:263 3824 #, fuzzy, kde-format 3825 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3826 msgid "Ham" 3827 msgstr "पूर्वाह्न" 3828 3829 #: kdecore/kcalendarsystemethiopian.cpp:265 3830 #, fuzzy, kde-format 3831 #| msgid "Arb" 3832 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3833 msgid "Arb" 3834 msgstr "बुध" 3835 3836 #: kdecore/kcalendarsystemethiopian.cpp:267 3837 #, fuzzy, kde-format 3838 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3839 msgid "Qed" 3840 msgstr "बुध" 3841 3842 #: kdecore/kcalendarsystemethiopian.cpp:269 3843 #, fuzzy, kde-format 3844 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3845 msgid "Ehu" 3846 msgstr "गुरू" 3847 3848 #: kdecore/kcalendarsystemethiopian.cpp:276 3849 #, fuzzy, kde-format 3850 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3851 msgid "Segno" 3852 msgstr "भेजू (&S)" 3853 3854 #: kdecore/kcalendarsystemethiopian.cpp:278 3855 #, fuzzy, kde-format 3856 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3857 msgid "Maksegno" 3858 msgstr "भेजू (&S)" 3859 3860 #: kdecore/kcalendarsystemethiopian.cpp:280 3861 #, fuzzy, kde-format 3862 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3863 msgid "Rob" 3864 msgstr "काज" 3865 3866 #: kdecore/kcalendarsystemethiopian.cpp:282 3867 #, fuzzy, kde-format 3868 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3869 msgid "Hamus" 3870 msgstr "ठहरू" 3871 3872 #: kdecore/kcalendarsystemethiopian.cpp:284 3873 #, fuzzy, kde-format 3874 #| msgid "Arb" 3875 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3876 msgid "Arb" 3877 msgstr "बुध" 3878 3879 #: kdecore/kcalendarsystemethiopian.cpp:286 3880 #, fuzzy, kde-format 3881 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3882 msgid "Qedame" 3883 msgstr "नाम" 3884 3885 #: kdecore/kcalendarsystemethiopian.cpp:288 3886 #, fuzzy, kde-format 3887 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3888 msgid "Ehud" 3889 msgstr "गुरू" 3890 3891 #: kdecore/kcalendarsystemgregorian.cpp:53 3892 #, kde-format 3893 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3894 msgid "Before Common Era" 3895 msgstr "" 3896 3897 #: kdecore/kcalendarsystemgregorian.cpp:54 3898 #, kde-format 3899 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3900 msgid "BCE" 3901 msgstr "" 3902 3903 #: kdecore/kcalendarsystemgregorian.cpp:56 3904 #, kde-format 3905 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3906 msgid "Before Christ" 3907 msgstr "" 3908 3909 #: kdecore/kcalendarsystemgregorian.cpp:57 3910 #, kde-format 3911 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3912 msgid "BC" 3913 msgstr "" 3914 3915 #: kdecore/kcalendarsystemgregorian.cpp:59 3916 #, kde-format 3917 msgctxt "" 3918 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3919 msgid "%Ey %EC" 3920 msgstr "" 3921 3922 #: kdecore/kcalendarsystemgregorian.cpp:63 3923 #, kde-format 3924 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3925 msgid "Common Era" 3926 msgstr "" 3927 3928 #: kdecore/kcalendarsystemgregorian.cpp:64 3929 #, kde-format 3930 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3931 msgid "CE" 3932 msgstr "" 3933 3934 #: kdecore/kcalendarsystemgregorian.cpp:66 3935 #: kdecore/kcalendarsystemjapanese.cpp:57 3936 #, kde-format 3937 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3938 msgid "Anno Domini" 3939 msgstr "" 3940 3941 #: kdecore/kcalendarsystemgregorian.cpp:67 3942 #: kdecore/kcalendarsystemjapanese.cpp:58 3943 #, kde-format 3944 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3945 msgid "AD" 3946 msgstr "" 3947 3948 #: kdecore/kcalendarsystemgregorian.cpp:69 3949 #: kdecore/kcalendarsystemjapanese.cpp:59 3950 #, kde-format 3951 msgctxt "" 3952 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3953 msgid "%Ey %EC" 3954 msgstr "" 3955 3956 #: kdecore/kcalendarsystemgregorian.cpp:138 3957 #, kde-format 3958 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3959 msgid "J" 3960 msgstr "" 3961 3962 #: kdecore/kcalendarsystemgregorian.cpp:140 3963 #, kde-format 3964 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3965 msgid "F" 3966 msgstr "" 3967 3968 #: kdecore/kcalendarsystemgregorian.cpp:142 3969 #, kde-format 3970 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3971 msgid "M" 3972 msgstr "" 3973 3974 #: kdecore/kcalendarsystemgregorian.cpp:144 3975 #, fuzzy, kde-format 3976 #| msgid "Av" 3977 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3978 msgid "A" 3979 msgstr "एव" 3980 3981 #: kdecore/kcalendarsystemgregorian.cpp:146 3982 #, kde-format 3983 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3984 msgid "M" 3985 msgstr "" 3986 3987 #: kdecore/kcalendarsystemgregorian.cpp:148 3988 #, kde-format 3989 msgctxt "Gregorian month 6 - KLocale::NarrowName" 3990 msgid "J" 3991 msgstr "" 3992 3993 #: kdecore/kcalendarsystemgregorian.cpp:150 3994 #, kde-format 3995 msgctxt "Gregorian month 7 - KLocale::NarrowName" 3996 msgid "J" 3997 msgstr "" 3998 3999 #: kdecore/kcalendarsystemgregorian.cpp:152 4000 #, fuzzy, kde-format 4001 #| msgid "Av" 4002 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4003 msgid "A" 4004 msgstr "एव" 4005 4006 #: kdecore/kcalendarsystemgregorian.cpp:154 4007 #, kde-format 4008 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4009 msgid "S" 4010 msgstr "" 4011 4012 #: kdecore/kcalendarsystemgregorian.cpp:156 4013 #, kde-format 4014 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4015 msgid "O" 4016 msgstr "" 4017 4018 #: kdecore/kcalendarsystemgregorian.cpp:158 4019 #, kde-format 4020 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4021 msgid "N" 4022 msgstr "" 4023 4024 #: kdecore/kcalendarsystemgregorian.cpp:160 4025 #, kde-format 4026 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4027 msgid "D" 4028 msgstr "" 4029 4030 #: kdecore/kcalendarsystemgregorian.cpp:169 4031 #, fuzzy, kde-format 4032 #| msgctxt "of January" 4033 #| msgid "of Jan" 4034 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4035 msgid "of Jan" 4036 msgstr "जनवरी क' " 4037 4038 #: kdecore/kcalendarsystemgregorian.cpp:171 4039 #, fuzzy, kde-format 4040 #| msgctxt "of February" 4041 #| msgid "of Feb" 4042 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4043 msgid "of Feb" 4044 msgstr "फरवरी क' " 4045 4046 #: kdecore/kcalendarsystemgregorian.cpp:173 4047 #, fuzzy, kde-format 4048 #| msgctxt "of March" 4049 #| msgid "of Mar" 4050 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4051 msgid "of Mar" 4052 msgstr "मार्च क' " 4053 4054 #: kdecore/kcalendarsystemgregorian.cpp:175 4055 #, fuzzy, kde-format 4056 #| msgctxt "of April" 4057 #| msgid "of Apr" 4058 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4059 msgid "of Apr" 4060 msgstr "अप्रैल क' " 4061 4062 #: kdecore/kcalendarsystemgregorian.cpp:177 4063 #, fuzzy, kde-format 4064 #| msgctxt "of May short" 4065 #| msgid "of May" 4066 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4067 msgid "of May" 4068 msgstr "मई क' " 4069 4070 #: kdecore/kcalendarsystemgregorian.cpp:179 4071 #, fuzzy, kde-format 4072 #| msgctxt "of June" 4073 #| msgid "of Jun" 4074 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4075 msgid "of Jun" 4076 msgstr "जून क' " 4077 4078 #: kdecore/kcalendarsystemgregorian.cpp:181 4079 #, fuzzy, kde-format 4080 #| msgctxt "of July" 4081 #| msgid "of Jul" 4082 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4083 msgid "of Jul" 4084 msgstr "जुलाई क' " 4085 4086 #: kdecore/kcalendarsystemgregorian.cpp:183 4087 #, fuzzy, kde-format 4088 #| msgctxt "of August" 4089 #| msgid "of Aug" 4090 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4091 msgid "of Aug" 4092 msgstr "अग. क' " 4093 4094 #: kdecore/kcalendarsystemgregorian.cpp:185 4095 #, fuzzy, kde-format 4096 #| msgctxt "of September" 4097 #| msgid "of Sep" 4098 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4099 msgid "of Sep" 4100 msgstr "सित. क' " 4101 4102 #: kdecore/kcalendarsystemgregorian.cpp:187 4103 #, fuzzy, kde-format 4104 #| msgctxt "of October" 4105 #| msgid "of Oct" 4106 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4107 msgid "of Oct" 4108 msgstr "अक्तू. क' " 4109 4110 #: kdecore/kcalendarsystemgregorian.cpp:189 4111 #, fuzzy, kde-format 4112 #| msgctxt "of November" 4113 #| msgid "of Nov" 4114 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4115 msgid "of Nov" 4116 msgstr "नवं. क' " 4117 4118 #: kdecore/kcalendarsystemgregorian.cpp:191 4119 #, fuzzy, kde-format 4120 #| msgctxt "of December" 4121 #| msgid "of Dec" 4122 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4123 msgid "of Dec" 4124 msgstr "दिस. क' " 4125 4126 #: kdecore/kcalendarsystemgregorian.cpp:200 4127 #, fuzzy, kde-format 4128 #| msgctxt "January" 4129 #| msgid "Jan" 4130 msgctxt "Gregorian month 1 - KLocale::ShortName" 4131 msgid "Jan" 4132 msgstr "जनवरी" 4133 4134 #: kdecore/kcalendarsystemgregorian.cpp:202 4135 #, fuzzy, kde-format 4136 #| msgctxt "February" 4137 #| msgid "Feb" 4138 msgctxt "Gregorian month 2 - KLocale::ShortName" 4139 msgid "Feb" 4140 msgstr "फरवरी" 4141 4142 #: kdecore/kcalendarsystemgregorian.cpp:204 4143 #, fuzzy, kde-format 4144 #| msgctxt "March" 4145 #| msgid "Mar" 4146 msgctxt "Gregorian month 3 - KLocale::ShortName" 4147 msgid "Mar" 4148 msgstr "मार्च" 4149 4150 #: kdecore/kcalendarsystemgregorian.cpp:206 4151 #, fuzzy, kde-format 4152 #| msgctxt "April" 4153 #| msgid "Apr" 4154 msgctxt "Gregorian month 4 - KLocale::ShortName" 4155 msgid "Apr" 4156 msgstr "अप्रैल" 4157 4158 #: kdecore/kcalendarsystemgregorian.cpp:208 4159 #, fuzzy, kde-format 4160 #| msgctxt "May short" 4161 #| msgid "May" 4162 msgctxt "Gregorian month 5 - KLocale::ShortName" 4163 msgid "May" 4164 msgstr "मई" 4165 4166 #: kdecore/kcalendarsystemgregorian.cpp:210 4167 #, fuzzy, kde-format 4168 #| msgctxt "June" 4169 #| msgid "Jun" 4170 msgctxt "Gregorian month 6 - KLocale::ShortName" 4171 msgid "Jun" 4172 msgstr "जून" 4173 4174 #: kdecore/kcalendarsystemgregorian.cpp:212 4175 #, fuzzy, kde-format 4176 #| msgctxt "July" 4177 #| msgid "Jul" 4178 msgctxt "Gregorian month 7 - KLocale::ShortName" 4179 msgid "Jul" 4180 msgstr "जुलाइ" 4181 4182 #: kdecore/kcalendarsystemgregorian.cpp:214 4183 #, fuzzy, kde-format 4184 #| msgctxt "August" 4185 #| msgid "Aug" 4186 msgctxt "Gregorian month 8 - KLocale::ShortName" 4187 msgid "Aug" 4188 msgstr "अगस्त" 4189 4190 #: kdecore/kcalendarsystemgregorian.cpp:216 4191 #, fuzzy, kde-format 4192 #| msgctxt "September" 4193 #| msgid "Sep" 4194 msgctxt "Gregorian month 9 - KLocale::ShortName" 4195 msgid "Sep" 4196 msgstr "सितंबर" 4197 4198 #: kdecore/kcalendarsystemgregorian.cpp:218 4199 #, fuzzy, kde-format 4200 #| msgctxt "October" 4201 #| msgid "Oct" 4202 msgctxt "Gregorian month 10 - KLocale::ShortName" 4203 msgid "Oct" 4204 msgstr "अक्टूबर" 4205 4206 #: kdecore/kcalendarsystemgregorian.cpp:220 4207 #, fuzzy, kde-format 4208 #| msgctxt "November" 4209 #| msgid "Nov" 4210 msgctxt "Gregorian month 11 - KLocale::ShortName" 4211 msgid "Nov" 4212 msgstr "नबंबर" 4213 4214 #: kdecore/kcalendarsystemgregorian.cpp:222 4215 #, fuzzy, kde-format 4216 #| msgctxt "December" 4217 #| msgid "Dec" 4218 msgctxt "Gregorian month 12 - KLocale::ShortName" 4219 msgid "Dec" 4220 msgstr "दिसंबर" 4221 4222 #: kdecore/kcalendarsystemgregorian.cpp:231 4223 #, fuzzy, kde-format 4224 #| msgid "of January" 4225 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4226 msgid "of January" 4227 msgstr "जनवरी क' " 4228 4229 #: kdecore/kcalendarsystemgregorian.cpp:233 4230 #, fuzzy, kde-format 4231 #| msgid "of February" 4232 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4233 msgid "of February" 4234 msgstr "फरवरी क' " 4235 4236 #: kdecore/kcalendarsystemgregorian.cpp:235 4237 #, fuzzy, kde-format 4238 #| msgid "of March" 4239 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4240 msgid "of March" 4241 msgstr "मार्च क' " 4242 4243 #: kdecore/kcalendarsystemgregorian.cpp:237 4244 #, fuzzy, kde-format 4245 #| msgid "of April" 4246 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4247 msgid "of April" 4248 msgstr "अप्रैल क' " 4249 4250 #: kdecore/kcalendarsystemgregorian.cpp:239 4251 #, fuzzy, kde-format 4252 #| msgctxt "of May short" 4253 #| msgid "of May" 4254 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4255 msgid "of May" 4256 msgstr "मई क' " 4257 4258 #: kdecore/kcalendarsystemgregorian.cpp:241 4259 #, fuzzy, kde-format 4260 #| msgid "of June" 4261 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4262 msgid "of June" 4263 msgstr "जून क' " 4264 4265 #: kdecore/kcalendarsystemgregorian.cpp:243 4266 #, fuzzy, kde-format 4267 #| msgid "of July" 4268 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4269 msgid "of July" 4270 msgstr "जुलाई क' " 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:245 4273 #, fuzzy, kde-format 4274 #| msgid "of August" 4275 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4276 msgid "of August" 4277 msgstr "अगस्त क' " 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:247 4280 #, fuzzy, kde-format 4281 #| msgid "of September" 4282 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4283 msgid "of September" 4284 msgstr "सितम्बर क' " 4285 4286 #: kdecore/kcalendarsystemgregorian.cpp:249 4287 #, fuzzy, kde-format 4288 #| msgid "of October" 4289 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4290 msgid "of October" 4291 msgstr "अक्टूबर क' " 4292 4293 #: kdecore/kcalendarsystemgregorian.cpp:251 4294 #, fuzzy, kde-format 4295 #| msgid "of November" 4296 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4297 msgid "of November" 4298 msgstr "नवंबर क' " 4299 4300 #: kdecore/kcalendarsystemgregorian.cpp:253 4301 #, fuzzy, kde-format 4302 #| msgid "of December" 4303 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4304 msgid "of December" 4305 msgstr "दिसम्बर क' " 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:262 4308 #, fuzzy, kde-format 4309 #| msgid "January" 4310 msgctxt "Gregorian month 1 - KLocale::LongName" 4311 msgid "January" 4312 msgstr "जनवरी" 4313 4314 #: kdecore/kcalendarsystemgregorian.cpp:264 4315 #, fuzzy, kde-format 4316 #| msgid "February" 4317 msgctxt "Gregorian month 2 - KLocale::LongName" 4318 msgid "February" 4319 msgstr "फरवरी" 4320 4321 #: kdecore/kcalendarsystemgregorian.cpp:266 4322 #, fuzzy, kde-format 4323 #| msgctxt "March long" 4324 #| msgid "March" 4325 msgctxt "Gregorian month 3 - KLocale::LongName" 4326 msgid "March" 4327 msgstr "मार्च" 4328 4329 #: kdecore/kcalendarsystemgregorian.cpp:268 4330 #, fuzzy, kde-format 4331 #| msgid "April" 4332 msgctxt "Gregorian month 4 - KLocale::LongName" 4333 msgid "April" 4334 msgstr "अप्रैल" 4335 4336 #: kdecore/kcalendarsystemgregorian.cpp:270 4337 #, fuzzy, kde-format 4338 #| msgctxt "May short" 4339 #| msgid "May" 4340 msgctxt "Gregorian month 5 - KLocale::LongName" 4341 msgid "May" 4342 msgstr "मई" 4343 4344 #: kdecore/kcalendarsystemgregorian.cpp:272 4345 #, fuzzy, kde-format 4346 #| msgid "June" 4347 msgctxt "Gregorian month 6 - KLocale::LongName" 4348 msgid "June" 4349 msgstr "जून" 4350 4351 #: kdecore/kcalendarsystemgregorian.cpp:274 4352 #, fuzzy, kde-format 4353 #| msgid "July" 4354 msgctxt "Gregorian month 7 - KLocale::LongName" 4355 msgid "July" 4356 msgstr "जुलाइ" 4357 4358 #: kdecore/kcalendarsystemgregorian.cpp:276 4359 #, fuzzy, kde-format 4360 #| msgctxt "August long" 4361 #| msgid "August" 4362 msgctxt "Gregorian month 8 - KLocale::LongName" 4363 msgid "August" 4364 msgstr "अगस्त" 4365 4366 #: kdecore/kcalendarsystemgregorian.cpp:278 4367 #, fuzzy, kde-format 4368 #| msgid "September" 4369 msgctxt "Gregorian month 9 - KLocale::LongName" 4370 msgid "September" 4371 msgstr "सितम्बर" 4372 4373 #: kdecore/kcalendarsystemgregorian.cpp:280 4374 #, fuzzy, kde-format 4375 #| msgid "October" 4376 msgctxt "Gregorian month 10 - KLocale::LongName" 4377 msgid "October" 4378 msgstr "अक्टूबर" 4379 4380 #: kdecore/kcalendarsystemgregorian.cpp:282 4381 #, fuzzy, kde-format 4382 #| msgid "November" 4383 msgctxt "Gregorian month 11 - KLocale::LongName" 4384 msgid "November" 4385 msgstr "नवम्बर" 4386 4387 #: kdecore/kcalendarsystemgregorian.cpp:284 4388 #, fuzzy, kde-format 4389 #| msgid "December" 4390 msgctxt "Gregorian month 12 - KLocale::LongName" 4391 msgid "December" 4392 msgstr "दिसम्बर" 4393 4394 #: kdecore/kcalendarsystemgregorian.cpp:297 4395 #: kdecore/kcalendarsystemhebrew.cpp:807 4396 #, kde-format 4397 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4398 msgid "M" 4399 msgstr "" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:299 4402 #: kdecore/kcalendarsystemhebrew.cpp:809 4403 #, kde-format 4404 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4405 msgid "T" 4406 msgstr "" 4407 4408 #: kdecore/kcalendarsystemgregorian.cpp:301 4409 #: kdecore/kcalendarsystemhebrew.cpp:811 4410 #, kde-format 4411 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4412 msgid "W" 4413 msgstr "" 4414 4415 #: kdecore/kcalendarsystemgregorian.cpp:303 4416 #: kdecore/kcalendarsystemhebrew.cpp:813 4417 #, kde-format 4418 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4419 msgid "T" 4420 msgstr "" 4421 4422 #: kdecore/kcalendarsystemgregorian.cpp:305 4423 #: kdecore/kcalendarsystemhebrew.cpp:815 4424 #, kde-format 4425 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4426 msgid "F" 4427 msgstr "" 4428 4429 #: kdecore/kcalendarsystemgregorian.cpp:307 4430 #: kdecore/kcalendarsystemhebrew.cpp:817 4431 #, kde-format 4432 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4433 msgid "S" 4434 msgstr "" 4435 4436 #: kdecore/kcalendarsystemgregorian.cpp:309 4437 #: kdecore/kcalendarsystemhebrew.cpp:819 4438 #, kde-format 4439 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4440 msgid "S" 4441 msgstr "" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:318 4444 #: kdecore/kcalendarsystemhebrew.cpp:828 4445 #, fuzzy, kde-format 4446 #| msgctxt "Monday" 4447 #| msgid "Mon" 4448 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4449 msgid "Mon" 4450 msgstr "सोम" 4451 4452 #: kdecore/kcalendarsystemgregorian.cpp:320 4453 #: kdecore/kcalendarsystemhebrew.cpp:830 4454 #, fuzzy, kde-format 4455 #| msgctxt "Tuesday" 4456 #| msgid "Tue" 4457 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4458 msgid "Tue" 4459 msgstr "मंगल" 4460 4461 #: kdecore/kcalendarsystemgregorian.cpp:322 4462 #: kdecore/kcalendarsystemhebrew.cpp:832 4463 #, fuzzy, kde-format 4464 #| msgctxt "Wednesday" 4465 #| msgid "Wed" 4466 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4467 msgid "Wed" 4468 msgstr "बुध" 4469 4470 #: kdecore/kcalendarsystemgregorian.cpp:324 4471 #: kdecore/kcalendarsystemhebrew.cpp:834 4472 #, fuzzy, kde-format 4473 #| msgctxt "Thursday" 4474 #| msgid "Thu" 4475 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4476 msgid "Thu" 4477 msgstr "गुरू" 4478 4479 #: kdecore/kcalendarsystemgregorian.cpp:326 4480 #: kdecore/kcalendarsystemhebrew.cpp:836 4481 #, fuzzy, kde-format 4482 #| msgctxt "Friday" 4483 #| msgid "Fri" 4484 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4485 msgid "Fri" 4486 msgstr "शुक्र" 4487 4488 #: kdecore/kcalendarsystemgregorian.cpp:328 4489 #: kdecore/kcalendarsystemhebrew.cpp:838 4490 #, fuzzy, kde-format 4491 #| msgctxt "Saturday" 4492 #| msgid "Sat" 4493 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4494 msgid "Sat" 4495 msgstr "शनि" 4496 4497 #: kdecore/kcalendarsystemgregorian.cpp:330 4498 #: kdecore/kcalendarsystemhebrew.cpp:840 4499 #, fuzzy, kde-format 4500 #| msgctxt "Sunday" 4501 #| msgid "Sun" 4502 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4503 msgid "Sun" 4504 msgstr "सूर्य" 4505 4506 #: kdecore/kcalendarsystemgregorian.cpp:337 4507 #: kdecore/kcalendarsystemhebrew.cpp:847 4508 #, fuzzy, kde-format 4509 #| msgid "Monday" 4510 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4511 msgid "Monday" 4512 msgstr "सोमवार" 4513 4514 #: kdecore/kcalendarsystemgregorian.cpp:339 4515 #: kdecore/kcalendarsystemhebrew.cpp:849 4516 #, fuzzy, kde-format 4517 #| msgid "Tuesday" 4518 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4519 msgid "Tuesday" 4520 msgstr "मंगलवार" 4521 4522 #: kdecore/kcalendarsystemgregorian.cpp:341 4523 #: kdecore/kcalendarsystemhebrew.cpp:851 4524 #, fuzzy, kde-format 4525 #| msgid "Wednesday" 4526 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4527 msgid "Wednesday" 4528 msgstr "बुधवार" 4529 4530 #: kdecore/kcalendarsystemgregorian.cpp:343 4531 #: kdecore/kcalendarsystemhebrew.cpp:853 4532 #, fuzzy, kde-format 4533 #| msgid "Thursday" 4534 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4535 msgid "Thursday" 4536 msgstr "वृहस्पतिवार" 4537 4538 #: kdecore/kcalendarsystemgregorian.cpp:345 4539 #: kdecore/kcalendarsystemhebrew.cpp:855 4540 #, fuzzy, kde-format 4541 #| msgid "Friday" 4542 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4543 msgid "Friday" 4544 msgstr "शुक्रवार" 4545 4546 #: kdecore/kcalendarsystemgregorian.cpp:347 4547 #: kdecore/kcalendarsystemhebrew.cpp:857 4548 #, fuzzy, kde-format 4549 #| msgid "Saturday" 4550 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4551 msgid "Saturday" 4552 msgstr "शनिवार" 4553 4554 #: kdecore/kcalendarsystemgregorian.cpp:349 4555 #: kdecore/kcalendarsystemhebrew.cpp:859 4556 #, fuzzy, kde-format 4557 #| msgid "Sunday" 4558 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4559 msgid "Sunday" 4560 msgstr "रविवार" 4561 4562 #: kdecore/kcalendarsystemhebrew.cpp:281 4563 #, kde-format 4564 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4565 msgid "Anno Mundi" 4566 msgstr "" 4567 4568 #: kdecore/kcalendarsystemhebrew.cpp:282 4569 #, kde-format 4570 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4571 msgid "AM" 4572 msgstr "" 4573 4574 #: kdecore/kcalendarsystemhebrew.cpp:283 4575 #, kde-format 4576 msgctxt "" 4577 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4578 msgid "%Ey %EC" 4579 msgstr "" 4580 4581 #: kdecore/kcalendarsystemhebrew.cpp:625 4582 #, kde-format 4583 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4584 msgid "T" 4585 msgstr "" 4586 4587 #: kdecore/kcalendarsystemhebrew.cpp:627 4588 #, kde-format 4589 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4590 msgid "H" 4591 msgstr "" 4592 4593 #: kdecore/kcalendarsystemhebrew.cpp:629 4594 #, kde-format 4595 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4596 msgid "K" 4597 msgstr "" 4598 4599 #: kdecore/kcalendarsystemhebrew.cpp:631 4600 #, kde-format 4601 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4602 msgid "T" 4603 msgstr "" 4604 4605 #: kdecore/kcalendarsystemhebrew.cpp:633 4606 #, kde-format 4607 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4608 msgid "S" 4609 msgstr "" 4610 4611 #: kdecore/kcalendarsystemhebrew.cpp:635 4612 #, fuzzy, kde-format 4613 #| msgid "Av" 4614 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4615 msgid "A" 4616 msgstr "एव" 4617 4618 #: kdecore/kcalendarsystemhebrew.cpp:637 4619 #, kde-format 4620 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4621 msgid "N" 4622 msgstr "" 4623 4624 #: kdecore/kcalendarsystemhebrew.cpp:639 4625 #, kde-format 4626 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4627 msgid "I" 4628 msgstr "" 4629 4630 #: kdecore/kcalendarsystemhebrew.cpp:641 4631 #, kde-format 4632 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4633 msgid "S" 4634 msgstr "" 4635 4636 #: kdecore/kcalendarsystemhebrew.cpp:643 4637 #, kde-format 4638 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4639 msgid "T" 4640 msgstr "" 4641 4642 #: kdecore/kcalendarsystemhebrew.cpp:645 4643 #, fuzzy, kde-format 4644 #| msgid "Av" 4645 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4646 msgid "A" 4647 msgstr "एव" 4648 4649 #: kdecore/kcalendarsystemhebrew.cpp:647 4650 #, kde-format 4651 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4652 msgid "E" 4653 msgstr "" 4654 4655 #: kdecore/kcalendarsystemhebrew.cpp:649 4656 #, fuzzy, kde-format 4657 #| msgid "Av" 4658 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4659 msgid "A" 4660 msgstr "एव" 4661 4662 #: kdecore/kcalendarsystemhebrew.cpp:651 4663 #, fuzzy, kde-format 4664 #| msgid "Av" 4665 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4666 msgid "A" 4667 msgstr "एव" 4668 4669 #: kdecore/kcalendarsystemhebrew.cpp:660 4670 #, fuzzy, kde-format 4671 #| msgctxt "of Tir short" 4672 #| msgid "of Tir" 4673 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4674 msgid "of Tis" 4675 msgstr "तिर क' " 4676 4677 #: kdecore/kcalendarsystemhebrew.cpp:662 4678 #, fuzzy, kde-format 4679 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4680 msgid "of Hes" 4681 msgstr "मेह क' " 4682 4683 #: kdecore/kcalendarsystemhebrew.cpp:664 4684 #, fuzzy, kde-format 4685 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4686 msgid "of Kis" 4687 msgstr "निसान क' " 4688 4689 #: kdecore/kcalendarsystemhebrew.cpp:666 4690 #, fuzzy, kde-format 4691 #| msgid "of Tevet" 4692 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4693 msgid "of Tev" 4694 msgstr "तेवेत क' " 4695 4696 #: kdecore/kcalendarsystemhebrew.cpp:668 4697 #, fuzzy, kde-format 4698 #| msgid "of Shvat" 4699 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4700 msgid "of Shv" 4701 msgstr "शवत क' " 4702 4703 #: kdecore/kcalendarsystemhebrew.cpp:670 4704 #, fuzzy, kde-format 4705 #| msgid "of Adar" 4706 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4707 msgid "of Ada" 4708 msgstr "अदार क' " 4709 4710 #: kdecore/kcalendarsystemhebrew.cpp:672 4711 #, fuzzy, kde-format 4712 #| msgid "of Nisan" 4713 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4714 msgid "of Nis" 4715 msgstr "निसान क' " 4716 4717 #: kdecore/kcalendarsystemhebrew.cpp:674 4718 #, fuzzy, kde-format 4719 #| msgid "of Iyar" 4720 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4721 msgid "of Iya" 4722 msgstr "इयार क' " 4723 4724 #: kdecore/kcalendarsystemhebrew.cpp:676 4725 #, fuzzy, kde-format 4726 #| msgid "of Sivan" 4727 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4728 msgid "of Siv" 4729 msgstr "सिवान क' " 4730 4731 #: kdecore/kcalendarsystemhebrew.cpp:678 4732 #, fuzzy, kde-format 4733 #| msgid "of Tamuz" 4734 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4735 msgid "of Tam" 4736 msgstr "तमुज क' " 4737 4738 #: kdecore/kcalendarsystemhebrew.cpp:680 4739 #, fuzzy, kde-format 4740 #| msgid "of Av" 4741 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4742 msgid "of Av" 4743 msgstr "एव क' " 4744 4745 #: kdecore/kcalendarsystemhebrew.cpp:682 4746 #, fuzzy, kde-format 4747 #| msgid "of Elul" 4748 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4749 msgid "of Elu" 4750 msgstr "एलुल क' " 4751 4752 #: kdecore/kcalendarsystemhebrew.cpp:684 4753 #, fuzzy, kde-format 4754 #| msgid "of Adar" 4755 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4756 msgid "of Ad1" 4757 msgstr "अदार क' " 4758 4759 #: kdecore/kcalendarsystemhebrew.cpp:686 4760 #, fuzzy, kde-format 4761 #| msgid "of Adar" 4762 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4763 msgid "of Ad2" 4764 msgstr "अदार क' " 4765 4766 #: kdecore/kcalendarsystemhebrew.cpp:695 4767 #, fuzzy, kde-format 4768 #| msgctxt "Tir short" 4769 #| msgid "Tir" 4770 msgctxt "Hebrew month 1 - KLocale::ShortName" 4771 msgid "Tis" 4772 msgstr "तिर" 4773 4774 #: kdecore/kcalendarsystemhebrew.cpp:697 4775 #, fuzzy, kde-format 4776 msgctxt "Hebrew month 2 - KLocale::ShortName" 4777 msgid "Hes" 4778 msgstr "हँ" 4779 4780 #: kdecore/kcalendarsystemhebrew.cpp:699 4781 #, fuzzy, kde-format 4782 #| msgid "Kislev" 4783 msgctxt "Hebrew month 3 - KLocale::ShortName" 4784 msgid "Kis" 4785 msgstr "किस्लेव" 4786 4787 #: kdecore/kcalendarsystemhebrew.cpp:701 4788 #, fuzzy, kde-format 4789 #| msgid "Tevet" 4790 msgctxt "Hebrew month 4 - KLocale::ShortName" 4791 msgid "Tev" 4792 msgstr "तेवत" 4793 4794 #: kdecore/kcalendarsystemhebrew.cpp:703 4795 #, fuzzy, kde-format 4796 #| msgid "Shvat" 4797 msgctxt "Hebrew month 5 - KLocale::ShortName" 4798 msgid "Shv" 4799 msgstr "श्वत" 4800 4801 #: kdecore/kcalendarsystemhebrew.cpp:705 4802 #, fuzzy, kde-format 4803 #| msgid "Adar" 4804 msgctxt "Hebrew month 6 - KLocale::ShortName" 4805 msgid "Ada" 4806 msgstr "अदर" 4807 4808 #: kdecore/kcalendarsystemhebrew.cpp:707 4809 #, fuzzy, kde-format 4810 #| msgid "Nisan" 4811 msgctxt "Hebrew month 7 - KLocale::ShortName" 4812 msgid "Nis" 4813 msgstr "निसान" 4814 4815 #: kdecore/kcalendarsystemhebrew.cpp:709 4816 #, fuzzy, kde-format 4817 #| msgid "Iyar" 4818 msgctxt "Hebrew month 8 - KLocale::ShortName" 4819 msgid "Iya" 4820 msgstr "इयार" 4821 4822 #: kdecore/kcalendarsystemhebrew.cpp:711 4823 #, fuzzy, kde-format 4824 #| msgid "Sivan" 4825 msgctxt "Hebrew month 9 - KLocale::ShortName" 4826 msgid "Siv" 4827 msgstr "सिवान" 4828 4829 #: kdecore/kcalendarsystemhebrew.cpp:713 4830 #, fuzzy, kde-format 4831 #| msgid "Tamuz" 4832 msgctxt "Hebrew month 10 - KLocale::ShortName" 4833 msgid "Tam" 4834 msgstr "तामुज" 4835 4836 #: kdecore/kcalendarsystemhebrew.cpp:715 4837 #, fuzzy, kde-format 4838 #| msgid "Av" 4839 msgctxt "Hebrew month 11 - KLocale::ShortName" 4840 msgid "Av" 4841 msgstr "एव" 4842 4843 #: kdecore/kcalendarsystemhebrew.cpp:717 4844 #, fuzzy, kde-format 4845 #| msgid "Elul" 4846 msgctxt "Hebrew month 12 - KLocale::ShortName" 4847 msgid "Elu" 4848 msgstr "एलुल" 4849 4850 #: kdecore/kcalendarsystemhebrew.cpp:719 4851 #, fuzzy, kde-format 4852 #| msgid "Ahd" 4853 msgctxt "Hebrew month 13 - KLocale::ShortName" 4854 msgid "Ad1" 4855 msgstr "रवि" 4856 4857 #: kdecore/kcalendarsystemhebrew.cpp:721 4858 #, fuzzy, kde-format 4859 #| msgid "Ahd" 4860 msgctxt "Hebrew month 14 - KLocale::ShortName" 4861 msgid "Ad2" 4862 msgstr "रवि" 4863 4864 #: kdecore/kcalendarsystemhebrew.cpp:730 4865 #, fuzzy, kde-format 4866 #| msgid "of Tishrey" 4867 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4868 msgid "of Tishrey" 4869 msgstr "तिशरे क' " 4870 4871 #: kdecore/kcalendarsystemhebrew.cpp:732 4872 #, fuzzy, kde-format 4873 #| msgid "of Heshvan" 4874 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4875 msgid "of Heshvan" 4876 msgstr "हेशवान क' " 4877 4878 #: kdecore/kcalendarsystemhebrew.cpp:734 4879 #, fuzzy, kde-format 4880 #| msgid "of Kislev" 4881 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4882 msgid "of Kislev" 4883 msgstr "किसलेव क' " 4884 4885 #: kdecore/kcalendarsystemhebrew.cpp:736 4886 #, fuzzy, kde-format 4887 #| msgid "of Tevet" 4888 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4889 msgid "of Tevet" 4890 msgstr "तेवेत क' " 4891 4892 #: kdecore/kcalendarsystemhebrew.cpp:738 4893 #, fuzzy, kde-format 4894 #| msgid "of Shvat" 4895 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4896 msgid "of Shvat" 4897 msgstr "शवत क' " 4898 4899 #: kdecore/kcalendarsystemhebrew.cpp:740 4900 #, fuzzy, kde-format 4901 #| msgid "of Adar" 4902 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4903 msgid "of Adar" 4904 msgstr "अदार क' " 4905 4906 #: kdecore/kcalendarsystemhebrew.cpp:742 4907 #, fuzzy, kde-format 4908 #| msgid "of Nisan" 4909 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4910 msgid "of Nisan" 4911 msgstr "निसान क' " 4912 4913 #: kdecore/kcalendarsystemhebrew.cpp:744 4914 #, fuzzy, kde-format 4915 #| msgid "of Iyar" 4916 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4917 msgid "of Iyar" 4918 msgstr "इयार क' " 4919 4920 #: kdecore/kcalendarsystemhebrew.cpp:746 4921 #, fuzzy, kde-format 4922 #| msgid "of Sivan" 4923 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4924 msgid "of Sivan" 4925 msgstr "सिवान क' " 4926 4927 #: kdecore/kcalendarsystemhebrew.cpp:748 4928 #, fuzzy, kde-format 4929 #| msgid "of Tamuz" 4930 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4931 msgid "of Tamuz" 4932 msgstr "तमुज क' " 4933 4934 #: kdecore/kcalendarsystemhebrew.cpp:750 4935 #, fuzzy, kde-format 4936 #| msgid "of Av" 4937 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4938 msgid "of Av" 4939 msgstr "एव क' " 4940 4941 #: kdecore/kcalendarsystemhebrew.cpp:752 4942 #, fuzzy, kde-format 4943 #| msgid "of Elul" 4944 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4945 msgid "of Elul" 4946 msgstr "एलुल क' " 4947 4948 #: kdecore/kcalendarsystemhebrew.cpp:754 4949 #, fuzzy, kde-format 4950 #| msgid "of Adar I" 4951 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4952 msgid "of Adar I" 4953 msgstr "अदार I क' " 4954 4955 #: kdecore/kcalendarsystemhebrew.cpp:756 4956 #, fuzzy, kde-format 4957 #| msgid "of Adar II" 4958 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4959 msgid "of Adar II" 4960 msgstr "अदार II क' " 4961 4962 #: kdecore/kcalendarsystemhebrew.cpp:765 4963 #, fuzzy, kde-format 4964 #| msgid "Tishrey" 4965 msgctxt "Hebrew month 1 - KLocale::LongName" 4966 msgid "Tishrey" 4967 msgstr "तिशरे" 4968 4969 #: kdecore/kcalendarsystemhebrew.cpp:767 4970 #, fuzzy, kde-format 4971 #| msgid "Heshvan" 4972 msgctxt "Hebrew month 2 - KLocale::LongName" 4973 msgid "Heshvan" 4974 msgstr "हेश्वान" 4975 4976 #: kdecore/kcalendarsystemhebrew.cpp:769 4977 #, fuzzy, kde-format 4978 #| msgid "Kislev" 4979 msgctxt "Hebrew month 3 - KLocale::LongName" 4980 msgid "Kislev" 4981 msgstr "किस्लेव" 4982 4983 #: kdecore/kcalendarsystemhebrew.cpp:771 4984 #, fuzzy, kde-format 4985 #| msgid "Tevet" 4986 msgctxt "Hebrew month 4 - KLocale::LongName" 4987 msgid "Tevet" 4988 msgstr "तेवत" 4989 4990 #: kdecore/kcalendarsystemhebrew.cpp:773 4991 #, fuzzy, kde-format 4992 #| msgid "Shvat" 4993 msgctxt "Hebrew month 5 - KLocale::LongName" 4994 msgid "Shvat" 4995 msgstr "श्वत" 4996 4997 #: kdecore/kcalendarsystemhebrew.cpp:775 4998 #, fuzzy, kde-format 4999 #| msgid "Adar" 5000 msgctxt "Hebrew month 6 - KLocale::LongName" 5001 msgid "Adar" 5002 msgstr "अदर" 5003 5004 #: kdecore/kcalendarsystemhebrew.cpp:777 5005 #, fuzzy, kde-format 5006 #| msgid "Nisan" 5007 msgctxt "Hebrew month 7 - KLocale::LongName" 5008 msgid "Nisan" 5009 msgstr "निसान" 5010 5011 #: kdecore/kcalendarsystemhebrew.cpp:779 5012 #, fuzzy, kde-format 5013 #| msgid "Iyar" 5014 msgctxt "Hebrew month 8 - KLocale::LongName" 5015 msgid "Iyar" 5016 msgstr "इयार" 5017 5018 #: kdecore/kcalendarsystemhebrew.cpp:781 5019 #, fuzzy, kde-format 5020 #| msgid "Sivan" 5021 msgctxt "Hebrew month 9 - KLocale::LongName" 5022 msgid "Sivan" 5023 msgstr "सिवान" 5024 5025 #: kdecore/kcalendarsystemhebrew.cpp:783 5026 #, fuzzy, kde-format 5027 #| msgid "Tamuz" 5028 msgctxt "Hebrew month 10 - KLocale::LongName" 5029 msgid "Tamuz" 5030 msgstr "तामुज" 5031 5032 #: kdecore/kcalendarsystemhebrew.cpp:785 5033 #, fuzzy, kde-format 5034 #| msgid "Av" 5035 msgctxt "Hebrew month 11 - KLocale::LongName" 5036 msgid "Av" 5037 msgstr "एव" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:787 5040 #, fuzzy, kde-format 5041 #| msgid "Elul" 5042 msgctxt "Hebrew month 12 - KLocale::LongName" 5043 msgid "Elul" 5044 msgstr "एलुल" 5045 5046 #: kdecore/kcalendarsystemhebrew.cpp:789 5047 #, fuzzy, kde-format 5048 #| msgid "Adar I" 5049 msgctxt "Hebrew month 13 - KLocale::LongName" 5050 msgid "Adar I" 5051 msgstr "अदर I" 5052 5053 #: kdecore/kcalendarsystemhebrew.cpp:791 5054 #, fuzzy, kde-format 5055 #| msgid "Adar II" 5056 msgctxt "Hebrew month 14 - KLocale::LongName" 5057 msgid "Adar II" 5058 msgstr "अदर II" 5059 5060 #: kdecore/kcalendarsystemindiannational.cpp:66 5061 #, fuzzy, kde-format 5062 #| msgid "Safar" 5063 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5064 msgid "Saka Era" 5065 msgstr "सफर" 5066 5067 #: kdecore/kcalendarsystemindiannational.cpp:67 5068 #, kde-format 5069 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5070 msgid "SE" 5071 msgstr "" 5072 5073 #: kdecore/kcalendarsystemindiannational.cpp:68 5074 #, kde-format 5075 msgctxt "" 5076 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5077 "2000 SE" 5078 msgid "%Ey %EC" 5079 msgstr "" 5080 5081 #: kdecore/kcalendarsystemindiannational.cpp:158 5082 #, kde-format 5083 msgctxt "Indian National month 1 - KLocale::NarrowName" 5084 msgid "C" 5085 msgstr "" 5086 5087 #: kdecore/kcalendarsystemindiannational.cpp:160 5088 #, kde-format 5089 msgctxt "Indian National month 2 - KLocale::NarrowName" 5090 msgid "V" 5091 msgstr "" 5092 5093 #: kdecore/kcalendarsystemindiannational.cpp:162 5094 #, kde-format 5095 msgctxt "Indian National month 3 - KLocale::NarrowName" 5096 msgid "J" 5097 msgstr "" 5098 5099 #: kdecore/kcalendarsystemindiannational.cpp:164 5100 #, fuzzy, kde-format 5101 msgctxt "Indian National month 4 - KLocale::NarrowName" 5102 msgid "Ā" 5103 msgstr "खोर क' " 5104 5105 #: kdecore/kcalendarsystemindiannational.cpp:166 5106 #, kde-format 5107 msgctxt "Indian National month 5 - KLocale::NarrowName" 5108 msgid "S" 5109 msgstr "" 5110 5111 #: kdecore/kcalendarsystemindiannational.cpp:168 5112 #, kde-format 5113 msgctxt "Indian National month 6 - KLocale::NarrowName" 5114 msgid "B" 5115 msgstr "" 5116 5117 #: kdecore/kcalendarsystemindiannational.cpp:170 5118 #, fuzzy, kde-format 5119 msgctxt "Indian National month 7 - KLocale::NarrowName" 5120 msgid "Ā" 5121 msgstr "खोर क' " 5122 5123 #: kdecore/kcalendarsystemindiannational.cpp:172 5124 #, kde-format 5125 msgctxt "Indian National month 8 - KLocale::NarrowName" 5126 msgid "K" 5127 msgstr "" 5128 5129 #: kdecore/kcalendarsystemindiannational.cpp:174 5130 #, fuzzy, kde-format 5131 #| msgid "Av" 5132 msgctxt "Indian National month 9 - KLocale::NarrowName" 5133 msgid "A" 5134 msgstr "एव" 5135 5136 #: kdecore/kcalendarsystemindiannational.cpp:176 5137 #, kde-format 5138 msgctxt "Indian National month 10 - KLocale::NarrowName" 5139 msgid "P" 5140 msgstr "" 5141 5142 #: kdecore/kcalendarsystemindiannational.cpp:178 5143 #, kde-format 5144 msgctxt "Indian National month 11 - KLocale::NarrowName" 5145 msgid "M" 5146 msgstr "" 5147 5148 #: kdecore/kcalendarsystemindiannational.cpp:180 5149 #, kde-format 5150 msgctxt "Indian National month 12 - KLocale::NarrowName" 5151 msgid "P" 5152 msgstr "" 5153 5154 #: kdecore/kcalendarsystemindiannational.cpp:189 5155 #, fuzzy, kde-format 5156 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5157 msgid "of Cha" 5158 msgstr "शाह क' " 5159 5160 #: kdecore/kcalendarsystemindiannational.cpp:191 5161 #, fuzzy, kde-format 5162 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5163 msgid "of Vai" 5164 msgstr "फर क' " 5165 5166 #: kdecore/kcalendarsystemindiannational.cpp:193 5167 #, fuzzy, kde-format 5168 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5169 msgid "of Jya" 5170 msgstr "जनवरी क' " 5171 5172 #: kdecore/kcalendarsystemindiannational.cpp:195 5173 #, fuzzy, kde-format 5174 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5175 msgid "of Āsh" 5176 msgstr "खोर क' " 5177 5178 #: kdecore/kcalendarsystemindiannational.cpp:197 5179 #, fuzzy, kde-format 5180 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5181 msgid "of Shr" 5182 msgstr "शाह क' " 5183 5184 #: kdecore/kcalendarsystemindiannational.cpp:199 5185 #, fuzzy, kde-format 5186 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5187 msgid "of Bhā" 5188 msgstr "बाह क' " 5189 5190 #: kdecore/kcalendarsystemindiannational.cpp:201 5191 #, fuzzy, kde-format 5192 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5193 msgid "of Āsw" 5194 msgstr "एसफ क' " 5195 5196 #: kdecore/kcalendarsystemindiannational.cpp:203 5197 #, fuzzy, kde-format 5198 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5199 msgid "of Kār" 5200 msgstr "फर क' " 5201 5202 #: kdecore/kcalendarsystemindiannational.cpp:205 5203 #, fuzzy, kde-format 5204 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5205 msgid "of Agr" 5206 msgstr "अप्रैल क' " 5207 5208 #: kdecore/kcalendarsystemindiannational.cpp:207 5209 #, fuzzy, kde-format 5210 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5211 msgid "of Pau" 5212 msgstr "तमुज क' " 5213 5214 #: kdecore/kcalendarsystemindiannational.cpp:209 5215 #, fuzzy, kde-format 5216 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5217 msgid "of Māg" 5218 msgstr "मोर क' " 5219 5220 #: kdecore/kcalendarsystemindiannational.cpp:211 5221 #, fuzzy, kde-format 5222 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5223 msgid "of Phā" 5224 msgstr "खोर क' " 5225 5226 #: kdecore/kcalendarsystemindiannational.cpp:220 5227 #, fuzzy, kde-format 5228 msgctxt "Indian National month 1 - KLocale::ShortName" 5229 msgid "Cha" 5230 msgstr "गुरु" 5231 5232 #: kdecore/kcalendarsystemindiannational.cpp:222 5233 #, fuzzy, kde-format 5234 msgctxt "Indian National month 2 - KLocale::ShortName" 5235 msgid "Vai" 5236 msgstr "फर क' " 5237 5238 #: kdecore/kcalendarsystemindiannational.cpp:224 5239 #, fuzzy, kde-format 5240 msgctxt "Indian National month 3 - KLocale::ShortName" 5241 msgid "Jya" 5242 msgstr "जनवरी" 5243 5244 #: kdecore/kcalendarsystemindiannational.cpp:226 5245 #, fuzzy, kde-format 5246 msgctxt "Indian National month 4 - KLocale::ShortName" 5247 msgid "Āsh" 5248 msgstr "खोर क' " 5249 5250 #: kdecore/kcalendarsystemindiannational.cpp:228 5251 #, fuzzy, kde-format 5252 msgctxt "Indian National month 5 - KLocale::ShortName" 5253 msgid "Shr" 5254 msgstr "शा" 5255 5256 #: kdecore/kcalendarsystemindiannational.cpp:230 5257 #, fuzzy, kde-format 5258 msgctxt "Indian National month 6 - KLocale::ShortName" 5259 msgid "Bhā" 5260 msgstr "बाह क' " 5261 5262 #: kdecore/kcalendarsystemindiannational.cpp:232 5263 #, fuzzy, kde-format 5264 msgctxt "Indian National month 7 - KLocale::ShortName" 5265 msgid "Āsw" 5266 msgstr "एसफ क' " 5267 5268 #: kdecore/kcalendarsystemindiannational.cpp:234 5269 #, fuzzy, kde-format 5270 msgctxt "Indian National month 8 - KLocale::ShortName" 5271 msgid "Kār" 5272 msgstr "फर क' " 5273 5274 #: kdecore/kcalendarsystemindiannational.cpp:236 5275 #, fuzzy, kde-format 5276 msgctxt "Indian National month 9 - KLocale::ShortName" 5277 msgid "Agr" 5278 msgstr "बुध" 5279 5280 #: kdecore/kcalendarsystemindiannational.cpp:238 5281 #, fuzzy, kde-format 5282 msgctxt "Indian National month 10 - KLocale::ShortName" 5283 msgid "Pau" 5284 msgstr "ठहरू" 5285 5286 #: kdecore/kcalendarsystemindiannational.cpp:240 5287 #, fuzzy, kde-format 5288 msgctxt "Indian National month 11 - KLocale::ShortName" 5289 msgid "Māg" 5290 msgstr "मोर क' " 5291 5292 #: kdecore/kcalendarsystemindiannational.cpp:242 5293 #, fuzzy, kde-format 5294 msgctxt "Indian National month 12 - KLocale::ShortName" 5295 msgid "Phā" 5296 msgstr "खोर क' " 5297 5298 #: kdecore/kcalendarsystemindiannational.cpp:251 5299 #, fuzzy, kde-format 5300 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5301 msgid "of Chaitra" 5302 msgstr "मोहर्रम क" 5303 5304 #: kdecore/kcalendarsystemindiannational.cpp:253 5305 #, fuzzy, kde-format 5306 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5307 msgid "of Vaishākh" 5308 msgstr "फर क' " 5309 5310 #: kdecore/kcalendarsystemindiannational.cpp:255 5311 #, fuzzy, kde-format 5312 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5313 msgid "of Jyaishtha" 5314 msgstr "निसान क' " 5315 5316 #: kdecore/kcalendarsystemindiannational.cpp:257 5317 #, fuzzy, kde-format 5318 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5319 msgid "of Āshādha" 5320 msgstr "खोर क' " 5321 5322 #: kdecore/kcalendarsystemindiannational.cpp:259 5323 #, fuzzy, kde-format 5324 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5325 msgid "of Shrāvana" 5326 msgstr "शवत क' " 5327 5328 #: kdecore/kcalendarsystemindiannational.cpp:261 5329 #, fuzzy, kde-format 5330 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5331 msgid "of Bhādrapad" 5332 msgstr "खोरदाद क' " 5333 5334 #: kdecore/kcalendarsystemindiannational.cpp:263 5335 #, fuzzy, kde-format 5336 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5337 msgid "of Āshwin" 5338 msgstr "हेशवान क' " 5339 5340 #: kdecore/kcalendarsystemindiannational.cpp:265 5341 #, fuzzy, kde-format 5342 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5343 msgid "of Kārtik" 5344 msgstr "फर क' " 5345 5346 #: kdecore/kcalendarsystemindiannational.cpp:267 5347 #, fuzzy, kde-format 5348 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5349 msgid "of Agrahayana" 5350 msgstr "बहमान क' " 5351 5352 #: kdecore/kcalendarsystemindiannational.cpp:269 5353 #, fuzzy, kde-format 5354 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5355 msgid "of Paush" 5356 msgstr "बाह क' " 5357 5358 #: kdecore/kcalendarsystemindiannational.cpp:271 5359 #, fuzzy, kde-format 5360 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5361 msgid "of Māgh" 5362 msgstr "मेह क' " 5363 5364 #: kdecore/kcalendarsystemindiannational.cpp:273 5365 #, fuzzy, kde-format 5366 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5367 msgid "of Phālgun" 5368 msgstr "खोर क' " 5369 5370 #: kdecore/kcalendarsystemindiannational.cpp:282 5371 #, fuzzy, kde-format 5372 msgctxt "Indian National month 1 - KLocale::LongName" 5373 msgid "Chaitra" 5374 msgstr "मोहर्रम क" 5375 5376 #: kdecore/kcalendarsystemindiannational.cpp:284 5377 #, fuzzy, kde-format 5378 msgctxt "Indian National month 2 - KLocale::LongName" 5379 msgid "Vaishākh" 5380 msgstr "फर क' " 5381 5382 #: kdecore/kcalendarsystemindiannational.cpp:286 5383 #, fuzzy, kde-format 5384 msgctxt "Indian National month 3 - KLocale::LongName" 5385 msgid "Jyaishtha" 5386 msgstr "निसान क' " 5387 5388 #: kdecore/kcalendarsystemindiannational.cpp:288 5389 #, fuzzy, kde-format 5390 msgctxt "Indian National month 4 - KLocale::LongName" 5391 msgid "Āshādha" 5392 msgstr "खोर क' " 5393 5394 #: kdecore/kcalendarsystemindiannational.cpp:290 5395 #, fuzzy, kde-format 5396 msgctxt "Indian National month 5 - KLocale::LongName" 5397 msgid "Shrāvana" 5398 msgstr "शवत क' " 5399 5400 #: kdecore/kcalendarsystemindiannational.cpp:292 5401 #, fuzzy, kde-format 5402 msgctxt "Indian National month 6 - KLocale::LongName" 5403 msgid "Bhādrapad" 5404 msgstr "खोरदाद क' " 5405 5406 #: kdecore/kcalendarsystemindiannational.cpp:294 5407 #, fuzzy, kde-format 5408 msgctxt "Indian National month 7 - KLocale::LongName" 5409 msgid "Āshwin" 5410 msgstr "हेशवान क' " 5411 5412 #: kdecore/kcalendarsystemindiannational.cpp:296 5413 #, fuzzy, kde-format 5414 msgctxt "Indian National month 8 - KLocale::LongName" 5415 msgid "Kārtik" 5416 msgstr "फर क' " 5417 5418 #: kdecore/kcalendarsystemindiannational.cpp:298 5419 #, fuzzy, kde-format 5420 msgctxt "Indian National month 9 - KLocale::LongName" 5421 msgid "Agrahayana" 5422 msgstr "थाना" 5423 5424 #: kdecore/kcalendarsystemindiannational.cpp:300 5425 #, fuzzy, kde-format 5426 msgctxt "Indian National month 10 - KLocale::LongName" 5427 msgid "Paush" 5428 msgstr "ठहरू" 5429 5430 #: kdecore/kcalendarsystemindiannational.cpp:302 5431 #, fuzzy, kde-format 5432 msgctxt "Indian National month 11 - KLocale::LongName" 5433 msgid "Māgh" 5434 msgstr "मेह क' " 5435 5436 #: kdecore/kcalendarsystemindiannational.cpp:304 5437 #, fuzzy, kde-format 5438 msgctxt "Indian National month 12 - KLocale::LongName" 5439 msgid "Phālgun" 5440 msgstr "खोर क' " 5441 5442 #: kdecore/kcalendarsystemindiannational.cpp:317 5443 #, kde-format 5444 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5445 msgid "S" 5446 msgstr "" 5447 5448 #: kdecore/kcalendarsystemindiannational.cpp:319 5449 #, kde-format 5450 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5451 msgid "M" 5452 msgstr "" 5453 5454 #: kdecore/kcalendarsystemindiannational.cpp:321 5455 #, kde-format 5456 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5457 msgid "B" 5458 msgstr "" 5459 5460 #: kdecore/kcalendarsystemindiannational.cpp:323 5461 #, kde-format 5462 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5463 msgid "G" 5464 msgstr "" 5465 5466 #: kdecore/kcalendarsystemindiannational.cpp:325 5467 #, kde-format 5468 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5469 msgid "S" 5470 msgstr "" 5471 5472 #: kdecore/kcalendarsystemindiannational.cpp:327 5473 #, kde-format 5474 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5475 msgid "S" 5476 msgstr "" 5477 5478 #: kdecore/kcalendarsystemindiannational.cpp:329 5479 #, kde-format 5480 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5481 msgid "R" 5482 msgstr "" 5483 5484 #: kdecore/kcalendarsystemindiannational.cpp:338 5485 #, fuzzy, kde-format 5486 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5487 msgid "Som" 5488 msgstr "Jom" 5489 5490 #: kdecore/kcalendarsystemindiannational.cpp:340 5491 #, kde-format 5492 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5493 msgid "Mañ" 5494 msgstr "" 5495 5496 #: kdecore/kcalendarsystemindiannational.cpp:342 5497 #, fuzzy, kde-format 5498 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5499 msgid "Bud" 5500 msgstr "बुहीद" 5501 5502 #: kdecore/kcalendarsystemindiannational.cpp:344 5503 #, kde-format 5504 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5505 msgid "Gur" 5506 msgstr "" 5507 5508 #: kdecore/kcalendarsystemindiannational.cpp:346 5509 #, fuzzy, kde-format 5510 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5511 msgid "Suk" 5512 msgstr "सूर्य" 5513 5514 #: kdecore/kcalendarsystemindiannational.cpp:348 5515 #, fuzzy, kde-format 5516 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5517 msgid "San" 5518 msgstr "सिवान" 5519 5520 #: kdecore/kcalendarsystemindiannational.cpp:350 5521 #, kde-format 5522 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5523 msgid "Rav" 5524 msgstr "" 5525 5526 #: kdecore/kcalendarsystemindiannational.cpp:357 5527 #, kde-format 5528 msgctxt "Indian National weekday 1 - KLocale::LongName" 5529 msgid "Somavãra" 5530 msgstr "" 5531 5532 #: kdecore/kcalendarsystemindiannational.cpp:359 5533 #, kde-format 5534 msgctxt "Indian National weekday 2 - KLocale::LongName" 5535 msgid "Mañgalvã" 5536 msgstr "" 5537 5538 #: kdecore/kcalendarsystemindiannational.cpp:361 5539 #, kde-format 5540 msgctxt "Indian National weekday 3 - KLocale::LongName" 5541 msgid "Budhavãra" 5542 msgstr "" 5543 5544 #: kdecore/kcalendarsystemindiannational.cpp:363 5545 #, kde-format 5546 msgctxt "Indian National weekday 4 - KLocale::LongName" 5547 msgid "Guruvãra" 5548 msgstr "" 5549 5550 #: kdecore/kcalendarsystemindiannational.cpp:365 5551 #, kde-format 5552 msgctxt "Indian National weekday 5 - KLocale::LongName" 5553 msgid "Sukravãra" 5554 msgstr "" 5555 5556 #: kdecore/kcalendarsystemindiannational.cpp:367 5557 #, kde-format 5558 msgctxt "Indian National weekday 6 - KLocale::LongName" 5559 msgid "Sanivãra" 5560 msgstr "" 5561 5562 #: kdecore/kcalendarsystemindiannational.cpp:369 5563 #, kde-format 5564 msgctxt "Indian National weekday 7 - KLocale::LongName" 5565 msgid "Raviãra" 5566 msgstr "" 5567 5568 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5569 #, kde-format 5570 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5571 msgid "Anno Hegirae" 5572 msgstr "" 5573 5574 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5575 #, kde-format 5576 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5577 msgid "AH" 5578 msgstr "" 5579 5580 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5581 #, kde-format 5582 msgctxt "" 5583 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5584 msgid "%Ey %EC" 5585 msgstr "" 5586 5587 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5588 #, kde-format 5589 msgctxt "Hijri month 1 - KLocale::NarrowName" 5590 msgid "M" 5591 msgstr "" 5592 5593 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5594 #, kde-format 5595 msgctxt "Hijri month 2 - KLocale::NarrowName" 5596 msgid "S" 5597 msgstr "" 5598 5599 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5600 #, fuzzy, kde-format 5601 #| msgid "Av" 5602 msgctxt "Hijri month 3 - KLocale::NarrowName" 5603 msgid "A" 5604 msgstr "एव" 5605 5606 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5607 #, kde-format 5608 msgctxt "Hijri month 4 - KLocale::NarrowName" 5609 msgid "T" 5610 msgstr "" 5611 5612 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5613 #, fuzzy, kde-format 5614 #| msgid "Av" 5615 msgctxt "Hijri month 5 - KLocale::NarrowName" 5616 msgid "A" 5617 msgstr "एव" 5618 5619 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5620 #, kde-format 5621 msgctxt "Hijri month 6 - KLocale::NarrowName" 5622 msgid "T" 5623 msgstr "" 5624 5625 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5626 #, kde-format 5627 msgctxt "Hijri month 7 - KLocale::NarrowName" 5628 msgid "R" 5629 msgstr "" 5630 5631 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5632 #, kde-format 5633 msgctxt "Hijri month 8 - KLocale::NarrowName" 5634 msgid "S" 5635 msgstr "" 5636 5637 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5638 #, kde-format 5639 msgctxt "Hijri month 9 - KLocale::NarrowName" 5640 msgid "R" 5641 msgstr "" 5642 5643 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5644 #, kde-format 5645 msgctxt "Hijri month 10 - KLocale::NarrowName" 5646 msgid "S" 5647 msgstr "" 5648 5649 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5650 #, kde-format 5651 msgctxt "Hijri month 11 - KLocale::NarrowName" 5652 msgid "Q" 5653 msgstr "" 5654 5655 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5656 #, kde-format 5657 msgctxt "Hijri month 12 - KLocale::NarrowName" 5658 msgid "H" 5659 msgstr "" 5660 5661 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5662 #, fuzzy, kde-format 5663 #| msgctxt "of Mehr short" 5664 #| msgid "of Meh" 5665 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5666 msgid "of Muh" 5667 msgstr "मेह क' " 5668 5669 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5670 #, fuzzy, kde-format 5671 #| msgid "of Safar" 5672 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5673 msgid "of Saf" 5674 msgstr "सफर क' " 5675 5676 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5677 #, fuzzy, kde-format 5678 #| msgid "of R. Awal" 5679 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5680 msgid "of R.A" 5681 msgstr "र. अव्वल क' " 5682 5683 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5684 #, fuzzy, kde-format 5685 #| msgid "of R. Thaani" 5686 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5687 msgid "of R.T" 5688 msgstr "र. उस्सानी क' " 5689 5690 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5691 #, fuzzy, kde-format 5692 #| msgid "of J. Awal" 5693 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5694 msgid "of J.A" 5695 msgstr "ज. अव्वल क' " 5696 5697 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5698 #, fuzzy, kde-format 5699 #| msgid "of J. Thaani" 5700 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5701 msgid "of J.T" 5702 msgstr "ज. उस्सानी क' " 5703 5704 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5705 #, fuzzy, kde-format 5706 #| msgid "of Rajab" 5707 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5708 msgid "of Raj" 5709 msgstr "रज्जब क' " 5710 5711 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5712 #, fuzzy, kde-format 5713 #| msgctxt "of Shahrivar short" 5714 #| msgid "of Sha" 5715 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5716 msgid "of Sha" 5717 msgstr "शाह क' " 5718 5719 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5720 #, fuzzy, kde-format 5721 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5722 msgid "of Ram" 5723 msgstr "तमुज क' " 5724 5725 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5726 #, fuzzy, kde-format 5727 #| msgctxt "of Shahrivar short" 5728 #| msgid "of Sha" 5729 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5730 msgid "of Shw" 5731 msgstr "शाह क' " 5732 5733 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5734 #, fuzzy, kde-format 5735 #| msgid "of Qi`dah" 5736 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5737 msgid "of Qid" 5738 msgstr "जिल्काद क' " 5739 5740 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5741 #, fuzzy, kde-format 5742 #| msgid "of Hijjah" 5743 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5744 msgid "of Hij" 5745 msgstr "जिल्हज क' " 5746 5747 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5748 #, fuzzy, kde-format 5749 #| msgctxt "Mehr short" 5750 #| msgid "Meh" 5751 msgctxt "Hijri month 1 - KLocale::ShortName" 5752 msgid "Muh" 5753 msgstr "मेह" 5754 5755 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5756 #, fuzzy, kde-format 5757 #| msgid "Safar" 5758 msgctxt "Hijri month 2 - KLocale::ShortName" 5759 msgid "Saf" 5760 msgstr "सफर" 5761 5762 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5763 #, fuzzy, kde-format 5764 #| msgid "R. Awal" 5765 msgctxt "Hijri month 3 - KLocale::ShortName" 5766 msgid "R.A" 5767 msgstr "र. अव्वल" 5768 5769 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5770 #, kde-format 5771 msgctxt "Hijri month 4 - KLocale::ShortName" 5772 msgid "R.T" 5773 msgstr "" 5774 5775 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5776 #, fuzzy, kde-format 5777 #| msgid "J. Awal" 5778 msgctxt "Hijri month 5 - KLocale::ShortName" 5779 msgid "J.A" 5780 msgstr "ज. अव्वल" 5781 5782 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5783 #, kde-format 5784 msgctxt "Hijri month 6 - KLocale::ShortName" 5785 msgid "J.T" 5786 msgstr "" 5787 5788 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5789 #, fuzzy, kde-format 5790 #| msgid "Rajab" 5791 msgctxt "Hijri month 7 - KLocale::ShortName" 5792 msgid "Raj" 5793 msgstr "रज्जब" 5794 5795 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5796 #, fuzzy, kde-format 5797 #| msgctxt "Shahrivar short" 5798 #| msgid "Sha" 5799 msgctxt "Hijri month 8 - KLocale::ShortName" 5800 msgid "Sha" 5801 msgstr "शा" 5802 5803 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5804 #, fuzzy, kde-format 5805 msgctxt "Hijri month 9 - KLocale::ShortName" 5806 msgid "Ram" 5807 msgstr "पूर्वाह्न" 5808 5809 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5810 #, fuzzy, kde-format 5811 #| msgctxt "Shahrivar short" 5812 #| msgid "Sha" 5813 msgctxt "Hijri month 10 - KLocale::ShortName" 5814 msgid "Shw" 5815 msgstr "शा" 5816 5817 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5818 #, fuzzy, kde-format 5819 #| msgid "Qi`dah" 5820 msgctxt "Hijri month 11 - KLocale::ShortName" 5821 msgid "Qid" 5822 msgstr "जिल्काद" 5823 5824 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5825 #, fuzzy, kde-format 5826 #| msgctxt "@item Calendar system" 5827 #| msgid "Hijri" 5828 msgctxt "Hijri month 12 - KLocale::ShortName" 5829 msgid "Hij" 5830 msgstr "हिजरी" 5831 5832 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5833 #, fuzzy, kde-format 5834 #| msgid "of Muharram" 5835 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5836 msgid "of Muharram" 5837 msgstr "मोहर्रम क" 5838 5839 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5840 #, fuzzy, kde-format 5841 #| msgid "of Safar" 5842 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5843 msgid "of Safar" 5844 msgstr "सफर क' " 5845 5846 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5847 #, fuzzy, kde-format 5848 #| msgid "of Rabi` al-Awal" 5849 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5850 msgid "of Rabi` al-Awal" 5851 msgstr "रबी उल-अव्वल क' " 5852 5853 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5854 #, fuzzy, kde-format 5855 #| msgid "of Rabi` al-Thaani" 5856 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5857 msgid "of Rabi` al-Thaani" 5858 msgstr "रबी उस्सानी क' " 5859 5860 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5861 #, fuzzy, kde-format 5862 #| msgid "of Jumaada al-Awal" 5863 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5864 msgid "of Jumaada al-Awal" 5865 msgstr "जमादिल अव्वल क' " 5866 5867 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5868 #, fuzzy, kde-format 5869 #| msgid "of Jumaada al-Thaani" 5870 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5871 msgid "of Jumaada al-Thaani" 5872 msgstr "जमादिल उस्सानी क' " 5873 5874 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5875 #, fuzzy, kde-format 5876 #| msgid "of Rajab" 5877 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5878 msgid "of Rajab" 5879 msgstr "रज्जब क' " 5880 5881 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5882 #, fuzzy, kde-format 5883 #| msgid "of Sha`ban" 5884 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5885 msgid "of Sha`ban" 5886 msgstr "शाबान क' " 5887 5888 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5889 #, fuzzy, kde-format 5890 #| msgid "of Ramadan" 5891 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5892 msgid "of Ramadan" 5893 msgstr "रमादान क' " 5894 5895 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5896 #, fuzzy, kde-format 5897 #| msgid "of Shawwal" 5898 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5899 msgid "of Shawwal" 5900 msgstr "शब्बाल क' " 5901 5902 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5903 #, fuzzy, kde-format 5904 #| msgid "of Thu al-Qi`dah" 5905 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5906 msgid "of Thu al-Qi`dah" 5907 msgstr "तू जिल्काद क' " 5908 5909 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5910 #, fuzzy, kde-format 5911 #| msgid "of Thu al-Hijjah" 5912 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5913 msgid "of Thu al-Hijjah" 5914 msgstr "तू जिल्हज क' " 5915 5916 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5917 #, fuzzy, kde-format 5918 #| msgid "Muharram" 5919 msgctxt "Hijri month 1 - KLocale::LongName" 5920 msgid "Muharram" 5921 msgstr "मोहर्रम" 5922 5923 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5924 #, fuzzy, kde-format 5925 #| msgid "Safar" 5926 msgctxt "Hijri month 2 - KLocale::LongName" 5927 msgid "Safar" 5928 msgstr "सफर" 5929 5930 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5931 #, fuzzy, kde-format 5932 #| msgid "Rabi` al-Awal" 5933 msgctxt "Hijri month 3 - KLocale::LongName" 5934 msgid "Rabi` al-Awal" 5935 msgstr "रबि उल-अव्वल" 5936 5937 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5938 #, fuzzy, kde-format 5939 #| msgid "Rabi` al-Thaani" 5940 msgctxt "Hijri month 4 - KLocale::LongName" 5941 msgid "Rabi` al-Thaani" 5942 msgstr "रबि उस्सानी" 5943 5944 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5945 #, fuzzy, kde-format 5946 #| msgid "Jumaada al-Awal" 5947 msgctxt "Hijri month 5 - KLocale::LongName" 5948 msgid "Jumaada al-Awal" 5949 msgstr "जमादिल अव्वल" 5950 5951 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5952 #, fuzzy, kde-format 5953 #| msgid "Jumaada al-Thaani" 5954 msgctxt "Hijri month 6 - KLocale::LongName" 5955 msgid "Jumaada al-Thaani" 5956 msgstr "जमादिल उस्सानी" 5957 5958 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5959 #, fuzzy, kde-format 5960 #| msgid "Rajab" 5961 msgctxt "Hijri month 7 - KLocale::LongName" 5962 msgid "Rajab" 5963 msgstr "रज्जब" 5964 5965 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5966 #, fuzzy, kde-format 5967 #| msgid "Sha`ban" 5968 msgctxt "Hijri month 8 - KLocale::LongName" 5969 msgid "Sha`ban" 5970 msgstr "शाबान" 5971 5972 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5973 #, fuzzy, kde-format 5974 #| msgid "Ramadan" 5975 msgctxt "Hijri month 9 - KLocale::LongName" 5976 msgid "Ramadan" 5977 msgstr "रमज़ान" 5978 5979 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5980 #, fuzzy, kde-format 5981 #| msgid "Shawwal" 5982 msgctxt "Hijri month 10 - KLocale::LongName" 5983 msgid "Shawwal" 5984 msgstr "शब्बाल" 5985 5986 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5987 #, fuzzy, kde-format 5988 #| msgid "Thu al-Qi`dah" 5989 msgctxt "Hijri month 11 - KLocale::LongName" 5990 msgid "Thu al-Qi`dah" 5991 msgstr "तू जिल्काद" 5992 5993 #: kdecore/kcalendarsystemislamiccivil.cpp:312 5994 #, fuzzy, kde-format 5995 #| msgid "Thu al-Hijjah" 5996 msgctxt "Hijri month 12 - KLocale::LongName" 5997 msgid "Thu al-Hijjah" 5998 msgstr "तू जिल्हज" 5999 6000 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6001 #, kde-format 6002 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6003 msgid "I" 6004 msgstr "" 6005 6006 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6007 #, kde-format 6008 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6009 msgid "T" 6010 msgstr "" 6011 6012 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6013 #, fuzzy, kde-format 6014 #| msgid "Av" 6015 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6016 msgid "A" 6017 msgstr "एव" 6018 6019 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6020 #, kde-format 6021 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6022 msgid "K" 6023 msgstr "" 6024 6025 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6026 #, kde-format 6027 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6028 msgid "J" 6029 msgstr "" 6030 6031 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6032 #, kde-format 6033 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6034 msgid "S" 6035 msgstr "" 6036 6037 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6038 #, fuzzy, kde-format 6039 #| msgid "Av" 6040 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6041 msgid "A" 6042 msgstr "एव" 6043 6044 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6045 #, fuzzy, kde-format 6046 #| msgid "Ith" 6047 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6048 msgid "Ith" 6049 msgstr "सोम" 6050 6051 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6052 #, fuzzy, kde-format 6053 #| msgid "Thl" 6054 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6055 msgid "Thl" 6056 msgstr "मंगल" 6057 6058 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6059 #, fuzzy, kde-format 6060 #| msgid "Arb" 6061 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6062 msgid "Arb" 6063 msgstr "बुध" 6064 6065 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6066 #, fuzzy, kde-format 6067 #| msgid "Kha" 6068 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6069 msgid "Kha" 6070 msgstr "गुरु" 6071 6072 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6073 #, fuzzy, kde-format 6074 #| msgid "Jum" 6075 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6076 msgid "Jum" 6077 msgstr "शुक्र" 6078 6079 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6080 #, fuzzy, kde-format 6081 #| msgid "Sab" 6082 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6083 msgid "Sab" 6084 msgstr "शनि" 6085 6086 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6087 #, fuzzy, kde-format 6088 #| msgid "Ahd" 6089 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6090 msgid "Ahd" 6091 msgstr "रवि" 6092 6093 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6094 #, fuzzy, kde-format 6095 #| msgid "Yaum al-Ithnain" 6096 msgctxt "Hijri weekday 1 - KLocale::LongName" 6097 msgid "Yaum al-Ithnain" 6098 msgstr "यम अल-इथन" 6099 6100 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6101 #, fuzzy, kde-format 6102 #| msgid "Yau al-Thulatha" 6103 msgctxt "Hijri weekday 2 - KLocale::LongName" 6104 msgid "Yau al-Thulatha" 6105 msgstr "या अल-दलथ" 6106 6107 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6108 #, fuzzy, kde-format 6109 #| msgid "Yaum al-Arbi'a" 6110 msgctxt "Hijri weekday 3 - KLocale::LongName" 6111 msgid "Yaum al-Arbi'a" 6112 msgstr "यम अल-अरबिया" 6113 6114 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6115 #, fuzzy, kde-format 6116 #| msgid "Yaum al-Khamees" 6117 msgctxt "Hijri weekday 4 - KLocale::LongName" 6118 msgid "Yaum al-Khamees" 6119 msgstr "यम अल-खमीज़" 6120 6121 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6122 #, fuzzy, kde-format 6123 #| msgid "Yaum al-Jumma" 6124 msgctxt "Hijri weekday 5 - KLocale::LongName" 6125 msgid "Yaum al-Jumma" 6126 msgstr "यम अल-जुमा" 6127 6128 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6129 #, fuzzy, kde-format 6130 #| msgid "Yaum al-Sabt" 6131 msgctxt "Hijri weekday 6 - KLocale::LongName" 6132 msgid "Yaum al-Sabt" 6133 msgstr "यम अल-सब्त" 6134 6135 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6136 #, fuzzy, kde-format 6137 #| msgid "Yaum al-Ahad" 6138 msgctxt "Hijri weekday 7 - KLocale::LongName" 6139 msgid "Yaum al-Ahad" 6140 msgstr "यम अल-अहद" 6141 6142 #: kdecore/kcalendarsystemjalali.cpp:74 6143 #, kde-format 6144 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6145 msgid "Anno Persico" 6146 msgstr "" 6147 6148 #: kdecore/kcalendarsystemjalali.cpp:75 6149 #, kde-format 6150 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6151 msgid "AP" 6152 msgstr "" 6153 6154 #: kdecore/kcalendarsystemjalali.cpp:76 6155 #, kde-format 6156 msgctxt "" 6157 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6158 msgid "%Ey %EC" 6159 msgstr "" 6160 6161 #: kdecore/kcalendarsystemjalali.cpp:172 6162 #, kde-format 6163 msgctxt "Jalali month 1 - KLocale::NarrowName" 6164 msgid "F" 6165 msgstr "" 6166 6167 #: kdecore/kcalendarsystemjalali.cpp:174 6168 #, kde-format 6169 msgctxt "Jalali month 2 - KLocale::NarrowName" 6170 msgid "O" 6171 msgstr "" 6172 6173 #: kdecore/kcalendarsystemjalali.cpp:176 6174 #, kde-format 6175 msgctxt "Jalali month 3 - KLocale::NarrowName" 6176 msgid "K" 6177 msgstr "" 6178 6179 #: kdecore/kcalendarsystemjalali.cpp:178 6180 #, kde-format 6181 msgctxt "Jalali month 4 - KLocale::NarrowName" 6182 msgid "T" 6183 msgstr "" 6184 6185 #: kdecore/kcalendarsystemjalali.cpp:180 6186 #, kde-format 6187 msgctxt "Jalali month 5 - KLocale::NarrowName" 6188 msgid "M" 6189 msgstr "" 6190 6191 #: kdecore/kcalendarsystemjalali.cpp:182 6192 #, kde-format 6193 msgctxt "Jalali month 6 - KLocale::NarrowName" 6194 msgid "S" 6195 msgstr "" 6196 6197 #: kdecore/kcalendarsystemjalali.cpp:184 6198 #, kde-format 6199 msgctxt "Jalali month 7 - KLocale::NarrowName" 6200 msgid "M" 6201 msgstr "" 6202 6203 #: kdecore/kcalendarsystemjalali.cpp:186 6204 #, fuzzy, kde-format 6205 #| msgid "Av" 6206 msgctxt "Jalali month 8 - KLocale::NarrowName" 6207 msgid "A" 6208 msgstr "एव" 6209 6210 #: kdecore/kcalendarsystemjalali.cpp:188 6211 #, fuzzy, kde-format 6212 #| msgid "Av" 6213 msgctxt "Jalali month 9 - KLocale::NarrowName" 6214 msgid "A" 6215 msgstr "एव" 6216 6217 #: kdecore/kcalendarsystemjalali.cpp:190 6218 #, kde-format 6219 msgctxt "Jalali month 10 - KLocale::NarrowName" 6220 msgid "D" 6221 msgstr "" 6222 6223 #: kdecore/kcalendarsystemjalali.cpp:192 6224 #, kde-format 6225 msgctxt "Jalali month 11 - KLocale::NarrowName" 6226 msgid "B" 6227 msgstr "" 6228 6229 #: kdecore/kcalendarsystemjalali.cpp:194 6230 #, kde-format 6231 msgctxt "Jalali month 12 - KLocale::NarrowName" 6232 msgid "E" 6233 msgstr "" 6234 6235 #: kdecore/kcalendarsystemjalali.cpp:203 6236 #, fuzzy, kde-format 6237 #| msgctxt "of Farvardin short" 6238 #| msgid "of Far" 6239 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6240 msgid "of Far" 6241 msgstr "फर क' " 6242 6243 #: kdecore/kcalendarsystemjalali.cpp:205 6244 #, fuzzy, kde-format 6245 #| msgctxt "of Ordibehesht short" 6246 #| msgid "of Ord" 6247 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6248 msgid "of Ord" 6249 msgstr "ओरदी क' " 6250 6251 #: kdecore/kcalendarsystemjalali.cpp:207 6252 #, fuzzy, kde-format 6253 #| msgctxt "of Khordad short" 6254 #| msgid "of Kho" 6255 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6256 msgid "of Kho" 6257 msgstr "खोर क' " 6258 6259 #: kdecore/kcalendarsystemjalali.cpp:209 6260 #, fuzzy, kde-format 6261 #| msgctxt "of Tir short" 6262 #| msgid "of Tir" 6263 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6264 msgid "of Tir" 6265 msgstr "तिर क' " 6266 6267 #: kdecore/kcalendarsystemjalali.cpp:211 6268 #, fuzzy, kde-format 6269 #| msgctxt "of Mordad short" 6270 #| msgid "of Mor" 6271 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6272 msgid "of Mor" 6273 msgstr "मोर क' " 6274 6275 #: kdecore/kcalendarsystemjalali.cpp:213 6276 #, fuzzy, kde-format 6277 #| msgctxt "of Shahrivar short" 6278 #| msgid "of Sha" 6279 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6280 msgid "of Sha" 6281 msgstr "शाह क' " 6282 6283 #: kdecore/kcalendarsystemjalali.cpp:215 6284 #, fuzzy, kde-format 6285 #| msgctxt "of Mehr short" 6286 #| msgid "of Meh" 6287 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6288 msgid "of Meh" 6289 msgstr "मेह क' " 6290 6291 #: kdecore/kcalendarsystemjalali.cpp:217 6292 #, fuzzy, kde-format 6293 #| msgctxt "of Aban short" 6294 #| msgid "of Aba" 6295 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6296 msgid "of Aba" 6297 msgstr "अबा क' " 6298 6299 #: kdecore/kcalendarsystemjalali.cpp:219 6300 #, fuzzy, kde-format 6301 #| msgctxt "of Azar short" 6302 #| msgid "of Aza" 6303 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6304 msgid "of Aza" 6305 msgstr "अज क' " 6306 6307 #: kdecore/kcalendarsystemjalali.cpp:221 6308 #, fuzzy, kde-format 6309 #| msgctxt "of Dei short" 6310 #| msgid "of Dei" 6311 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6312 msgid "of Dei" 6313 msgstr "देई क' " 6314 6315 #: kdecore/kcalendarsystemjalali.cpp:223 6316 #, fuzzy, kde-format 6317 #| msgctxt "of Bahman short" 6318 #| msgid "of Bah" 6319 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6320 msgid "of Bah" 6321 msgstr "बाह क' " 6322 6323 #: kdecore/kcalendarsystemjalali.cpp:225 6324 #, fuzzy, kde-format 6325 #| msgctxt "of Esfand short" 6326 #| msgid "of Esf" 6327 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6328 msgid "of Esf" 6329 msgstr "एसफ क' " 6330 6331 #: kdecore/kcalendarsystemjalali.cpp:234 6332 #, fuzzy, kde-format 6333 #| msgctxt "Farvardin short" 6334 #| msgid "Far" 6335 msgctxt "Jalali month 1 - KLocale::ShortName" 6336 msgid "Far" 6337 msgstr "दूरि" 6338 6339 #: kdecore/kcalendarsystemjalali.cpp:236 6340 #, fuzzy, kde-format 6341 #| msgctxt "Ordibehesht short" 6342 #| msgid "Ord" 6343 msgctxt "Jalali month 2 - KLocale::ShortName" 6344 msgid "Ord" 6345 msgstr "आर्द" 6346 6347 #: kdecore/kcalendarsystemjalali.cpp:238 6348 #, fuzzy, kde-format 6349 #| msgctxt "Khordad short" 6350 #| msgid "Kho" 6351 msgctxt "Jalali month 3 - KLocale::ShortName" 6352 msgid "Kho" 6353 msgstr "खोर" 6354 6355 #: kdecore/kcalendarsystemjalali.cpp:240 6356 #, fuzzy, kde-format 6357 #| msgctxt "Tir short" 6358 #| msgid "Tir" 6359 msgctxt "Jalali month 4 - KLocale::ShortName" 6360 msgid "Tir" 6361 msgstr "तिर" 6362 6363 #: kdecore/kcalendarsystemjalali.cpp:242 6364 #, fuzzy, kde-format 6365 #| msgctxt "Mordad short" 6366 #| msgid "Mor" 6367 msgctxt "Jalali month 5 - KLocale::ShortName" 6368 msgid "Mor" 6369 msgstr "मोर" 6370 6371 #: kdecore/kcalendarsystemjalali.cpp:244 6372 #, fuzzy, kde-format 6373 #| msgctxt "Shahrivar short" 6374 #| msgid "Sha" 6375 msgctxt "Jalali month 6 - KLocale::ShortName" 6376 msgid "Sha" 6377 msgstr "शा" 6378 6379 #: kdecore/kcalendarsystemjalali.cpp:246 6380 #, fuzzy, kde-format 6381 #| msgctxt "Mehr short" 6382 #| msgid "Meh" 6383 msgctxt "Jalali month 7 - KLocale::ShortName" 6384 msgid "Meh" 6385 msgstr "मेह" 6386 6387 #: kdecore/kcalendarsystemjalali.cpp:248 6388 #, fuzzy, kde-format 6389 #| msgctxt "Aban short" 6390 #| msgid "Aba" 6391 msgctxt "Jalali month 8 - KLocale::ShortName" 6392 msgid "Aba" 6393 msgstr "अबा" 6394 6395 #: kdecore/kcalendarsystemjalali.cpp:250 6396 #, fuzzy, kde-format 6397 #| msgctxt "Azar short" 6398 #| msgid "Aza" 6399 msgctxt "Jalali month 9 - KLocale::ShortName" 6400 msgid "Aza" 6401 msgstr "अज" 6402 6403 #: kdecore/kcalendarsystemjalali.cpp:252 6404 #, fuzzy, kde-format 6405 #| msgctxt "Dei short" 6406 #| msgid "Dei" 6407 msgctxt "Jalali month 10 - KLocale::ShortName" 6408 msgid "Dei" 6409 msgstr "देई" 6410 6411 #: kdecore/kcalendarsystemjalali.cpp:254 6412 #, fuzzy, kde-format 6413 #| msgctxt "Bahman short" 6414 #| msgid "Bah" 6415 msgctxt "Jalali month 11 - KLocale::ShortName" 6416 msgid "Bah" 6417 msgstr "बाह" 6418 6419 #: kdecore/kcalendarsystemjalali.cpp:256 6420 #, fuzzy, kde-format 6421 #| msgctxt "Esfand" 6422 #| msgid "Esf" 6423 msgctxt "Jalali month 12 - KLocale::ShortName" 6424 msgid "Esf" 6425 msgstr "एस" 6426 6427 #: kdecore/kcalendarsystemjalali.cpp:265 6428 #, fuzzy, kde-format 6429 #| msgid "of Farvardin" 6430 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6431 msgid "of Farvardin" 6432 msgstr "फवरदीन क' " 6433 6434 #: kdecore/kcalendarsystemjalali.cpp:267 6435 #, fuzzy, kde-format 6436 #| msgid "of Ordibehesht" 6437 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6438 msgid "of Ordibehesht" 6439 msgstr "ऑरदीबेहेस्त क' " 6440 6441 #: kdecore/kcalendarsystemjalali.cpp:269 6442 #, fuzzy, kde-format 6443 #| msgid "of Khordad" 6444 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6445 msgid "of Khordad" 6446 msgstr "खोरदाद क' " 6447 6448 #: kdecore/kcalendarsystemjalali.cpp:271 6449 #, fuzzy, kde-format 6450 #| msgctxt "of Tir short" 6451 #| msgid "of Tir" 6452 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6453 msgid "of Tir" 6454 msgstr "तिर क' " 6455 6456 #: kdecore/kcalendarsystemjalali.cpp:273 6457 #, fuzzy, kde-format 6458 #| msgid "of Mordad" 6459 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6460 msgid "of Mordad" 6461 msgstr "मोरदाद क' " 6462 6463 #: kdecore/kcalendarsystemjalali.cpp:275 6464 #, fuzzy, kde-format 6465 #| msgid "of Shahrivar" 6466 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6467 msgid "of Shahrivar" 6468 msgstr "शाहहिरवार क' " 6469 6470 #: kdecore/kcalendarsystemjalali.cpp:277 6471 #, fuzzy, kde-format 6472 #| msgid "of Mehr" 6473 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6474 msgid "of Mehr" 6475 msgstr "मेहर क' " 6476 6477 #: kdecore/kcalendarsystemjalali.cpp:279 6478 #, fuzzy, kde-format 6479 #| msgid "of Aban" 6480 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6481 msgid "of Aban" 6482 msgstr "अबान क' " 6483 6484 #: kdecore/kcalendarsystemjalali.cpp:281 6485 #, fuzzy, kde-format 6486 #| msgid "of Azar" 6487 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6488 msgid "of Azar" 6489 msgstr "अजर क' " 6490 6491 #: kdecore/kcalendarsystemjalali.cpp:283 6492 #, fuzzy, kde-format 6493 #| msgctxt "of Dei short" 6494 #| msgid "of Dei" 6495 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6496 msgid "of Dei" 6497 msgstr "देई क' " 6498 6499 #: kdecore/kcalendarsystemjalali.cpp:285 6500 #, fuzzy, kde-format 6501 #| msgid "of Bahman" 6502 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6503 msgid "of Bahman" 6504 msgstr "बहमान क' " 6505 6506 #: kdecore/kcalendarsystemjalali.cpp:287 6507 #, fuzzy, kde-format 6508 #| msgid "of Esfand" 6509 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6510 msgid "of Esfand" 6511 msgstr "एसफंद क' " 6512 6513 #: kdecore/kcalendarsystemjalali.cpp:296 6514 #, fuzzy, kde-format 6515 #| msgid "Farvardin" 6516 msgctxt "Jalali month 1 - KLocale::LongName" 6517 msgid "Farvardin" 6518 msgstr "फरवरदीन" 6519 6520 #: kdecore/kcalendarsystemjalali.cpp:298 6521 #, fuzzy, kde-format 6522 #| msgid "Ordibehesht" 6523 msgctxt "Jalali month 2 - KLocale::LongName" 6524 msgid "Ordibehesht" 6525 msgstr "ओरदीबेहेस्त" 6526 6527 #: kdecore/kcalendarsystemjalali.cpp:300 6528 #, fuzzy, kde-format 6529 #| msgid "Khordad" 6530 msgctxt "Jalali month 3 - KLocale::LongName" 6531 msgid "Khordad" 6532 msgstr "खोरदाद" 6533 6534 #: kdecore/kcalendarsystemjalali.cpp:302 6535 #, fuzzy, kde-format 6536 #| msgctxt "Tir short" 6537 #| msgid "Tir" 6538 msgctxt "Jalali month 4 - KLocale::LongName" 6539 msgid "Tir" 6540 msgstr "तिर" 6541 6542 #: kdecore/kcalendarsystemjalali.cpp:304 6543 #, fuzzy, kde-format 6544 #| msgid "Mordad" 6545 msgctxt "Jalali month 5 - KLocale::LongName" 6546 msgid "Mordad" 6547 msgstr "मोरदाद" 6548 6549 #: kdecore/kcalendarsystemjalali.cpp:306 6550 #, fuzzy, kde-format 6551 #| msgid "Shahrivar" 6552 msgctxt "Jalali month 6 - KLocale::LongName" 6553 msgid "Shahrivar" 6554 msgstr "शाहरिवार" 6555 6556 #: kdecore/kcalendarsystemjalali.cpp:308 6557 #, fuzzy, kde-format 6558 #| msgid "Mehr" 6559 msgctxt "Jalali month 7 - KLocale::LongName" 6560 msgid "Mehr" 6561 msgstr "मेहर" 6562 6563 #: kdecore/kcalendarsystemjalali.cpp:310 6564 #, fuzzy, kde-format 6565 #| msgid "Aban" 6566 msgctxt "Jalali month 8 - KLocale::LongName" 6567 msgid "Aban" 6568 msgstr "अबान" 6569 6570 #: kdecore/kcalendarsystemjalali.cpp:312 6571 #, fuzzy, kde-format 6572 #| msgid "Azar" 6573 msgctxt "Jalali month 9 - KLocale::LongName" 6574 msgid "Azar" 6575 msgstr "अजर" 6576 6577 #: kdecore/kcalendarsystemjalali.cpp:314 6578 #, fuzzy, kde-format 6579 #| msgctxt "Dei short" 6580 #| msgid "Dei" 6581 msgctxt "Jalali month 10 - KLocale::LongName" 6582 msgid "Dei" 6583 msgstr "देई" 6584 6585 #: kdecore/kcalendarsystemjalali.cpp:316 6586 #, fuzzy, kde-format 6587 #| msgid "Bahman" 6588 msgctxt "Jalali month 11 - KLocale::LongName" 6589 msgid "Bahman" 6590 msgstr "बहमान" 6591 6592 #: kdecore/kcalendarsystemjalali.cpp:318 6593 #, fuzzy, kde-format 6594 #| msgid "Esfand" 6595 msgctxt "Jalali month 12 - KLocale::LongName" 6596 msgid "Esfand" 6597 msgstr "एसफंद" 6598 6599 #: kdecore/kcalendarsystemjalali.cpp:331 6600 #, kde-format 6601 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6602 msgid "2" 6603 msgstr "" 6604 6605 #: kdecore/kcalendarsystemjalali.cpp:333 6606 #, kde-format 6607 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6608 msgid "3" 6609 msgstr "" 6610 6611 #: kdecore/kcalendarsystemjalali.cpp:335 6612 #, kde-format 6613 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6614 msgid "4" 6615 msgstr "" 6616 6617 #: kdecore/kcalendarsystemjalali.cpp:337 6618 #, kde-format 6619 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6620 msgid "5" 6621 msgstr "" 6622 6623 #: kdecore/kcalendarsystemjalali.cpp:339 6624 #, kde-format 6625 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6626 msgid "J" 6627 msgstr "" 6628 6629 #: kdecore/kcalendarsystemjalali.cpp:341 6630 #, kde-format 6631 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6632 msgid "S" 6633 msgstr "" 6634 6635 #: kdecore/kcalendarsystemjalali.cpp:343 6636 #, kde-format 6637 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6638 msgid "1" 6639 msgstr "" 6640 6641 #: kdecore/kcalendarsystemjalali.cpp:352 6642 #, fuzzy, kde-format 6643 #| msgctxt "Do shanbe short" 6644 #| msgid "2sh" 6645 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6646 msgid "2sh" 6647 msgstr "2sh" 6648 6649 #: kdecore/kcalendarsystemjalali.cpp:354 6650 #, fuzzy, kde-format 6651 #| msgctxt "Se shanbe short" 6652 #| msgid "3sh" 6653 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6654 msgid "3sh" 6655 msgstr "3sh" 6656 6657 #: kdecore/kcalendarsystemjalali.cpp:356 6658 #, fuzzy, kde-format 6659 #| msgctxt "Chahar shanbe short" 6660 #| msgid "4sh" 6661 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6662 msgid "4sh" 6663 msgstr "4sh" 6664 6665 #: kdecore/kcalendarsystemjalali.cpp:358 6666 #, fuzzy, kde-format 6667 #| msgctxt "Panj shanbe short" 6668 #| msgid "5sh" 6669 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6670 msgid "5sh" 6671 msgstr "5sh" 6672 6673 #: kdecore/kcalendarsystemjalali.cpp:360 6674 #, fuzzy, kde-format 6675 #| msgctxt "Jumee short" 6676 #| msgid "Jom" 6677 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6678 msgid "Jom" 6679 msgstr "Jom" 6680 6681 #: kdecore/kcalendarsystemjalali.cpp:362 6682 #, fuzzy, kde-format 6683 #| msgid "Shanbe" 6684 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6685 msgid "Shn" 6686 msgstr "शान्बे" 6687 6688 #: kdecore/kcalendarsystemjalali.cpp:364 6689 #, fuzzy, kde-format 6690 #| msgctxt "Yek-shanbe short" 6691 #| msgid "1sh" 6692 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6693 msgid "1sh" 6694 msgstr "1sh" 6695 6696 #: kdecore/kcalendarsystemjalali.cpp:371 6697 #, fuzzy, kde-format 6698 #| msgid "Do shanbe" 6699 msgctxt "Jalali weekday 1 - KLocale::LongName" 6700 msgid "Do shanbe" 6701 msgstr "दुइ शान्बे" 6702 6703 #: kdecore/kcalendarsystemjalali.cpp:373 6704 #, fuzzy, kde-format 6705 #| msgid "Se shanbe" 6706 msgctxt "Jalali weekday 2 - KLocale::LongName" 6707 msgid "Se shanbe" 6708 msgstr "से शान्बे" 6709 6710 #: kdecore/kcalendarsystemjalali.cpp:375 6711 #, fuzzy, kde-format 6712 #| msgid "Chahar shanbe" 6713 msgctxt "Jalali weekday 3 - KLocale::LongName" 6714 msgid "Chahar shanbe" 6715 msgstr "चहर शान्बे" 6716 6717 #: kdecore/kcalendarsystemjalali.cpp:377 6718 #, fuzzy, kde-format 6719 #| msgid "Panj shanbe" 6720 msgctxt "Jalali weekday 4 - KLocale::LongName" 6721 msgid "Panj shanbe" 6722 msgstr "पंज शान्बे" 6723 6724 #: kdecore/kcalendarsystemjalali.cpp:379 6725 #, fuzzy, kde-format 6726 #| msgid "Jumee" 6727 msgctxt "Jalali weekday 5 - KLocale::LongName" 6728 msgid "Jumee" 6729 msgstr "जूमी" 6730 6731 #: kdecore/kcalendarsystemjalali.cpp:381 6732 #, fuzzy, kde-format 6733 #| msgid "Shanbe" 6734 msgctxt "Jalali weekday 6 - KLocale::LongName" 6735 msgid "Shanbe" 6736 msgstr "शान्बे" 6737 6738 #: kdecore/kcalendarsystemjalali.cpp:383 6739 #, fuzzy, kde-format 6740 #| msgid "Yek-shanbe" 6741 msgctxt "Jalali weekday 7 - KLocale::LongName" 6742 msgid "Yek-shanbe" 6743 msgstr "येक-शान्बे" 6744 6745 #: kdecore/kcalendarsystemjapanese.cpp:62 6746 #, kde-format 6747 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6748 msgid "Meiji" 6749 msgstr "" 6750 6751 #: kdecore/kcalendarsystemjapanese.cpp:64 6752 #, kde-format 6753 msgctxt "" 6754 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6755 "e.g. Meiji 1" 6756 msgid "%EC Gannen" 6757 msgstr "" 6758 6759 #: kdecore/kcalendarsystemjapanese.cpp:66 6760 #, kde-format 6761 msgctxt "" 6762 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6763 "e.g. Meiji 22" 6764 msgid "%EC %Ey" 6765 msgstr "" 6766 6767 #: kdecore/kcalendarsystemjapanese.cpp:69 6768 #, kde-format 6769 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6770 msgid "Taishō" 6771 msgstr "" 6772 6773 #: kdecore/kcalendarsystemjapanese.cpp:71 6774 #, kde-format 6775 msgctxt "" 6776 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6777 "1, e.g. Taishō 1" 6778 msgid "%EC Gannen" 6779 msgstr "" 6780 6781 #: kdecore/kcalendarsystemjapanese.cpp:73 6782 #, kde-format 6783 msgctxt "" 6784 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6785 "1, e.g. Taishō 22" 6786 msgid "%EC %Ey" 6787 msgstr "" 6788 6789 #: kdecore/kcalendarsystemjapanese.cpp:76 6790 #, fuzzy, kde-format 6791 #| msgctxt "Shahrivar short" 6792 #| msgid "Sha" 6793 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6794 msgid "Shōwa" 6795 msgstr "शा" 6796 6797 #: kdecore/kcalendarsystemjapanese.cpp:78 6798 #, kde-format 6799 msgctxt "" 6800 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6801 "e.g. Shōwa 1" 6802 msgid "%EC Gannen" 6803 msgstr "" 6804 6805 #: kdecore/kcalendarsystemjapanese.cpp:80 6806 #, kde-format 6807 msgctxt "" 6808 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6809 "e.g. Shōwa 22" 6810 msgid "%EC %Ey" 6811 msgstr "" 6812 6813 #: kdecore/kcalendarsystemjapanese.cpp:83 6814 #, kde-format 6815 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6816 msgid "Heisei" 6817 msgstr "" 6818 6819 #: kdecore/kcalendarsystemjapanese.cpp:85 6820 #, kde-format 6821 msgctxt "" 6822 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6823 "1, e.g. Heisei 1" 6824 msgid "%EC Gannen" 6825 msgstr "" 6826 6827 #: kdecore/kcalendarsystemjapanese.cpp:87 6828 #, kde-format 6829 msgctxt "" 6830 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6831 "1, e.g. Heisei 22" 6832 msgid "%EC %Ey" 6833 msgstr "" 6834 6835 #: kdecore/kcalendarsystemjapanese.cpp:164 6836 #, fuzzy, kde-format 6837 msgctxt "Japanese year 1 of era" 6838 msgid "Gannen" 6839 msgstr "हरिअर:" 6840 6841 #: kdecore/kcalendarsystemjulian.cpp:73 6842 #, kde-format 6843 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6844 msgid "Before Common Era" 6845 msgstr "" 6846 6847 #: kdecore/kcalendarsystemjulian.cpp:74 6848 #, kde-format 6849 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6850 msgid "BCE" 6851 msgstr "" 6852 6853 #: kdecore/kcalendarsystemjulian.cpp:76 6854 #, kde-format 6855 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6856 msgid "Before Christ" 6857 msgstr "" 6858 6859 #: kdecore/kcalendarsystemjulian.cpp:77 6860 #, kde-format 6861 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6862 msgid "BC" 6863 msgstr "" 6864 6865 #: kdecore/kcalendarsystemjulian.cpp:79 6866 #, kde-format 6867 msgctxt "" 6868 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6869 msgid "%Ey %EC" 6870 msgstr "" 6871 6872 #: kdecore/kcalendarsystemjulian.cpp:83 6873 #, kde-format 6874 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6875 msgid "Common Era" 6876 msgstr "" 6877 6878 #: kdecore/kcalendarsystemjulian.cpp:84 6879 #, kde-format 6880 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6881 msgid "CE" 6882 msgstr "" 6883 6884 #: kdecore/kcalendarsystemjulian.cpp:86 6885 #, kde-format 6886 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6887 msgid "Anno Domini" 6888 msgstr "" 6889 6890 #: kdecore/kcalendarsystemjulian.cpp:87 6891 #, kde-format 6892 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6893 msgid "AD" 6894 msgstr "" 6895 6896 #: kdecore/kcalendarsystemjulian.cpp:89 6897 #, kde-format 6898 msgctxt "" 6899 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6900 msgid "%Ey %EC" 6901 msgstr "" 6902 6903 #: kdecore/kcalendarsystemjulian.cpp:172 6904 #, kde-format 6905 msgctxt "Julian month 1 - KLocale::NarrowName" 6906 msgid "J" 6907 msgstr "" 6908 6909 #: kdecore/kcalendarsystemjulian.cpp:174 6910 #, kde-format 6911 msgctxt "Julian month 2 - KLocale::NarrowName" 6912 msgid "F" 6913 msgstr "" 6914 6915 #: kdecore/kcalendarsystemjulian.cpp:176 6916 #, kde-format 6917 msgctxt "Julian month 3 - KLocale::NarrowName" 6918 msgid "M" 6919 msgstr "" 6920 6921 #: kdecore/kcalendarsystemjulian.cpp:178 6922 #, fuzzy, kde-format 6923 #| msgid "Av" 6924 msgctxt "Julian month 4 - KLocale::NarrowName" 6925 msgid "A" 6926 msgstr "एव" 6927 6928 #: kdecore/kcalendarsystemjulian.cpp:180 6929 #, kde-format 6930 msgctxt "Julian month 5 - KLocale::NarrowName" 6931 msgid "M" 6932 msgstr "" 6933 6934 #: kdecore/kcalendarsystemjulian.cpp:182 6935 #, kde-format 6936 msgctxt "Julian month 6 - KLocale::NarrowName" 6937 msgid "J" 6938 msgstr "" 6939 6940 #: kdecore/kcalendarsystemjulian.cpp:184 6941 #, kde-format 6942 msgctxt "Julian month 7 - KLocale::NarrowName" 6943 msgid "J" 6944 msgstr "" 6945 6946 #: kdecore/kcalendarsystemjulian.cpp:186 6947 #, fuzzy, kde-format 6948 #| msgid "Av" 6949 msgctxt "Julian month 8 - KLocale::NarrowName" 6950 msgid "A" 6951 msgstr "एव" 6952 6953 #: kdecore/kcalendarsystemjulian.cpp:188 6954 #, kde-format 6955 msgctxt "Julian month 9 - KLocale::NarrowName" 6956 msgid "S" 6957 msgstr "" 6958 6959 #: kdecore/kcalendarsystemjulian.cpp:190 6960 #, kde-format 6961 msgctxt "Julian month 10 - KLocale::NarrowName" 6962 msgid "O" 6963 msgstr "" 6964 6965 #: kdecore/kcalendarsystemjulian.cpp:192 6966 #, kde-format 6967 msgctxt "Julian month 11 - KLocale::NarrowName" 6968 msgid "N" 6969 msgstr "" 6970 6971 #: kdecore/kcalendarsystemjulian.cpp:194 6972 #, kde-format 6973 msgctxt "Julian month 12 - KLocale::NarrowName" 6974 msgid "D" 6975 msgstr "" 6976 6977 #: kdecore/kcalendarsystemjulian.cpp:203 6978 #, fuzzy, kde-format 6979 #| msgctxt "of January" 6980 #| msgid "of Jan" 6981 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6982 msgid "of Jan" 6983 msgstr "जनवरी क' " 6984 6985 #: kdecore/kcalendarsystemjulian.cpp:205 6986 #, fuzzy, kde-format 6987 #| msgctxt "of February" 6988 #| msgid "of Feb" 6989 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6990 msgid "of Feb" 6991 msgstr "फरवरी क' " 6992 6993 #: kdecore/kcalendarsystemjulian.cpp:207 6994 #, fuzzy, kde-format 6995 #| msgctxt "of March" 6996 #| msgid "of Mar" 6997 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6998 msgid "of Mar" 6999 msgstr "मार्च क' " 7000 7001 #: kdecore/kcalendarsystemjulian.cpp:209 7002 #, fuzzy, kde-format 7003 #| msgctxt "of April" 7004 #| msgid "of Apr" 7005 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7006 msgid "of Apr" 7007 msgstr "अप्रैल क' " 7008 7009 #: kdecore/kcalendarsystemjulian.cpp:211 7010 #, fuzzy, kde-format 7011 #| msgctxt "of May short" 7012 #| msgid "of May" 7013 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7014 msgid "of May" 7015 msgstr "मई क' " 7016 7017 #: kdecore/kcalendarsystemjulian.cpp:213 7018 #, fuzzy, kde-format 7019 #| msgctxt "of June" 7020 #| msgid "of Jun" 7021 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7022 msgid "of Jun" 7023 msgstr "जून क' " 7024 7025 #: kdecore/kcalendarsystemjulian.cpp:215 7026 #, fuzzy, kde-format 7027 #| msgctxt "of July" 7028 #| msgid "of Jul" 7029 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7030 msgid "of Jul" 7031 msgstr "जुलाई क' " 7032 7033 #: kdecore/kcalendarsystemjulian.cpp:217 7034 #, fuzzy, kde-format 7035 #| msgctxt "of August" 7036 #| msgid "of Aug" 7037 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7038 msgid "of Aug" 7039 msgstr "अग. क' " 7040 7041 #: kdecore/kcalendarsystemjulian.cpp:219 7042 #, fuzzy, kde-format 7043 #| msgctxt "of September" 7044 #| msgid "of Sep" 7045 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7046 msgid "of Sep" 7047 msgstr "सित. क' " 7048 7049 #: kdecore/kcalendarsystemjulian.cpp:221 7050 #, fuzzy, kde-format 7051 #| msgctxt "of October" 7052 #| msgid "of Oct" 7053 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7054 msgid "of Oct" 7055 msgstr "अक्तू. क' " 7056 7057 #: kdecore/kcalendarsystemjulian.cpp:223 7058 #, fuzzy, kde-format 7059 #| msgctxt "of November" 7060 #| msgid "of Nov" 7061 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7062 msgid "of Nov" 7063 msgstr "नवं. क' " 7064 7065 #: kdecore/kcalendarsystemjulian.cpp:225 7066 #, fuzzy, kde-format 7067 #| msgctxt "of December" 7068 #| msgid "of Dec" 7069 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7070 msgid "of Dec" 7071 msgstr "दिस. क' " 7072 7073 #: kdecore/kcalendarsystemjulian.cpp:234 7074 #, fuzzy, kde-format 7075 #| msgctxt "January" 7076 #| msgid "Jan" 7077 msgctxt "Julian month 1 - KLocale::ShortName" 7078 msgid "Jan" 7079 msgstr "जनवरी" 7080 7081 #: kdecore/kcalendarsystemjulian.cpp:236 7082 #, fuzzy, kde-format 7083 #| msgctxt "February" 7084 #| msgid "Feb" 7085 msgctxt "Julian month 2 - KLocale::ShortName" 7086 msgid "Feb" 7087 msgstr "फरवरी" 7088 7089 #: kdecore/kcalendarsystemjulian.cpp:238 7090 #, fuzzy, kde-format 7091 #| msgctxt "March" 7092 #| msgid "Mar" 7093 msgctxt "Julian month 3 - KLocale::ShortName" 7094 msgid "Mar" 7095 msgstr "मार्च" 7096 7097 #: kdecore/kcalendarsystemjulian.cpp:240 7098 #, fuzzy, kde-format 7099 #| msgctxt "April" 7100 #| msgid "Apr" 7101 msgctxt "Julian month 4 - KLocale::ShortName" 7102 msgid "Apr" 7103 msgstr "अप्रैल" 7104 7105 #: kdecore/kcalendarsystemjulian.cpp:242 7106 #, fuzzy, kde-format 7107 #| msgctxt "May short" 7108 #| msgid "May" 7109 msgctxt "Julian month 5 - KLocale::ShortName" 7110 msgid "May" 7111 msgstr "मई" 7112 7113 #: kdecore/kcalendarsystemjulian.cpp:244 7114 #, fuzzy, kde-format 7115 #| msgctxt "June" 7116 #| msgid "Jun" 7117 msgctxt "Julian month 6 - KLocale::ShortName" 7118 msgid "Jun" 7119 msgstr "जून" 7120 7121 #: kdecore/kcalendarsystemjulian.cpp:246 7122 #, fuzzy, kde-format 7123 #| msgctxt "July" 7124 #| msgid "Jul" 7125 msgctxt "Julian month 7 - KLocale::ShortName" 7126 msgid "Jul" 7127 msgstr "जुलाइ" 7128 7129 #: kdecore/kcalendarsystemjulian.cpp:248 7130 #, fuzzy, kde-format 7131 #| msgctxt "August" 7132 #| msgid "Aug" 7133 msgctxt "Julian month 8 - KLocale::ShortName" 7134 msgid "Aug" 7135 msgstr "अगस्त" 7136 7137 #: kdecore/kcalendarsystemjulian.cpp:250 7138 #, fuzzy, kde-format 7139 #| msgctxt "September" 7140 #| msgid "Sep" 7141 msgctxt "Julian month 9 - KLocale::ShortName" 7142 msgid "Sep" 7143 msgstr "सितंबर" 7144 7145 #: kdecore/kcalendarsystemjulian.cpp:252 7146 #, fuzzy, kde-format 7147 #| msgctxt "October" 7148 #| msgid "Oct" 7149 msgctxt "Julian month 10 - KLocale::ShortName" 7150 msgid "Oct" 7151 msgstr "अक्टूबर" 7152 7153 #: kdecore/kcalendarsystemjulian.cpp:254 7154 #, fuzzy, kde-format 7155 #| msgctxt "November" 7156 #| msgid "Nov" 7157 msgctxt "Julian month 11 - KLocale::ShortName" 7158 msgid "Nov" 7159 msgstr "नबंबर" 7160 7161 #: kdecore/kcalendarsystemjulian.cpp:256 7162 #, fuzzy, kde-format 7163 #| msgctxt "December" 7164 #| msgid "Dec" 7165 msgctxt "Julian month 12 - KLocale::ShortName" 7166 msgid "Dec" 7167 msgstr "दिसंबर" 7168 7169 #: kdecore/kcalendarsystemjulian.cpp:265 7170 #, fuzzy, kde-format 7171 #| msgid "of January" 7172 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7173 msgid "of January" 7174 msgstr "जनवरी क' " 7175 7176 #: kdecore/kcalendarsystemjulian.cpp:267 7177 #, fuzzy, kde-format 7178 #| msgid "of February" 7179 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7180 msgid "of February" 7181 msgstr "फरवरी क' " 7182 7183 #: kdecore/kcalendarsystemjulian.cpp:269 7184 #, fuzzy, kde-format 7185 #| msgid "of March" 7186 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7187 msgid "of March" 7188 msgstr "मार्च क' " 7189 7190 #: kdecore/kcalendarsystemjulian.cpp:271 7191 #, fuzzy, kde-format 7192 #| msgid "of April" 7193 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7194 msgid "of April" 7195 msgstr "अप्रैल क' " 7196 7197 #: kdecore/kcalendarsystemjulian.cpp:273 7198 #, fuzzy, kde-format 7199 #| msgctxt "of May short" 7200 #| msgid "of May" 7201 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7202 msgid "of May" 7203 msgstr "मई क' " 7204 7205 #: kdecore/kcalendarsystemjulian.cpp:275 7206 #, fuzzy, kde-format 7207 #| msgid "of June" 7208 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7209 msgid "of June" 7210 msgstr "जून क' " 7211 7212 #: kdecore/kcalendarsystemjulian.cpp:277 7213 #, fuzzy, kde-format 7214 #| msgid "of July" 7215 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7216 msgid "of July" 7217 msgstr "जुलाई क' " 7218 7219 #: kdecore/kcalendarsystemjulian.cpp:279 7220 #, fuzzy, kde-format 7221 #| msgid "of August" 7222 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7223 msgid "of August" 7224 msgstr "अगस्त क' " 7225 7226 #: kdecore/kcalendarsystemjulian.cpp:281 7227 #, fuzzy, kde-format 7228 #| msgid "of September" 7229 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7230 msgid "of September" 7231 msgstr "सितम्बर क' " 7232 7233 #: kdecore/kcalendarsystemjulian.cpp:283 7234 #, fuzzy, kde-format 7235 #| msgid "of October" 7236 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7237 msgid "of October" 7238 msgstr "अक्टूबर क' " 7239 7240 #: kdecore/kcalendarsystemjulian.cpp:285 7241 #, fuzzy, kde-format 7242 #| msgid "of November" 7243 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7244 msgid "of November" 7245 msgstr "नवंबर क' " 7246 7247 #: kdecore/kcalendarsystemjulian.cpp:287 7248 #, fuzzy, kde-format 7249 #| msgid "of December" 7250 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7251 msgid "of December" 7252 msgstr "दिसम्बर क' " 7253 7254 #: kdecore/kcalendarsystemjulian.cpp:296 7255 #, fuzzy, kde-format 7256 #| msgid "January" 7257 msgctxt "Julian month 1 - KLocale::LongName" 7258 msgid "January" 7259 msgstr "जनवरी" 7260 7261 #: kdecore/kcalendarsystemjulian.cpp:298 7262 #, fuzzy, kde-format 7263 #| msgid "February" 7264 msgctxt "Julian month 2 - KLocale::LongName" 7265 msgid "February" 7266 msgstr "फरवरी" 7267 7268 #: kdecore/kcalendarsystemjulian.cpp:300 7269 #, fuzzy, kde-format 7270 #| msgctxt "March long" 7271 #| msgid "March" 7272 msgctxt "Julian month 3 - KLocale::LongName" 7273 msgid "March" 7274 msgstr "मार्च" 7275 7276 #: kdecore/kcalendarsystemjulian.cpp:302 7277 #, fuzzy, kde-format 7278 #| msgid "April" 7279 msgctxt "Julian month 4 - KLocale::LongName" 7280 msgid "April" 7281 msgstr "अप्रैल" 7282 7283 #: kdecore/kcalendarsystemjulian.cpp:304 7284 #, fuzzy, kde-format 7285 #| msgctxt "May short" 7286 #| msgid "May" 7287 msgctxt "Julian month 5 - KLocale::LongName" 7288 msgid "May" 7289 msgstr "मई" 7290 7291 #: kdecore/kcalendarsystemjulian.cpp:306 7292 #, fuzzy, kde-format 7293 #| msgid "June" 7294 msgctxt "Julian month 6 - KLocale::LongName" 7295 msgid "June" 7296 msgstr "जून" 7297 7298 #: kdecore/kcalendarsystemjulian.cpp:308 7299 #, fuzzy, kde-format 7300 #| msgid "July" 7301 msgctxt "Julian month 7 - KLocale::LongName" 7302 msgid "July" 7303 msgstr "जुलाइ" 7304 7305 #: kdecore/kcalendarsystemjulian.cpp:310 7306 #, fuzzy, kde-format 7307 #| msgctxt "August long" 7308 #| msgid "August" 7309 msgctxt "Julian month 8 - KLocale::LongName" 7310 msgid "August" 7311 msgstr "अगस्त" 7312 7313 #: kdecore/kcalendarsystemjulian.cpp:312 7314 #, fuzzy, kde-format 7315 #| msgid "September" 7316 msgctxt "Julian month 9 - KLocale::LongName" 7317 msgid "September" 7318 msgstr "सितम्बर" 7319 7320 #: kdecore/kcalendarsystemjulian.cpp:314 7321 #, fuzzy, kde-format 7322 #| msgid "October" 7323 msgctxt "Julian month 10 - KLocale::LongName" 7324 msgid "October" 7325 msgstr "अक्टूबर" 7326 7327 #: kdecore/kcalendarsystemjulian.cpp:316 7328 #, fuzzy, kde-format 7329 #| msgid "November" 7330 msgctxt "Julian month 11 - KLocale::LongName" 7331 msgid "November" 7332 msgstr "नवम्बर" 7333 7334 #: kdecore/kcalendarsystemjulian.cpp:318 7335 #, fuzzy, kde-format 7336 #| msgid "December" 7337 msgctxt "Julian month 12 - KLocale::LongName" 7338 msgid "December" 7339 msgstr "दिसम्बर" 7340 7341 #: kdecore/kcalendarsystemjulian.cpp:331 7342 #, kde-format 7343 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7344 msgid "M" 7345 msgstr "" 7346 7347 #: kdecore/kcalendarsystemjulian.cpp:333 7348 #, kde-format 7349 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7350 msgid "T" 7351 msgstr "" 7352 7353 #: kdecore/kcalendarsystemjulian.cpp:335 7354 #, kde-format 7355 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7356 msgid "W" 7357 msgstr "" 7358 7359 #: kdecore/kcalendarsystemjulian.cpp:337 7360 #, kde-format 7361 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7362 msgid "T" 7363 msgstr "" 7364 7365 #: kdecore/kcalendarsystemjulian.cpp:339 7366 #, kde-format 7367 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7368 msgid "F" 7369 msgstr "" 7370 7371 #: kdecore/kcalendarsystemjulian.cpp:341 7372 #, kde-format 7373 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7374 msgid "S" 7375 msgstr "" 7376 7377 #: kdecore/kcalendarsystemjulian.cpp:343 7378 #, kde-format 7379 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7380 msgid "S" 7381 msgstr "" 7382 7383 #: kdecore/kcalendarsystemjulian.cpp:352 7384 #, fuzzy, kde-format 7385 #| msgctxt "Monday" 7386 #| msgid "Mon" 7387 msgctxt "Julian weekday 1 - KLocale::ShortName" 7388 msgid "Mon" 7389 msgstr "सोम" 7390 7391 #: kdecore/kcalendarsystemjulian.cpp:354 7392 #, fuzzy, kde-format 7393 #| msgctxt "Tuesday" 7394 #| msgid "Tue" 7395 msgctxt "Julian weekday 2 - KLocale::ShortName" 7396 msgid "Tue" 7397 msgstr "मंगल" 7398 7399 #: kdecore/kcalendarsystemjulian.cpp:356 7400 #, fuzzy, kde-format 7401 #| msgctxt "Wednesday" 7402 #| msgid "Wed" 7403 msgctxt "Julian weekday 3 - KLocale::ShortName" 7404 msgid "Wed" 7405 msgstr "बुध" 7406 7407 #: kdecore/kcalendarsystemjulian.cpp:358 7408 #, fuzzy, kde-format 7409 #| msgctxt "Thursday" 7410 #| msgid "Thu" 7411 msgctxt "Julian weekday 4 - KLocale::ShortName" 7412 msgid "Thu" 7413 msgstr "गुरू" 7414 7415 #: kdecore/kcalendarsystemjulian.cpp:360 7416 #, fuzzy, kde-format 7417 #| msgctxt "Friday" 7418 #| msgid "Fri" 7419 msgctxt "Julian weekday 5 - KLocale::ShortName" 7420 msgid "Fri" 7421 msgstr "शुक्र" 7422 7423 #: kdecore/kcalendarsystemjulian.cpp:362 7424 #, fuzzy, kde-format 7425 #| msgctxt "Saturday" 7426 #| msgid "Sat" 7427 msgctxt "Julian weekday 6 - KLocale::ShortName" 7428 msgid "Sat" 7429 msgstr "शनि" 7430 7431 #: kdecore/kcalendarsystemjulian.cpp:364 7432 #, fuzzy, kde-format 7433 #| msgctxt "Sunday" 7434 #| msgid "Sun" 7435 msgctxt "Julian weekday 7 - KLocale::ShortName" 7436 msgid "Sun" 7437 msgstr "सूर्य" 7438 7439 #: kdecore/kcalendarsystemjulian.cpp:371 7440 #, fuzzy, kde-format 7441 #| msgid "Monday" 7442 msgctxt "Julian weekday 1 - KLocale::LongName" 7443 msgid "Monday" 7444 msgstr "सोमवार" 7445 7446 #: kdecore/kcalendarsystemjulian.cpp:373 7447 #, fuzzy, kde-format 7448 #| msgid "Tuesday" 7449 msgctxt "Julian weekday 2 - KLocale::LongName" 7450 msgid "Tuesday" 7451 msgstr "मंगलवार" 7452 7453 #: kdecore/kcalendarsystemjulian.cpp:375 7454 #, fuzzy, kde-format 7455 #| msgid "Wednesday" 7456 msgctxt "Julian weekday 3 - KLocale::LongName" 7457 msgid "Wednesday" 7458 msgstr "बुधवार" 7459 7460 #: kdecore/kcalendarsystemjulian.cpp:377 7461 #, fuzzy, kde-format 7462 #| msgid "Thursday" 7463 msgctxt "Julian weekday 4 - KLocale::LongName" 7464 msgid "Thursday" 7465 msgstr "वृहस्पतिवार" 7466 7467 #: kdecore/kcalendarsystemjulian.cpp:379 7468 #, fuzzy, kde-format 7469 #| msgid "Friday" 7470 msgctxt "Julian weekday 5 - KLocale::LongName" 7471 msgid "Friday" 7472 msgstr "शुक्रवार" 7473 7474 #: kdecore/kcalendarsystemjulian.cpp:381 7475 #, fuzzy, kde-format 7476 #| msgid "Saturday" 7477 msgctxt "Julian weekday 6 - KLocale::LongName" 7478 msgid "Saturday" 7479 msgstr "शनिवार" 7480 7481 #: kdecore/kcalendarsystemjulian.cpp:383 7482 #, fuzzy, kde-format 7483 #| msgid "Sunday" 7484 msgctxt "Julian weekday 7 - KLocale::LongName" 7485 msgid "Sunday" 7486 msgstr "रविवार" 7487 7488 #: kdecore/kcalendarsystemminguo.cpp:57 7489 #, kde-format 7490 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7491 msgid "Republic of China Era" 7492 msgstr "" 7493 7494 #: kdecore/kcalendarsystemminguo.cpp:58 7495 #, kde-format 7496 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7497 msgid "ROC" 7498 msgstr "" 7499 7500 #: kdecore/kcalendarsystemminguo.cpp:59 7501 #, kde-format 7502 msgctxt "" 7503 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7504 msgid "%EC %Ey" 7505 msgstr "" 7506 7507 #: kdecore/kcalendarsystemthai.cpp:58 7508 #, kde-format 7509 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7510 msgid "Buddhist Era" 7511 msgstr "" 7512 7513 #: kdecore/kcalendarsystemthai.cpp:59 7514 #, kde-format 7515 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7516 msgid "BE" 7517 msgstr "" 7518 7519 #: kdecore/kcalendarsystemthai.cpp:60 7520 #, kde-format 7521 msgctxt "" 7522 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7523 msgid "%Ey %EC" 7524 msgstr "" 7525 7526 #: kdecore/kcmdlineargs.cpp:278 7527 #, kde-format 7528 msgid "Use the X-server display 'displayname'" 7529 msgstr "एक्स-सर्वर डिस्पले 'displayname' इस्तेमाल करू. " 7530 7531 #: kdecore/kcmdlineargs.cpp:281 7532 #, kde-format 7533 msgid "Restore the application for the given 'sessionId'" 7534 msgstr "अनुप्रयोग केँ देल 'sessionId' गेल सँ पुनर्स्थापित करू." 7535 7536 #: kdecore/kcmdlineargs.cpp:282 7537 #, kde-format 7538 msgid "" 7539 "Causes the application to install a private color\n" 7540 "map on an 8-bit display" 7541 msgstr "" 7542 "अनुप्रयोग केँ बाधित करैत अछि जे ओ मैप पर निज रंग\n" 7543 "8-बिट डिस्प्ले पर संस्थापित करे." 7544 7545 #: kdecore/kcmdlineargs.cpp:283 7546 #, kde-format 7547 msgid "" 7548 "Limits the number of colors allocated in the color\n" 7549 "cube on an 8-bit display, if the application is\n" 7550 "using the QApplication::ManyColor color\n" 7551 "specification" 7552 msgstr "" 7553 7554 #: kdecore/kcmdlineargs.cpp:284 7555 #, kde-format 7556 msgid "tells Qt to never grab the mouse or the keyboard" 7557 msgstr "क्यूटी केँ बतबैत अछि जे माउस अथवा कीबोर्ड केँ कहियो नहि पकड़बाक लेल." 7558 7559 #: kdecore/kcmdlineargs.cpp:285 7560 #, kde-format 7561 msgid "" 7562 "running under a debugger can cause an implicit\n" 7563 "-nograb, use -dograb to override" 7564 msgstr "" 7565 7566 #: kdecore/kcmdlineargs.cpp:286 7567 #, kde-format 7568 msgid "switches to synchronous mode for debugging" 7569 msgstr "डिबगिंग क' लेल सिंक्रोनस मोड मे बदलता अछि." 7570 7571 #: kdecore/kcmdlineargs.cpp:288 7572 #, kde-format 7573 msgid "defines the application font" 7574 msgstr "अनुप्रयोग फोन्ट पारिभाषित करैत अछि" 7575 7576 #: kdecore/kcmdlineargs.cpp:290 7577 #, kde-format 7578 msgid "" 7579 "sets the default background color and an\n" 7580 "application palette (light and dark shades are\n" 7581 "calculated)" 7582 msgstr "" 7583 "मूलभूत पृष्ठभूमि रंग नियत करैत अछि. आओर एकटा\n" 7584 "अनुप्रयोग पैलेट (हल्के आओर गहरे शेड्स क' \n" 7585 "गणन कएल जाइत अछि)" 7586 7587 #: kdecore/kcmdlineargs.cpp:292 7588 #, kde-format 7589 msgid "sets the default foreground color" 7590 msgstr "मूलभूत अग्रभूमि रंग सेट करैत अछि" 7591 7592 #: kdecore/kcmdlineargs.cpp:294 7593 #, kde-format 7594 msgid "sets the default button color" 7595 msgstr "मूलभूत बटन रंग सेट करैत अछि" 7596 7597 #: kdecore/kcmdlineargs.cpp:295 7598 #, kde-format 7599 msgid "sets the application name" 7600 msgstr "अनुप्रयोग नाम सेट करैत अछि" 7601 7602 #: kdecore/kcmdlineargs.cpp:296 7603 #, kde-format 7604 msgid "sets the application title (caption)" 7605 msgstr "अनुप्रयोग शीर्षक सेट करैत अछि (कैप्शन)" 7606 7607 #: kdecore/kcmdlineargs.cpp:297 7608 #, kde-format 7609 msgid "load the testability framework" 7610 msgstr "" 7611 7612 #: kdecore/kcmdlineargs.cpp:299 7613 #, kde-format 7614 msgid "" 7615 "forces the application to use a TrueColor visual on\n" 7616 "an 8-bit display" 7617 msgstr "" 7618 "अनुप्रयोग केँ बाधित करैत अछि जे ओ ट्रू-कलर विजुअल\n" 7619 "8-बिट डिस्प्ले पर उपयोग करे." 7620 7621 #: kdecore/kcmdlineargs.cpp:300 7622 #, kde-format 7623 msgid "" 7624 "sets XIM (X Input Method) input style. Possible\n" 7625 "values are onthespot, overthespot, offthespot and\n" 7626 "root" 7627 msgstr "" 7628 7629 #: kdecore/kcmdlineargs.cpp:301 7630 #, kde-format 7631 msgid "set XIM server" 7632 msgstr "एक्सआईएम सर्वर सेट करू" 7633 7634 #: kdecore/kcmdlineargs.cpp:302 7635 #, kde-format 7636 msgid "disable XIM" 7637 msgstr "एक्सआईएम अक्षम करू" 7638 7639 #: kdecore/kcmdlineargs.cpp:304 7640 #, kde-format 7641 msgid "mirrors the whole layout of widgets" 7642 msgstr "विजेट केर संपूर्ण खाकाक नकल बनाबैछ" 7643 7644 #: kdecore/kcmdlineargs.cpp:305 7645 #, kde-format 7646 msgid "applies the Qt stylesheet to the application widgets" 7647 msgstr "अनुप्रयोग विजेट मे क्यूटी स्टाइलशीट लागू करैत अछि" 7648 7649 #: kdecore/kcmdlineargs.cpp:306 7650 #, kde-format 7651 msgid "" 7652 "use a different graphics system instead of the default one, options are " 7653 "raster and opengl (experimental)" 7654 msgstr "" 7655 7656 #: kdecore/kcmdlineargs.cpp:307 7657 #, kde-format 7658 msgid "" 7659 "QML JS debugger information. Application must be\n" 7660 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7661 "enabled" 7662 msgstr "" 7663 7664 #: kdecore/kcmdlineargs.cpp:308 7665 #, kde-format 7666 msgid "The windowing system platform (e.g. xcb or wayland)" 7667 msgstr "" 7668 7669 #: kdecore/kcmdlineargs.cpp:310 7670 #, kde-format 7671 msgid "Use 'caption' as name in the titlebar" 7672 msgstr "शीर्षक पट्टी मे 'कैप्शन' नाम क' रूपेँ इस्तेमाल करू" 7673 7674 #: kdecore/kcmdlineargs.cpp:311 7675 #, kde-format 7676 msgid "Use 'icon' as the application icon" 7677 msgstr "प्रतीक केँ अनुप्रयोग 'प्रतीक' क' रूपेँ इस्तेमाल करू" 7678 7679 #: kdecore/kcmdlineargs.cpp:312 7680 #, kde-format 7681 msgid "Use alternative configuration file" 7682 msgstr "वैकल्पिक बिन्यास फाइल इस्तेमाल करू" 7683 7684 #: kdecore/kcmdlineargs.cpp:313 7685 #, kde-format 7686 msgid "Disable crash handler, to get core dumps" 7687 msgstr "कोर डम्प पाने क' लेल क्रेश हैंडलर अक्षम करू." 7688 7689 #: kdecore/kcmdlineargs.cpp:315 7690 #, kde-format 7691 msgid "Waits for a WM_NET compatible windowmanager" 7692 msgstr "एकटा WM_NET कम्पेटिबल विंडो-प्रबंधक क' लेल प्रतीक्षा रत" 7693 7694 #: kdecore/kcmdlineargs.cpp:317 7695 #, kde-format 7696 msgid "sets the application GUI style" 7697 msgstr "अनुप्रयोग जीयूआई शैली सेट करैत अछि" 7698 7699 #: kdecore/kcmdlineargs.cpp:318 7700 #, kde-format 7701 msgid "" 7702 "sets the client geometry of the main widget - see man X for the argument " 7703 "format (usually WidthxHeight+XPos+YPos)" 7704 msgstr "" 7705 7706 #: kdecore/kcmdlineargs.cpp:436 7707 #, kde-format 7708 msgid "KDE Application" 7709 msgstr "केडीइ अनुप्रयोग" 7710 7711 #: kdecore/kcmdlineargs.cpp:497 7712 #, kde-format 7713 msgid "Qt" 7714 msgstr "क्यूटी" 7715 7716 #: kdecore/kcmdlineargs.cpp:500 7717 #, kde-format 7718 msgid "KDE" 7719 msgstr "केडीइ" 7720 7721 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7722 #, fuzzy, kde-format 7723 #| msgid "ERROR: Unknown protocol '%1'" 7724 msgid "Unknown option '%1'." 7725 msgstr "त्रुटि: अनचिन्ह प्रोटोकाल '%1'" 7726 7727 #: kdecore/kcmdlineargs.cpp:841 7728 #, kde-format 7729 msgctxt "@info:shell %1 is cmdoption name" 7730 msgid "'%1' missing." 7731 msgstr "'%1' खो गेल अछि." 7732 7733 #: kdecore/kcmdlineargs.cpp:895 7734 #, fuzzy, kde-format 7735 #| msgctxt "" 7736 #| "@info:shell message on appcmd --version; do not translate 'Development " 7737 #| "Platform'%3 application name, other %n version strings" 7738 #| msgid "" 7739 #| "Qt: %1\n" 7740 #| "KDE Development Platform: %2\n" 7741 #| "%3: %4\n" 7742 msgctxt "" 7743 "@info:shell message on appcmd --version; do not translate 'Development " 7744 "Platform'%3 application name, other %n version strings" 7745 msgid "" 7746 "Qt: %1\n" 7747 "KDE Frameworks: %2\n" 7748 "%3: %4\n" 7749 msgstr "" 7750 "Qt: %1\n" 7751 "KDE विकास प्लैटफॉर्म: %2\n" 7752 "%3: %4\n" 7753 7754 #: kdecore/kcmdlineargs.cpp:921 7755 #, kde-format 7756 msgctxt "the 2nd argument is a list of name+address, one on each line" 7757 msgid "" 7758 "%1 was written by\n" 7759 "%2" 7760 msgstr "" 7761 "%1 केँ \n" 7762 "%2 केर द्वारा लिखल गेल" 7763 7764 #: kdecore/kcmdlineargs.cpp:924 7765 #, kde-format 7766 msgid "This application was written by somebody who wants to remain anonymous." 7767 msgstr "" 7768 7769 #: kdecore/kcmdlineargs.cpp:929 7770 #, kde-format 7771 msgid "Please use http://bugs.kde.org to report bugs.\n" 7772 msgstr "" 7773 7774 #: kdecore/kcmdlineargs.cpp:931 7775 #, kde-format 7776 msgid "Please report bugs to %1.\n" 7777 msgstr "" 7778 7779 #: kdecore/kcmdlineargs.cpp:961 7780 #, kde-format 7781 msgid "Unexpected argument '%1'." 7782 msgstr "" 7783 7784 #: kdecore/kcmdlineargs.cpp:1074 7785 #, kde-format 7786 msgid "Use --help to get a list of available command line options." 7787 msgstr "" 7788 7789 #: kdecore/kcmdlineargs.cpp:1096 7790 #, kde-format 7791 msgid "[options] " 7792 msgstr "" 7793 7794 #: kdecore/kcmdlineargs.cpp:1101 7795 #, kde-format 7796 msgid "[%1-options]" 7797 msgstr "" 7798 7799 #: kdecore/kcmdlineargs.cpp:1122 7800 #, kde-format 7801 msgid "Usage: %1 %2\n" 7802 msgstr "" 7803 7804 #: kdecore/kcmdlineargs.cpp:1125 7805 #, kde-format 7806 msgid "" 7807 "\n" 7808 "Generic options:\n" 7809 msgstr "" 7810 7811 #: kdecore/kcmdlineargs.cpp:1127 7812 #, kde-format 7813 msgid "Show help about options" 7814 msgstr "" 7815 7816 #: kdecore/kcmdlineargs.cpp:1133 7817 #, kde-format 7818 msgid "Show %1 specific options" 7819 msgstr "" 7820 7821 #: kdecore/kcmdlineargs.cpp:1140 7822 #, kde-format 7823 msgid "Show all options" 7824 msgstr "" 7825 7826 #: kdecore/kcmdlineargs.cpp:1141 7827 #, kde-format 7828 msgid "Show author information" 7829 msgstr "" 7830 7831 #: kdecore/kcmdlineargs.cpp:1142 7832 #, kde-format 7833 msgid "Show version information" 7834 msgstr "" 7835 7836 #: kdecore/kcmdlineargs.cpp:1143 7837 #, kde-format 7838 msgid "Show license information" 7839 msgstr "" 7840 7841 #: kdecore/kcmdlineargs.cpp:1144 7842 #, kde-format 7843 msgid "End of options" 7844 msgstr "" 7845 7846 #: kdecore/kcmdlineargs.cpp:1164 7847 #, kde-format 7848 msgid "" 7849 "\n" 7850 "%1 options:\n" 7851 msgstr "" 7852 7853 #: kdecore/kcmdlineargs.cpp:1166 7854 #, kde-format 7855 msgid "" 7856 "\n" 7857 "Options:\n" 7858 msgstr "" 7859 7860 #: kdecore/kcmdlineargs.cpp:1219 7861 #, kde-format 7862 msgid "" 7863 "\n" 7864 "Arguments:\n" 7865 msgstr "" 7866 7867 #: kdecore/kcmdlineargs.cpp:1580 7868 #, kde-format 7869 msgid "The files/URLs opened by the application will be deleted after use" 7870 msgstr "" 7871 "जे फाइलसभ/यूआरएल अनुप्रयोग द्वारा खोलल गेल छी ओकरा इस्तेमाल केर पश्चात मेटाए देल जएताह" 7872 7873 #: kdecore/kcmdlineargs.cpp:1581 7874 #, kde-format 7875 msgid "KDE-tempfile" 7876 msgstr "केडीइ-टेम्पफाइल" 7877 7878 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7879 #: kdecore/kdatetime.cpp:2985 7880 #, fuzzy, kde-format 7881 msgid "am" 7882 msgstr "पूर्वाह्न" 7883 7884 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7885 #: kdecore/kdatetime.cpp:2990 7886 #, kde-format 7887 msgid "pm" 7888 msgstr "अपराह्न" 7889 7890 #: kdecore/klibloader.cpp:100 7891 #, kde-format 7892 msgid "Library \"%1\" not found" 7893 msgstr "लाइब्रेरी \"%1\" नहि भेटल" 7894 7895 #: kdecore/klocale_kde.cpp:785 7896 #, kde-format 7897 msgctxt "digit set" 7898 msgid "Arabic-Indic" 7899 msgstr "अरबी-इंडिक" 7900 7901 #: kdecore/klocale_kde.cpp:788 7902 #, kde-format 7903 msgctxt "digit set" 7904 msgid "Bengali" 7905 msgstr "बंगाली" 7906 7907 #: kdecore/klocale_kde.cpp:791 7908 #, kde-format 7909 msgctxt "digit set" 7910 msgid "Devanagari" 7911 msgstr "देवनागरी" 7912 7913 #: kdecore/klocale_kde.cpp:794 7914 #, kde-format 7915 msgctxt "digit set" 7916 msgid "Eastern Arabic-Indic" 7917 msgstr "पूरबक अरबी-इंडिक" 7918 7919 #: kdecore/klocale_kde.cpp:797 7920 #, kde-format 7921 msgctxt "digit set" 7922 msgid "Gujarati" 7923 msgstr "गुजराती" 7924 7925 #: kdecore/klocale_kde.cpp:800 7926 #, kde-format 7927 msgctxt "digit set" 7928 msgid "Gurmukhi" 7929 msgstr "गुरूमुखी" 7930 7931 #: kdecore/klocale_kde.cpp:803 7932 #, kde-format 7933 msgctxt "digit set" 7934 msgid "Kannada" 7935 msgstr "कन्नड" 7936 7937 #: kdecore/klocale_kde.cpp:806 7938 #, kde-format 7939 msgctxt "digit set" 7940 msgid "Khmer" 7941 msgstr "ख्मेर" 7942 7943 #: kdecore/klocale_kde.cpp:809 7944 #, kde-format 7945 msgctxt "digit set" 7946 msgid "Malayalam" 7947 msgstr "मलयालम" 7948 7949 #: kdecore/klocale_kde.cpp:812 7950 #, kde-format 7951 msgctxt "digit set" 7952 msgid "Oriya" 7953 msgstr "उड़िया" 7954 7955 #: kdecore/klocale_kde.cpp:815 7956 #, kde-format 7957 msgctxt "digit set" 7958 msgid "Tamil" 7959 msgstr "तमिल" 7960 7961 #: kdecore/klocale_kde.cpp:818 7962 #, kde-format 7963 msgctxt "digit set" 7964 msgid "Telugu" 7965 msgstr "तेलुगु" 7966 7967 #: kdecore/klocale_kde.cpp:821 7968 #, fuzzy, kde-format 7969 #| msgid "R. Thaani" 7970 msgctxt "digit set" 7971 msgid "Thai" 7972 msgstr "र. उस्सानी" 7973 7974 #: kdecore/klocale_kde.cpp:824 7975 #, kde-format 7976 msgctxt "digit set" 7977 msgid "Arabic" 7978 msgstr "अरबी" 7979 7980 #: kdecore/klocale_kde.cpp:829 7981 #, kde-format 7982 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 7983 msgid "%1 (%2)" 7984 msgstr "%1 (%2)" 7985 7986 #. i18n: comments below, they are used by the 7987 #. translators. 7988 #. This prefix is shared by all current dialects. 7989 #. i18n: Dumb message, avoid any markup or scripting. 7990 #: kdecore/klocale_kde.cpp:1327 7991 #, kde-format 7992 msgctxt "size in bytes" 7993 msgid "%1 B" 7994 msgstr "%1 B" 7995 7996 #. i18n: Dumb message, avoid any markup or scripting. 7997 #: kdecore/klocale_kde.cpp:1332 7998 #, kde-format 7999 msgctxt "size in 1000 bytes" 8000 msgid "%1 kB" 8001 msgstr "%1 kB" 8002 8003 #. i18n: Dumb message, avoid any markup or scripting. 8004 #: kdecore/klocale_kde.cpp:1334 8005 #, kde-format 8006 msgctxt "size in 10^6 bytes" 8007 msgid "%1 MB" 8008 msgstr "%1 MB" 8009 8010 #. i18n: Dumb message, avoid any markup or scripting. 8011 #: kdecore/klocale_kde.cpp:1336 8012 #, kde-format 8013 msgctxt "size in 10^9 bytes" 8014 msgid "%1 GB" 8015 msgstr "%1 GB" 8016 8017 #. i18n: Dumb message, avoid any markup or scripting. 8018 #: kdecore/klocale_kde.cpp:1338 8019 #, kde-format 8020 msgctxt "size in 10^12 bytes" 8021 msgid "%1 TB" 8022 msgstr "%1 TB" 8023 8024 #. i18n: Dumb message, avoid any markup or scripting. 8025 #: kdecore/klocale_kde.cpp:1340 8026 #, kde-format 8027 msgctxt "size in 10^15 bytes" 8028 msgid "%1 PB" 8029 msgstr "%1 PB" 8030 8031 #. i18n: Dumb message, avoid any markup or scripting. 8032 #: kdecore/klocale_kde.cpp:1342 8033 #, kde-format 8034 msgctxt "size in 10^18 bytes" 8035 msgid "%1 EB" 8036 msgstr "%1 EB" 8037 8038 #. i18n: Dumb message, avoid any markup or scripting. 8039 #: kdecore/klocale_kde.cpp:1344 8040 #, kde-format 8041 msgctxt "size in 10^21 bytes" 8042 msgid "%1 ZB" 8043 msgstr "%1 ZB" 8044 8045 #. i18n: Dumb message, avoid any markup or scripting. 8046 #: kdecore/klocale_kde.cpp:1346 8047 #, kde-format 8048 msgctxt "size in 10^24 bytes" 8049 msgid "%1 YB" 8050 msgstr "%1 YB" 8051 8052 #. i18n: Dumb message, avoid any markup or scripting. 8053 #: kdecore/klocale_kde.cpp:1351 8054 #, kde-format 8055 msgctxt "memory size in 1024 bytes" 8056 msgid "%1 KB" 8057 msgstr "%1 KB" 8058 8059 #. i18n: Dumb message, avoid any markup or scripting. 8060 #: kdecore/klocale_kde.cpp:1353 8061 #, kde-format 8062 msgctxt "memory size in 2^20 bytes" 8063 msgid "%1 MB" 8064 msgstr "%1 MB" 8065 8066 #. i18n: Dumb message, avoid any markup or scripting. 8067 #: kdecore/klocale_kde.cpp:1355 8068 #, kde-format 8069 msgctxt "memory size in 2^30 bytes" 8070 msgid "%1 GB" 8071 msgstr "%1 GB" 8072 8073 #. i18n: Dumb message, avoid any markup or scripting. 8074 #: kdecore/klocale_kde.cpp:1357 8075 #, kde-format 8076 msgctxt "memory size in 2^40 bytes" 8077 msgid "%1 TB" 8078 msgstr "%1 TB" 8079 8080 #. i18n: Dumb message, avoid any markup or scripting. 8081 #: kdecore/klocale_kde.cpp:1359 8082 #, kde-format 8083 msgctxt "memory size in 2^50 bytes" 8084 msgid "%1 PB" 8085 msgstr "%1 PB" 8086 8087 #. i18n: Dumb message, avoid any markup or scripting. 8088 #: kdecore/klocale_kde.cpp:1361 8089 #, kde-format 8090 msgctxt "memory size in 2^60 bytes" 8091 msgid "%1 EB" 8092 msgstr "%1 EB" 8093 8094 #. i18n: Dumb message, avoid any markup or scripting. 8095 #: kdecore/klocale_kde.cpp:1363 8096 #, kde-format 8097 msgctxt "memory size in 2^70 bytes" 8098 msgid "%1 ZB" 8099 msgstr "%1 ZB" 8100 8101 #. i18n: Dumb message, avoid any markup or scripting. 8102 #: kdecore/klocale_kde.cpp:1365 8103 #, kde-format 8104 msgctxt "memory size in 2^80 bytes" 8105 msgid "%1 YB" 8106 msgstr "%1 YB" 8107 8108 #. i18n: Dumb message, avoid any markup or scripting. 8109 #: kdecore/klocale_kde.cpp:1371 8110 #, kde-format 8111 msgctxt "size in 1024 bytes" 8112 msgid "%1 KiB" 8113 msgstr "%1 KiB" 8114 8115 #. i18n: Dumb message, avoid any markup or scripting. 8116 #: kdecore/klocale_kde.cpp:1373 8117 #, kde-format 8118 msgctxt "size in 2^20 bytes" 8119 msgid "%1 MiB" 8120 msgstr "%1 MiB" 8121 8122 #. i18n: Dumb message, avoid any markup or scripting. 8123 #: kdecore/klocale_kde.cpp:1375 8124 #, kde-format 8125 msgctxt "size in 2^30 bytes" 8126 msgid "%1 GiB" 8127 msgstr "%1 GiB" 8128 8129 #. i18n: Dumb message, avoid any markup or scripting. 8130 #: kdecore/klocale_kde.cpp:1377 8131 #, kde-format 8132 msgctxt "size in 2^40 bytes" 8133 msgid "%1 TiB" 8134 msgstr "%1 TiB" 8135 8136 #. i18n: Dumb message, avoid any markup or scripting. 8137 #: kdecore/klocale_kde.cpp:1379 8138 #, kde-format 8139 msgctxt "size in 2^50 bytes" 8140 msgid "%1 PiB" 8141 msgstr "%1 PiB" 8142 8143 #. i18n: Dumb message, avoid any markup or scripting. 8144 #: kdecore/klocale_kde.cpp:1381 8145 #, kde-format 8146 msgctxt "size in 2^60 bytes" 8147 msgid "%1 EiB" 8148 msgstr "%1 EiB" 8149 8150 #. i18n: Dumb message, avoid any markup or scripting. 8151 #: kdecore/klocale_kde.cpp:1383 8152 #, kde-format 8153 msgctxt "size in 2^70 bytes" 8154 msgid "%1 ZiB" 8155 msgstr "%1 ZiB" 8156 8157 #. i18n: Dumb message, avoid any markup or scripting. 8158 #: kdecore/klocale_kde.cpp:1385 8159 #, kde-format 8160 msgctxt "size in 2^80 bytes" 8161 msgid "%1 YiB" 8162 msgstr "%1 YiB" 8163 8164 #: kdecore/klocale_kde.cpp:1472 8165 #, kde-format 8166 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8167 msgid "%1 days" 8168 msgstr "%1 दिन" 8169 8170 #: kdecore/klocale_kde.cpp:1475 8171 #, kde-format 8172 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8173 msgid "%1 hours" 8174 msgstr "%1 घंटा" 8175 8176 #: kdecore/klocale_kde.cpp:1478 8177 #, kde-format 8178 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8179 msgid "%1 minutes" 8180 msgstr "%1 मिनट" 8181 8182 #: kdecore/klocale_kde.cpp:1481 8183 #, kde-format 8184 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8185 msgid "%1 seconds" 8186 msgstr "%1 सकेंड" 8187 8188 #: kdecore/klocale_kde.cpp:1484 8189 #, kde-format 8190 msgctxt "@item:intext" 8191 msgid "%1 millisecond" 8192 msgid_plural "%1 milliseconds" 8193 msgstr[0] "" 8194 msgstr[1] "" 8195 8196 #: kdecore/klocale_kde.cpp:1491 8197 #, kde-format 8198 msgctxt "@item:intext" 8199 msgid "1 day" 8200 msgid_plural "%1 days" 8201 msgstr[0] "" 8202 msgstr[1] "" 8203 8204 #: kdecore/klocale_kde.cpp:1493 8205 #, kde-format 8206 msgctxt "@item:intext" 8207 msgid "1 hour" 8208 msgid_plural "%1 hours" 8209 msgstr[0] "" 8210 msgstr[1] "" 8211 8212 #: kdecore/klocale_kde.cpp:1495 8213 #, kde-format 8214 msgctxt "@item:intext" 8215 msgid "1 minute" 8216 msgid_plural "%1 minutes" 8217 msgstr[0] "" 8218 msgstr[1] "" 8219 8220 #: kdecore/klocale_kde.cpp:1497 8221 #, kde-format 8222 msgctxt "@item:intext" 8223 msgid "1 second" 8224 msgid_plural "%1 seconds" 8225 msgstr[0] "" 8226 msgstr[1] "" 8227 8228 #: kdecore/klocale_kde.cpp:1521 8229 #, kde-format 8230 msgctxt "" 8231 "@item:intext days and hours. This uses the previous item:intext messages. If " 8232 "this does not fit the grammar of your language please contact the i18n team " 8233 "to solve the problem" 8234 msgid "%1 and %2" 8235 msgstr "%1 आओर %2" 8236 8237 #: kdecore/klocale_kde.cpp:1527 8238 #, kde-format 8239 msgctxt "" 8240 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8241 "If this does not fit the grammar of your language please contact the i18n " 8242 "team to solve the problem" 8243 msgid "%1 and %2" 8244 msgstr "%1 आओर %2" 8245 8246 #: kdecore/klocale_kde.cpp:1534 8247 #, kde-format 8248 msgctxt "" 8249 "@item:intext minutes and seconds. This uses the previous item:intext " 8250 "messages. If this does not fit the grammar of your language please contact " 8251 "the i18n team to solve the problem" 8252 msgid "%1 and %2" 8253 msgstr "%1 आओर %2" 8254 8255 #: kdecore/klocale_kde.cpp:2153 8256 #, kde-format 8257 msgctxt "Before Noon KLocale::LongName" 8258 msgid "Ante Meridiem" 8259 msgstr "" 8260 8261 #: kdecore/klocale_kde.cpp:2154 8262 #, fuzzy, kde-format 8263 #| msgid "Av" 8264 msgctxt "Before Noon KLocale::ShortName" 8265 msgid "AM" 8266 msgstr "एव" 8267 8268 #: kdecore/klocale_kde.cpp:2155 8269 #, fuzzy, kde-format 8270 #| msgid "Av" 8271 msgctxt "Before Noon KLocale::NarrowName" 8272 msgid "A" 8273 msgstr "एव" 8274 8275 #: kdecore/klocale_kde.cpp:2158 8276 #, kde-format 8277 msgctxt "After Noon KLocale::LongName" 8278 msgid "Post Meridiem" 8279 msgstr "" 8280 8281 #: kdecore/klocale_kde.cpp:2159 8282 #, kde-format 8283 msgctxt "After Noon KLocale::ShortName" 8284 msgid "PM" 8285 msgstr "" 8286 8287 #: kdecore/klocale_kde.cpp:2160 8288 #, kde-format 8289 msgctxt "After Noon KLocale::NarrowName" 8290 msgid "P" 8291 msgstr "" 8292 8293 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8294 #, kde-format 8295 msgctxt "concatenation of dates and time" 8296 msgid "%1 %2" 8297 msgstr "%1 %2" 8298 8299 #: kdecore/klocale_kde.cpp:2267 8300 #, kde-format 8301 msgctxt "concatenation of date/time and time zone" 8302 msgid "%1 %2" 8303 msgstr "%1 %2" 8304 8305 #: kdecore/ksavefile.cpp:99 8306 #, kde-format 8307 msgid "No target filename has been given." 8308 msgstr "" 8309 8310 #: kdecore/ksavefile.cpp:106 8311 #, kde-format 8312 msgid "Already opened." 8313 msgstr "" 8314 8315 #: kdecore/ksavefile.cpp:135 8316 #, kde-format 8317 msgid "Insufficient permissions in target directory." 8318 msgstr "" 8319 8320 #: kdecore/ksavefile.cpp:139 8321 #, kde-format 8322 msgid "Unable to open temporary file." 8323 msgstr "" 8324 8325 #: kdecore/ksavefile.cpp:249 8326 #, kde-format 8327 msgid "Synchronization to disk failed" 8328 msgstr "" 8329 8330 #: kdecore/ksavefile.cpp:280 8331 #, kde-format 8332 msgid "Error during rename." 8333 msgstr "" 8334 8335 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8336 #, kde-format 8337 msgid "Timed out trying to connect to remote host" 8338 msgstr "रिमोट होस्ट सँ कनेक्ट हएबाक कोसिस मे टाइमआउट भ' गेल" 8339 8340 #: kdecore/netsupp.cpp:866 8341 #, kde-format 8342 msgid "address family for nodename not supported" 8343 msgstr "नोड नाम क' लेल एड्रेस फैमिली समर्थित नहि अछि" 8344 8345 #: kdecore/netsupp.cpp:868 8346 #, kde-format 8347 msgid "invalid value for 'ai_flags'" 8348 msgstr " 'ai_flags' क' लेल अवैध मान" 8349 8350 #: kdecore/netsupp.cpp:870 8351 #, kde-format 8352 msgid "'ai_family' not supported" 8353 msgstr "'ai_family' समर्थित नहि अछि" 8354 8355 #: kdecore/netsupp.cpp:872 8356 #, kde-format 8357 msgid "no address associated with nodename" 8358 msgstr "नोड नाम केर सँग कोनो पता संबद्ध नहि अछि" 8359 8360 #: kdecore/netsupp.cpp:874 8361 #, kde-format 8362 msgid "servname not supported for ai_socktype" 8363 msgstr "ai_socktype क' लेल सर्वनेम समर्थित नहि अछि" 8364 8365 #: kdecore/netsupp.cpp:875 8366 #, kde-format 8367 msgid "'ai_socktype' not supported" 8368 msgstr "'ai_socktype' समर्थित नहि अछि" 8369 8370 #: kdecore/netsupp.cpp:876 8371 #, kde-format 8372 msgid "system error" 8373 msgstr "तंत्र त्रुटि" 8374 8375 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8376 #, kde-format 8377 msgid "KDE Test Program" 8378 msgstr "केडीइ टेस्ट प्रोग्राम" 8379 8380 #: kdecore/TIMEZONES:1 8381 #, kde-format 8382 msgid "Africa/Abidjan" 8383 msgstr "अफ्रीका/अबीदियन" 8384 8385 #: kdecore/TIMEZONES:2 8386 #, kde-format 8387 msgid "Africa/Accra" 8388 msgstr "अफ्रीका/एक्रा" 8389 8390 #: kdecore/TIMEZONES:3 8391 #, kde-format 8392 msgid "Africa/Addis_Ababa" 8393 msgstr "अफ्रीका/अदिस_अबाबा" 8394 8395 #: kdecore/TIMEZONES:4 8396 #, kde-format 8397 msgid "Africa/Algiers" 8398 msgstr "अफ्रीका/अलगियर्स" 8399 8400 #: kdecore/TIMEZONES:5 8401 #, kde-format 8402 msgid "Africa/Asmara" 8403 msgstr "अफ्रीका/असमरा" 8404 8405 #: kdecore/TIMEZONES:6 8406 #, kde-format 8407 msgid "Africa/Asmera" 8408 msgstr "अफ्रीका/असमेरा" 8409 8410 #: kdecore/TIMEZONES:7 8411 #, kde-format 8412 msgid "Africa/Bamako" 8413 msgstr "अफ्रीका/बमाको" 8414 8415 #: kdecore/TIMEZONES:8 8416 #, kde-format 8417 msgid "Africa/Bangui" 8418 msgstr "अफ्रीका/बानगुइ" 8419 8420 #: kdecore/TIMEZONES:9 8421 #, kde-format 8422 msgid "Africa/Banjul" 8423 msgstr "अफ्रीका/बैनजुल" 8424 8425 #: kdecore/TIMEZONES:10 8426 #, kde-format 8427 msgid "Africa/Bissau" 8428 msgstr "अफ्रीका/बिसाउ" 8429 8430 #: kdecore/TIMEZONES:11 8431 #, kde-format 8432 msgid "Africa/Blantyre" 8433 msgstr "अफ्रीका/ब्लांटायर" 8434 8435 #: kdecore/TIMEZONES:12 8436 #, kde-format 8437 msgid "Africa/Brazzaville" 8438 msgstr "अफ्रीका/ब्राज़ावेल" 8439 8440 #: kdecore/TIMEZONES:13 8441 #, kde-format 8442 msgid "Africa/Bujumbura" 8443 msgstr "अफ्रीका/बुजुंबुरा" 8444 8445 #: kdecore/TIMEZONES:14 8446 #, kde-format 8447 msgid "Africa/Cairo" 8448 msgstr "अफ्रीका/कायरो" 8449 8450 #: kdecore/TIMEZONES:15 8451 #, kde-format 8452 msgid "Africa/Casablanca" 8453 msgstr "अफ्रीका/कैसबलंका" 8454 8455 #: kdecore/TIMEZONES:16 8456 #, kde-format 8457 msgid "Africa/Ceuta" 8458 msgstr "अफ्रीका/सेउटा" 8459 8460 #. i18n: comment to the previous timezone 8461 #: kdecore/TIMEZONES:18 8462 #, kde-format 8463 msgid "Ceuta & Melilla" 8464 msgstr "" 8465 8466 #. i18n: comment to the previous timezone 8467 #: kdecore/TIMEZONES:20 8468 #, kde-format 8469 msgid "Ceuta, Melilla" 8470 msgstr "" 8471 8472 #: kdecore/TIMEZONES:21 8473 #, kde-format 8474 msgid "Africa/Conakry" 8475 msgstr "अफ्रीका/कोनाक्री" 8476 8477 #: kdecore/TIMEZONES:22 8478 #, kde-format 8479 msgid "Africa/Dakar" 8480 msgstr "अफ्रीका/डकर" 8481 8482 #: kdecore/TIMEZONES:23 8483 #, kde-format 8484 msgid "Africa/Dar_es_Salaam" 8485 msgstr "अफ्रीका/डर_एस_सलाम" 8486 8487 #: kdecore/TIMEZONES:24 8488 #, kde-format 8489 msgid "Africa/Djibouti" 8490 msgstr "अफ्रीका/जिबोउटी" 8491 8492 #: kdecore/TIMEZONES:25 8493 #, kde-format 8494 msgid "Africa/Douala" 8495 msgstr "अफ्रीका/डॉउला" 8496 8497 #: kdecore/TIMEZONES:26 8498 #, kde-format 8499 msgid "Africa/El_Aaiun" 8500 msgstr "अफ्रीका/अल_आएउन" 8501 8502 #: kdecore/TIMEZONES:27 8503 #, kde-format 8504 msgid "Africa/Freetown" 8505 msgstr "अफ्रीका/फ्रीटाउन" 8506 8507 #: kdecore/TIMEZONES:28 8508 #, kde-format 8509 msgid "Africa/Gaborone" 8510 msgstr "अफ्रीका/गबोरोन" 8511 8512 #: kdecore/TIMEZONES:29 8513 #, kde-format 8514 msgid "Africa/Harare" 8515 msgstr "अफ्रीका/हरारे" 8516 8517 #: kdecore/TIMEZONES:30 8518 #, kde-format 8519 msgid "Africa/Johannesburg" 8520 msgstr "अफ्रीका/जॉनेसबर्ग" 8521 8522 #: kdecore/TIMEZONES:31 8523 #, fuzzy, kde-format 8524 #| msgid "Africa/Ceuta" 8525 msgid "Africa/Juba" 8526 msgstr "अफ्रीका/सेउटा" 8527 8528 #: kdecore/TIMEZONES:32 8529 #, kde-format 8530 msgid "Africa/Kampala" 8531 msgstr "अफ्रीका/कमपाला" 8532 8533 #: kdecore/TIMEZONES:33 8534 #, kde-format 8535 msgid "Africa/Khartoum" 8536 msgstr "अफ्रीका/खार्टोउम" 8537 8538 #: kdecore/TIMEZONES:34 8539 #, kde-format 8540 msgid "Africa/Kigali" 8541 msgstr "अफ्रीका/किगाली" 8542 8543 #: kdecore/TIMEZONES:35 8544 #, kde-format 8545 msgid "Africa/Kinshasa" 8546 msgstr "अफ्रीका/किंसहासा" 8547 8548 #. i18n: comment to the previous timezone 8549 #: kdecore/TIMEZONES:37 8550 #, kde-format 8551 msgid "west Dem. Rep. of Congo" 8552 msgstr "" 8553 8554 #. i18n: comment to the previous timezone 8555 #: kdecore/TIMEZONES:39 8556 #, kde-format 8557 msgid "Dem. Rep. of Congo (west)" 8558 msgstr "" 8559 8560 #: kdecore/TIMEZONES:40 8561 #, kde-format 8562 msgid "Africa/Lagos" 8563 msgstr "अफ्रीका/लागोस" 8564 8565 #: kdecore/TIMEZONES:41 8566 #, kde-format 8567 msgid "Africa/Libreville" 8568 msgstr "अफ्रीका/लिब्रेवेल" 8569 8570 #: kdecore/TIMEZONES:42 8571 #, kde-format 8572 msgid "Africa/Lome" 8573 msgstr "अफ्रीका/लोम" 8574 8575 #: kdecore/TIMEZONES:43 8576 #, kde-format 8577 msgid "Africa/Luanda" 8578 msgstr "अफ्रिका/लुआंडा" 8579 8580 #: kdecore/TIMEZONES:44 8581 #, kde-format 8582 msgid "Africa/Lubumbashi" 8583 msgstr "अफ्रीका/लुबुंबाशी" 8584 8585 #. i18n: comment to the previous timezone 8586 #: kdecore/TIMEZONES:46 8587 #, kde-format 8588 msgid "east Dem. Rep. of Congo" 8589 msgstr "" 8590 8591 #. i18n: comment to the previous timezone 8592 #: kdecore/TIMEZONES:48 8593 #, kde-format 8594 msgid "Dem. Rep. of Congo (east)" 8595 msgstr "" 8596 8597 #: kdecore/TIMEZONES:49 8598 #, kde-format 8599 msgid "Africa/Lusaka" 8600 msgstr "अफ्रीका/लुसाका" 8601 8602 #: kdecore/TIMEZONES:50 8603 #, kde-format 8604 msgid "Africa/Malabo" 8605 msgstr "अफ्रीका/मालाबो" 8606 8607 #: kdecore/TIMEZONES:51 8608 #, kde-format 8609 msgid "Africa/Maputo" 8610 msgstr "अफ्रीका/मपुटो" 8611 8612 #: kdecore/TIMEZONES:52 8613 #, kde-format 8614 msgid "Africa/Maseru" 8615 msgstr "अफ्रीका/मासेरु" 8616 8617 #: kdecore/TIMEZONES:53 8618 #, kde-format 8619 msgid "Africa/Mbabane" 8620 msgstr "अफ्रीका/बाबने" 8621 8622 #: kdecore/TIMEZONES:54 8623 #, kde-format 8624 msgid "Africa/Mogadishu" 8625 msgstr "अफ्रीका/मॉगाडिशु" 8626 8627 #: kdecore/TIMEZONES:55 8628 #, kde-format 8629 msgid "Africa/Monrovia" 8630 msgstr "अफ्रीका/मॉनरोविया" 8631 8632 #: kdecore/TIMEZONES:56 8633 #, kde-format 8634 msgid "Africa/Nairobi" 8635 msgstr "अफ्रीका/नारौबी" 8636 8637 #: kdecore/TIMEZONES:57 8638 #, kde-format 8639 msgid "Africa/Ndjamena" 8640 msgstr "अफ्रीका/जमीना" 8641 8642 #: kdecore/TIMEZONES:58 8643 #, kde-format 8644 msgid "Africa/Niamey" 8645 msgstr "अफ्रीका/नियमये" 8646 8647 #: kdecore/TIMEZONES:59 8648 #, kde-format 8649 msgid "Africa/Nouakchott" 8650 msgstr "अफ्रीका/नाउआकोट" 8651 8652 #: kdecore/TIMEZONES:60 8653 #, kde-format 8654 msgid "Africa/Ouagadougou" 8655 msgstr "अफ्रीका/ओयूगाडॉउगॉउ" 8656 8657 #: kdecore/TIMEZONES:61 8658 #, kde-format 8659 msgid "Africa/Porto-Novo" 8660 msgstr "अफ्रीका/पॉर्टो_नोवो" 8661 8662 #: kdecore/TIMEZONES:62 8663 #, fuzzy, kde-format 8664 #| msgid "Africa/Ceuta" 8665 msgid "Africa/Pretoria" 8666 msgstr "अफ्रीका/सेउटा" 8667 8668 #: kdecore/TIMEZONES:63 8669 #, kde-format 8670 msgid "Africa/Sao_Tome" 8671 msgstr "अफ्रीका/साओ_टोम" 8672 8673 #: kdecore/TIMEZONES:64 8674 #, kde-format 8675 msgid "Africa/Timbuktu" 8676 msgstr "अफ्रीका/टिम्बुक्टू" 8677 8678 #: kdecore/TIMEZONES:65 8679 #, kde-format 8680 msgid "Africa/Tripoli" 8681 msgstr "अफ्रीका/ट्रिपोली" 8682 8683 #: kdecore/TIMEZONES:66 8684 #, kde-format 8685 msgid "Africa/Tunis" 8686 msgstr "अफ्रीका/तुनिस" 8687 8688 #: kdecore/TIMEZONES:67 8689 #, kde-format 8690 msgid "Africa/Windhoek" 8691 msgstr "अफ्रीका/विंडहोक" 8692 8693 #: kdecore/TIMEZONES:68 8694 #, kde-format 8695 msgid "America/Adak" 8696 msgstr "अमेरिका/अडाक" 8697 8698 #. i18n: comment to the previous timezone 8699 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8700 #, kde-format 8701 msgid "Aleutian Islands" 8702 msgstr "" 8703 8704 #: kdecore/TIMEZONES:71 8705 #, kde-format 8706 msgid "America/Anchorage" 8707 msgstr "अमेरिका/एंकोरेज" 8708 8709 #. i18n: comment to the previous timezone 8710 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8711 #, kde-format 8712 msgid "Alaska Time" 8713 msgstr "" 8714 8715 #. i18n: comment to the previous timezone 8716 #: kdecore/TIMEZONES:75 8717 #, kde-format 8718 msgid "Alaska (most areas)" 8719 msgstr "" 8720 8721 #: kdecore/TIMEZONES:76 8722 #, kde-format 8723 msgid "America/Anguilla" 8724 msgstr "अमेरिका/एंगुला" 8725 8726 #: kdecore/TIMEZONES:77 8727 #, kde-format 8728 msgid "America/Antigua" 8729 msgstr "अमेरिका/एंटिगुआ" 8730 8731 #: kdecore/TIMEZONES:78 8732 #, kde-format 8733 msgid "America/Araguaina" 8734 msgstr "अमेरिका/अरगुयेना" 8735 8736 #. i18n: comment to the previous timezone 8737 #: kdecore/TIMEZONES:80 8738 #, kde-format 8739 msgid "Tocantins" 8740 msgstr "" 8741 8742 #: kdecore/TIMEZONES:81 8743 #, kde-format 8744 msgid "America/Argentina/Buenos_Aires" 8745 msgstr "अमेरिका/अरजेटीना/बुएनॉस_एरिस" 8746 8747 #. i18n: comment to the previous timezone 8748 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8749 #, kde-format 8750 msgid "Buenos Aires (BA, CF)" 8751 msgstr "" 8752 8753 #: kdecore/TIMEZONES:84 8754 #, kde-format 8755 msgid "America/Argentina/Catamarca" 8756 msgstr "अमेरिका/अरजेटीना/कैटामारका" 8757 8758 #. i18n: comment to the previous timezone 8759 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8760 #, kde-format 8761 msgid "Catamarca (CT), Chubut (CH)" 8762 msgstr "" 8763 8764 #. i18n: comment to the previous timezone 8765 #: kdecore/TIMEZONES:88 8766 #, kde-format 8767 msgid "Catamarca (CT); Chubut (CH)" 8768 msgstr "" 8769 8770 #: kdecore/TIMEZONES:89 8771 #, kde-format 8772 msgid "America/Argentina/ComodRivadavia" 8773 msgstr "अमेरिका/अरजेटीना/कोमोडरिवाडाविया" 8774 8775 #: kdecore/TIMEZONES:92 8776 #, kde-format 8777 msgid "America/Argentina/Cordoba" 8778 msgstr "अमेरिका/अरजेटीना/कॉर्डोबा" 8779 8780 #. i18n: comment to the previous timezone 8781 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8782 #, kde-format 8783 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8784 msgstr "" 8785 8786 #. i18n: comment to the previous timezone 8787 #: kdecore/TIMEZONES:96 8788 #, kde-format 8789 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8790 msgstr "" 8791 8792 #. i18n: comment to the previous timezone 8793 #: kdecore/TIMEZONES:98 8794 #, kde-format 8795 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8796 msgstr "" 8797 8798 #: kdecore/TIMEZONES:99 8799 #, kde-format 8800 msgid "America/Argentina/Jujuy" 8801 msgstr "अमेरिका/अरजेटीना/जुजुई" 8802 8803 #. i18n: comment to the previous timezone 8804 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8805 #, kde-format 8806 msgid "Jujuy (JY)" 8807 msgstr "" 8808 8809 #: kdecore/TIMEZONES:102 8810 #, kde-format 8811 msgid "America/Argentina/La_Rioja" 8812 msgstr "अमेरिका/अरजेटीना/ला_रियोहा" 8813 8814 #. i18n: comment to the previous timezone 8815 #: kdecore/TIMEZONES:104 8816 #, kde-format 8817 msgid "La Rioja (LR)" 8818 msgstr "" 8819 8820 #: kdecore/TIMEZONES:105 8821 #, kde-format 8822 msgid "America/Argentina/Mendoza" 8823 msgstr "अमेरिका/अरजेटीना/मेंडोज़ा" 8824 8825 #. i18n: comment to the previous timezone 8826 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8827 #, kde-format 8828 msgid "Mendoza (MZ)" 8829 msgstr "" 8830 8831 #: kdecore/TIMEZONES:108 8832 #, kde-format 8833 msgid "America/Argentina/Rio_Gallegos" 8834 msgstr "अमेरिका/अरजेटीना/रियो_गेल्लेगोस" 8835 8836 #. i18n: comment to the previous timezone 8837 #: kdecore/TIMEZONES:110 8838 #, kde-format 8839 msgid "Santa Cruz (SC)" 8840 msgstr "" 8841 8842 #: kdecore/TIMEZONES:111 8843 #, fuzzy, kde-format 8844 #| msgid "America/Argentina/San_Juan" 8845 msgid "America/Argentina/Salta" 8846 msgstr "अमेरिका/अरजेटीना/सां_जुआँ" 8847 8848 #. i18n: comment to the previous timezone 8849 #: kdecore/TIMEZONES:113 8850 #, kde-format 8851 msgid "(SA, LP, NQ, RN)" 8852 msgstr "" 8853 8854 #. i18n: comment to the previous timezone 8855 #: kdecore/TIMEZONES:115 8856 #, kde-format 8857 msgid "Salta (SA, LP, NQ, RN)" 8858 msgstr "" 8859 8860 #: kdecore/TIMEZONES:116 8861 #, kde-format 8862 msgid "America/Argentina/San_Juan" 8863 msgstr "अमेरिका/अरजेटीना/सां_जुआँ" 8864 8865 #. i18n: comment to the previous timezone 8866 #: kdecore/TIMEZONES:118 8867 #, kde-format 8868 msgid "San Juan (SJ)" 8869 msgstr "" 8870 8871 #: kdecore/TIMEZONES:119 8872 #, fuzzy, kde-format 8873 #| msgid "America/Argentina/San_Juan" 8874 msgid "America/Argentina/San_Luis" 8875 msgstr "अमेरिका/अरजेटीना/सां_जुआँ" 8876 8877 #. i18n: comment to the previous timezone 8878 #: kdecore/TIMEZONES:121 8879 #, kde-format 8880 msgid "San Luis (SL)" 8881 msgstr "" 8882 8883 #: kdecore/TIMEZONES:122 8884 #, kde-format 8885 msgid "America/Argentina/Tucuman" 8886 msgstr "अमेरिका/अरजेटीना/टुकुमन" 8887 8888 #. i18n: comment to the previous timezone 8889 #: kdecore/TIMEZONES:124 8890 #, kde-format 8891 msgid "Tucuman (TM)" 8892 msgstr "" 8893 8894 #: kdecore/TIMEZONES:125 8895 #, kde-format 8896 msgid "America/Argentina/Ushuaia" 8897 msgstr "अमेरिका/अरजेटीना/युशुइया" 8898 8899 #. i18n: comment to the previous timezone 8900 #: kdecore/TIMEZONES:127 8901 #, kde-format 8902 msgid "Tierra del Fuego (TF)" 8903 msgstr "" 8904 8905 #: kdecore/TIMEZONES:128 8906 #, kde-format 8907 msgid "America/Aruba" 8908 msgstr "अमेरिका/अरुबा" 8909 8910 #: kdecore/TIMEZONES:129 8911 #, kde-format 8912 msgid "America/Asuncion" 8913 msgstr "अमेरिका/असुनसन" 8914 8915 #: kdecore/TIMEZONES:130 8916 #, kde-format 8917 msgid "America/Atikokan" 8918 msgstr "अमेरिका/एटिकोकन" 8919 8920 #. i18n: comment to the previous timezone 8921 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8922 #, kde-format 8923 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8924 msgstr "" 8925 8926 #. i18n: comment to the previous timezone 8927 #: kdecore/TIMEZONES:134 8928 #, kde-format 8929 msgid "EST - ON (Atikokan); NU (Coral H)" 8930 msgstr "" 8931 8932 #: kdecore/TIMEZONES:135 8933 #, fuzzy, kde-format 8934 #| msgid "America/Atikokan" 8935 msgid "America/Atka" 8936 msgstr "अमेरिका/एटिकोकन" 8937 8938 #: kdecore/TIMEZONES:138 8939 #, kde-format 8940 msgid "America/Bahia" 8941 msgstr "अमेरिका/बाहिया" 8942 8943 #. i18n: comment to the previous timezone 8944 #: kdecore/TIMEZONES:140 8945 #, kde-format 8946 msgid "Bahia" 8947 msgstr "" 8948 8949 #: kdecore/TIMEZONES:141 8950 #, fuzzy, kde-format 8951 #| msgid "America/Bahia" 8952 msgid "America/Bahia_Banderas" 8953 msgstr "अमेरिका/बाहिया" 8954 8955 #. i18n: comment to the previous timezone 8956 #: kdecore/TIMEZONES:143 8957 #, kde-format 8958 msgid "Mexican Central Time - Bahia de Banderas" 8959 msgstr "" 8960 8961 #. i18n: comment to the previous timezone 8962 #: kdecore/TIMEZONES:145 8963 #, kde-format 8964 msgid "Central Time - Bahia de Banderas" 8965 msgstr "" 8966 8967 #: kdecore/TIMEZONES:146 8968 #, kde-format 8969 msgid "America/Barbados" 8970 msgstr "अमेरिका/बारबेडोस" 8971 8972 #: kdecore/TIMEZONES:147 8973 #, kde-format 8974 msgid "America/Belem" 8975 msgstr "अमेरिका/बेलेम" 8976 8977 #. i18n: comment to the previous timezone 8978 #: kdecore/TIMEZONES:149 8979 #, kde-format 8980 msgid "Amapa, E Para" 8981 msgstr "" 8982 8983 #. i18n: comment to the previous timezone 8984 #: kdecore/TIMEZONES:151 8985 #, kde-format 8986 msgid "Para (east); Amapa" 8987 msgstr "" 8988 8989 #: kdecore/TIMEZONES:152 8990 #, kde-format 8991 msgid "America/Belize" 8992 msgstr "अमेरिका/बेलाइज" 8993 8994 #: kdecore/TIMEZONES:153 8995 #, kde-format 8996 msgid "America/Blanc-Sablon" 8997 msgstr "अमेरिका/ब्लैंक-सैब्लान" 8998 8999 #. i18n: comment to the previous timezone 9000 #: kdecore/TIMEZONES:155 9001 #, kde-format 9002 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9003 msgstr "" 9004 9005 #. i18n: comment to the previous timezone 9006 #: kdecore/TIMEZONES:157 9007 #, kde-format 9008 msgid "AST - QC (Lower North Shore)" 9009 msgstr "" 9010 9011 #: kdecore/TIMEZONES:158 9012 #, kde-format 9013 msgid "America/Boa_Vista" 9014 msgstr "अमेरिका/बोआ_विस्टा" 9015 9016 #. i18n: comment to the previous timezone 9017 #: kdecore/TIMEZONES:160 9018 #, kde-format 9019 msgid "Roraima" 9020 msgstr "" 9021 9022 #: kdecore/TIMEZONES:161 9023 #, kde-format 9024 msgid "America/Bogota" 9025 msgstr "अमेरिका/बोगोटा" 9026 9027 #: kdecore/TIMEZONES:162 9028 #, kde-format 9029 msgid "America/Boise" 9030 msgstr "अमेरिका/बोइज" 9031 9032 #. i18n: comment to the previous timezone 9033 #: kdecore/TIMEZONES:164 9034 #, kde-format 9035 msgid "Mountain Time - south Idaho & east Oregon" 9036 msgstr "" 9037 9038 #. i18n: comment to the previous timezone 9039 #: kdecore/TIMEZONES:166 9040 #, kde-format 9041 msgid "Mountain - ID (south); OR (east)" 9042 msgstr "" 9043 9044 #: kdecore/TIMEZONES:167 9045 #, kde-format 9046 msgid "America/Buenos_Aires" 9047 msgstr "अमेरिका/बुएनॉस_एरिस" 9048 9049 #: kdecore/TIMEZONES:170 9050 #, fuzzy, kde-format 9051 #| msgid "America/Cayman" 9052 msgid "America/Calgary" 9053 msgstr "अमेरिका/केमान" 9054 9055 #. i18n: comment to the previous timezone 9056 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9057 #, kde-format 9058 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9059 msgstr "" 9060 9061 #: kdecore/TIMEZONES:173 9062 #, kde-format 9063 msgid "America/Cambridge_Bay" 9064 msgstr "अमेरिका/कैमब्रिज_बे" 9065 9066 #. i18n: comment to the previous timezone 9067 #: kdecore/TIMEZONES:175 9068 #, kde-format 9069 msgid "Mountain Time - west Nunavut" 9070 msgstr "" 9071 9072 #. i18n: comment to the previous timezone 9073 #: kdecore/TIMEZONES:177 9074 #, kde-format 9075 msgid "Mountain - NU (west)" 9076 msgstr "" 9077 9078 #: kdecore/TIMEZONES:178 9079 #, kde-format 9080 msgid "America/Campo_Grande" 9081 msgstr "अमेरिका/केम्पो_ग्रान्दे" 9082 9083 #. i18n: comment to the previous timezone 9084 #: kdecore/TIMEZONES:180 9085 #, kde-format 9086 msgid "Mato Grosso do Sul" 9087 msgstr "" 9088 9089 #: kdecore/TIMEZONES:181 9090 #, kde-format 9091 msgid "America/Cancun" 9092 msgstr "अमेरिका/कैनकुन" 9093 9094 #. i18n: comment to the previous timezone 9095 #: kdecore/TIMEZONES:183 9096 #, kde-format 9097 msgid "Central Time - Quintana Roo" 9098 msgstr "" 9099 9100 #. i18n: comment to the previous timezone 9101 #: kdecore/TIMEZONES:185 9102 #, kde-format 9103 msgid "Eastern Standard Time - Quintana Roo" 9104 msgstr "" 9105 9106 #: kdecore/TIMEZONES:186 9107 #, kde-format 9108 msgid "America/Caracas" 9109 msgstr "अमेरिका/कराकस" 9110 9111 #: kdecore/TIMEZONES:187 9112 #, kde-format 9113 msgid "America/Catamarca" 9114 msgstr "अमेरिका/कैटामारका" 9115 9116 #: kdecore/TIMEZONES:190 9117 #, kde-format 9118 msgid "America/Cayenne" 9119 msgstr "अमेरिका/सायेने" 9120 9121 #: kdecore/TIMEZONES:191 9122 #, kde-format 9123 msgid "America/Cayman" 9124 msgstr "अमेरिका/केमान" 9125 9126 #: kdecore/TIMEZONES:192 9127 #, kde-format 9128 msgid "America/Chicago" 9129 msgstr "अमेरिका/शिकागो" 9130 9131 #. i18n: comment to the previous timezone 9132 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9133 #, kde-format 9134 msgid "Central Time" 9135 msgstr "" 9136 9137 #. i18n: comment to the previous timezone 9138 #: kdecore/TIMEZONES:196 9139 #, kde-format 9140 msgid "Central (most areas)" 9141 msgstr "" 9142 9143 #: kdecore/TIMEZONES:197 9144 #, kde-format 9145 msgid "America/Chihuahua" 9146 msgstr "अमेरिका/चिहुआहुआ" 9147 9148 #. i18n: comment to the previous timezone 9149 #: kdecore/TIMEZONES:199 9150 #, kde-format 9151 msgid "Mountain Time - Chihuahua" 9152 msgstr "" 9153 9154 #. i18n: comment to the previous timezone 9155 #: kdecore/TIMEZONES:201 9156 #, kde-format 9157 msgid "Mexican Mountain Time - Chihuahua away from US border" 9158 msgstr "" 9159 9160 #. i18n: comment to the previous timezone 9161 #: kdecore/TIMEZONES:203 9162 #, kde-format 9163 msgid "Mountain Time - Chihuahua (most areas)" 9164 msgstr "" 9165 9166 #: kdecore/TIMEZONES:204 9167 #, fuzzy, kde-format 9168 #| msgid "America/Curacao" 9169 msgid "America/Coral_Harbour" 9170 msgstr "अमेरिका/कुराकाओ" 9171 9172 #: kdecore/TIMEZONES:207 9173 #, kde-format 9174 msgid "America/Cordoba" 9175 msgstr "अमेरिका/कॉर्डोबा" 9176 9177 #: kdecore/TIMEZONES:210 9178 #, kde-format 9179 msgid "America/Costa_Rica" 9180 msgstr "अमेरिका/कोस्टा_रिका" 9181 9182 #: kdecore/TIMEZONES:211 9183 #, fuzzy, kde-format 9184 #| msgid "Africa/Freetown" 9185 msgid "America/Creston" 9186 msgstr "अफ्रीका/फ्रीटाउन" 9187 9188 #. i18n: comment to the previous timezone 9189 #: kdecore/TIMEZONES:213 9190 #, kde-format 9191 msgid "Mountain Standard Time - Creston, British Columbia" 9192 msgstr "" 9193 9194 #. i18n: comment to the previous timezone 9195 #: kdecore/TIMEZONES:215 9196 #, kde-format 9197 msgid "MST - BC (Creston)" 9198 msgstr "" 9199 9200 #: kdecore/TIMEZONES:216 9201 #, kde-format 9202 msgid "America/Cuiaba" 9203 msgstr "अमेरिका/कुएबा" 9204 9205 #. i18n: comment to the previous timezone 9206 #: kdecore/TIMEZONES:218 9207 #, kde-format 9208 msgid "Mato Grosso" 9209 msgstr "" 9210 9211 #: kdecore/TIMEZONES:219 9212 #, kde-format 9213 msgid "America/Curacao" 9214 msgstr "अमेरिका/कुराकाओ" 9215 9216 #: kdecore/TIMEZONES:220 9217 #, kde-format 9218 msgid "America/Danmarkshavn" 9219 msgstr "अमेरिका/डेनमार्कशावन" 9220 9221 #. i18n: comment to the previous timezone 9222 #: kdecore/TIMEZONES:222 9223 #, kde-format 9224 msgid "east coast, north of Scoresbysund" 9225 msgstr "" 9226 9227 #. i18n: comment to the previous timezone 9228 #: kdecore/TIMEZONES:224 9229 #, kde-format 9230 msgid "National Park (east coast)" 9231 msgstr "" 9232 9233 #: kdecore/TIMEZONES:225 9234 #, kde-format 9235 msgid "America/Dawson" 9236 msgstr "अमेरिका/डॉसन" 9237 9238 #. i18n: comment to the previous timezone 9239 #: kdecore/TIMEZONES:227 9240 #, kde-format 9241 msgid "Pacific Time - north Yukon" 9242 msgstr "" 9243 9244 #. i18n: comment to the previous timezone 9245 #: kdecore/TIMEZONES:229 9246 #, kde-format 9247 msgid "MST - Yukon (west)" 9248 msgstr "" 9249 9250 #: kdecore/TIMEZONES:230 9251 #, kde-format 9252 msgid "America/Dawson_Creek" 9253 msgstr "अमेरिका/डॉसन_क्रिक" 9254 9255 #. i18n: comment to the previous timezone 9256 #: kdecore/TIMEZONES:232 9257 #, kde-format 9258 msgid "" 9259 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9260 msgstr "" 9261 9262 #. i18n: comment to the previous timezone 9263 #: kdecore/TIMEZONES:234 9264 #, kde-format 9265 msgid "MST - BC (Dawson Cr, Ft St John)" 9266 msgstr "" 9267 9268 #: kdecore/TIMEZONES:235 9269 #, kde-format 9270 msgid "America/Denver" 9271 msgstr "अमेरिका/डेनवर" 9272 9273 #. i18n: comment to the previous timezone 9274 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9275 #, kde-format 9276 msgid "Mountain Time" 9277 msgstr "" 9278 9279 #. i18n: comment to the previous timezone 9280 #: kdecore/TIMEZONES:239 9281 #, kde-format 9282 msgid "Mountain (most areas)" 9283 msgstr "" 9284 9285 #: kdecore/TIMEZONES:240 9286 #, kde-format 9287 msgid "America/Detroit" 9288 msgstr "अमेरिका/डैट्रिरॉइट" 9289 9290 #. i18n: comment to the previous timezone 9291 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9292 #, kde-format 9293 msgid "Eastern Time - Michigan - most locations" 9294 msgstr "" 9295 9296 #. i18n: comment to the previous timezone 9297 #: kdecore/TIMEZONES:244 9298 #, kde-format 9299 msgid "Eastern - MI (most areas)" 9300 msgstr "" 9301 9302 #: kdecore/TIMEZONES:245 9303 #, kde-format 9304 msgid "America/Dominica" 9305 msgstr "अमेरिका/डोमिनिका" 9306 9307 #: kdecore/TIMEZONES:246 9308 #, kde-format 9309 msgid "America/Edmonton" 9310 msgstr "अमेरिका/इडमॉनटॉन" 9311 9312 #. i18n: comment to the previous timezone 9313 #: kdecore/TIMEZONES:250 9314 #, kde-format 9315 msgid "Mountain - AB; BC (E); SK (W)" 9316 msgstr "" 9317 9318 #: kdecore/TIMEZONES:251 9319 #, kde-format 9320 msgid "America/Eirunepe" 9321 msgstr "अमेरिका/एयरुनपे" 9322 9323 #. i18n: comment to the previous timezone 9324 #: kdecore/TIMEZONES:253 9325 #, kde-format 9326 msgid "W Amazonas" 9327 msgstr "" 9328 9329 #. i18n: comment to the previous timezone 9330 #: kdecore/TIMEZONES:255 9331 #, kde-format 9332 msgid "Amazonas (west)" 9333 msgstr "" 9334 9335 #: kdecore/TIMEZONES:256 9336 #, kde-format 9337 msgid "America/El_Salvador" 9338 msgstr "अमेरिका/एल_सलवाडोर" 9339 9340 #: kdecore/TIMEZONES:257 9341 #, fuzzy, kde-format 9342 #| msgid "America/Grenada" 9343 msgid "America/Ensenada" 9344 msgstr "अमेरिका/ग्रेनडा" 9345 9346 #. i18n: comment to the previous timezone 9347 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9348 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9349 #, fuzzy, kde-format 9350 #| msgid "Pacific/Niue" 9351 msgid "Pacific Time" 9352 msgstr "प्रशांत/निउ" 9353 9354 #: kdecore/TIMEZONES:260 9355 #, fuzzy, kde-format 9356 #| msgid "America/Porto_Velho" 9357 msgid "America/Fort_Nelson" 9358 msgstr "अमेरिका/पॉर्टो_वेलहो" 9359 9360 #. i18n: comment to the previous timezone 9361 #: kdecore/TIMEZONES:262 9362 #, kde-format 9363 msgid "MST - BC (Ft Nelson)" 9364 msgstr "" 9365 9366 #: kdecore/TIMEZONES:263 9367 #, fuzzy, kde-format 9368 #| msgid "America/Fortaleza" 9369 msgid "America/Fort_Wayne" 9370 msgstr "अमेरिका/फॉर्टलेज़ा" 9371 9372 #. i18n: comment to the previous timezone 9373 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9374 #: kdecore/TIMEZONES:1419 9375 #, kde-format 9376 msgid "Eastern Time - Indiana - most locations" 9377 msgstr "" 9378 9379 #: kdecore/TIMEZONES:266 9380 #, kde-format 9381 msgid "America/Fortaleza" 9382 msgstr "अमेरिका/फॉर्टलेज़ा" 9383 9384 #. i18n: comment to the previous timezone 9385 #: kdecore/TIMEZONES:268 9386 #, kde-format 9387 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9388 msgstr "" 9389 9390 #. i18n: comment to the previous timezone 9391 #: kdecore/TIMEZONES:270 9392 #, kde-format 9393 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9394 msgstr "" 9395 9396 #: kdecore/TIMEZONES:271 9397 #, fuzzy, kde-format 9398 #| msgid "Africa/Freetown" 9399 msgid "America/Fredericton" 9400 msgstr "अफ्रीका/फ्रीटाउन" 9401 9402 #. i18n: comment to the previous timezone 9403 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9404 #, kde-format 9405 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9406 msgstr "" 9407 9408 #: kdecore/TIMEZONES:274 9409 #, kde-format 9410 msgid "America/Glace_Bay" 9411 msgstr "अमेरिका/ग्लेस_बे" 9412 9413 #. i18n: comment to the previous timezone 9414 #: kdecore/TIMEZONES:276 9415 #, kde-format 9416 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9417 msgstr "" 9418 9419 #. i18n: comment to the previous timezone 9420 #: kdecore/TIMEZONES:278 9421 #, fuzzy, kde-format 9422 #| msgid "Atlantic/Cape_Verde" 9423 msgid "Atlantic - NS (Cape Breton)" 9424 msgstr "अमेरिका/केप_वर्डे" 9425 9426 #: kdecore/TIMEZONES:279 9427 #, kde-format 9428 msgid "America/Godthab" 9429 msgstr "अमेरिका/गॉडथब" 9430 9431 #. i18n: comment to the previous timezone 9432 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9433 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9434 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9435 #: kdecore/TIMEZONES:1350 9436 #, kde-format 9437 msgid "most locations" 9438 msgstr "" 9439 9440 #: kdecore/TIMEZONES:282 9441 #, kde-format 9442 msgid "America/Goose_Bay" 9443 msgstr "अमेरिका/गूज_बे" 9444 9445 #. i18n: comment to the previous timezone 9446 #: kdecore/TIMEZONES:284 9447 #, kde-format 9448 msgid "Atlantic Time - Labrador - most locations" 9449 msgstr "" 9450 9451 #. i18n: comment to the previous timezone 9452 #: kdecore/TIMEZONES:286 9453 #, kde-format 9454 msgid "Atlantic - Labrador (most areas)" 9455 msgstr "" 9456 9457 #: kdecore/TIMEZONES:287 9458 #, kde-format 9459 msgid "America/Grand_Turk" 9460 msgstr "अमेरिका/ग्रैंड_तुर्क" 9461 9462 #: kdecore/TIMEZONES:288 9463 #, kde-format 9464 msgid "America/Grenada" 9465 msgstr "अमेरिका/ग्रेनडा" 9466 9467 #: kdecore/TIMEZONES:289 9468 #, kde-format 9469 msgid "America/Guadeloupe" 9470 msgstr "अमेरिका/गुआडेलोउप" 9471 9472 #: kdecore/TIMEZONES:290 9473 #, kde-format 9474 msgid "America/Guatemala" 9475 msgstr "अमेरिका/गुआटेमाला" 9476 9477 #: kdecore/TIMEZONES:291 9478 #, kde-format 9479 msgid "America/Guayaquil" 9480 msgstr "अमेरिका/गुआयाक़्युल" 9481 9482 #. i18n: comment to the previous timezone 9483 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9484 #: kdecore/TIMEZONES:1400 9485 #, kde-format 9486 msgid "mainland" 9487 msgstr "" 9488 9489 #. i18n: comment to the previous timezone 9490 #: kdecore/TIMEZONES:295 9491 #, kde-format 9492 msgid "Ecuador (mainland)" 9493 msgstr "" 9494 9495 #: kdecore/TIMEZONES:296 9496 #, kde-format 9497 msgid "America/Guyana" 9498 msgstr "अमेरिका/गुयाना" 9499 9500 #: kdecore/TIMEZONES:297 9501 #, kde-format 9502 msgid "America/Halifax" 9503 msgstr "अमेरिका/हैलीफ़ैक्स" 9504 9505 #. i18n: comment to the previous timezone 9506 #: kdecore/TIMEZONES:301 9507 #, kde-format 9508 msgid "Atlantic - NS (most areas); PE" 9509 msgstr "" 9510 9511 #: kdecore/TIMEZONES:302 9512 #, kde-format 9513 msgid "America/Havana" 9514 msgstr "अमेरिका/हवाना" 9515 9516 #: kdecore/TIMEZONES:303 9517 #, kde-format 9518 msgid "America/Hermosillo" 9519 msgstr "अमेरिका/हरमॉसिलो" 9520 9521 #. i18n: comment to the previous timezone 9522 #: kdecore/TIMEZONES:305 9523 #, kde-format 9524 msgid "Mountain Standard Time - Sonora" 9525 msgstr "" 9526 9527 #: kdecore/TIMEZONES:306 9528 #, kde-format 9529 msgid "America/Indiana/Indianapolis" 9530 msgstr "अमेरिका/इंडियना/इंडियानापालिस" 9531 9532 #. i18n: comment to the previous timezone 9533 #: kdecore/TIMEZONES:310 9534 #, kde-format 9535 msgid "Eastern - IN (most areas)" 9536 msgstr "" 9537 9538 #: kdecore/TIMEZONES:311 9539 #, kde-format 9540 msgid "America/Indiana/Knox" 9541 msgstr "अमेरिका/इंडियाना/नॉक्स" 9542 9543 #. i18n: comment to the previous timezone 9544 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9545 #, kde-format 9546 msgid "Eastern Time - Indiana - Starke County" 9547 msgstr "" 9548 9549 #. i18n: comment to the previous timezone 9550 #: kdecore/TIMEZONES:315 9551 #, kde-format 9552 msgid "Central Time - Indiana - Starke County" 9553 msgstr "" 9554 9555 #. i18n: comment to the previous timezone 9556 #: kdecore/TIMEZONES:317 9557 #, kde-format 9558 msgid "Central - IN (Starke)" 9559 msgstr "" 9560 9561 #: kdecore/TIMEZONES:318 9562 #, kde-format 9563 msgid "America/Indiana/Marengo" 9564 msgstr "अमेरिका/इंडियाना/मारेंगो" 9565 9566 #. i18n: comment to the previous timezone 9567 #: kdecore/TIMEZONES:320 9568 #, kde-format 9569 msgid "Eastern Time - Indiana - Crawford County" 9570 msgstr "" 9571 9572 #. i18n: comment to the previous timezone 9573 #: kdecore/TIMEZONES:322 9574 #, kde-format 9575 msgid "Eastern - IN (Crawford)" 9576 msgstr "" 9577 9578 #: kdecore/TIMEZONES:323 9579 #, kde-format 9580 msgid "America/Indiana/Petersburg" 9581 msgstr "अमेरिका/इंडियाना/पीट्सवर्ग" 9582 9583 #. i18n: comment to the previous timezone 9584 #: kdecore/TIMEZONES:325 9585 #, kde-format 9586 msgid "Central Time - Indiana - Pike County" 9587 msgstr "" 9588 9589 #. i18n: comment to the previous timezone 9590 #: kdecore/TIMEZONES:327 9591 #, kde-format 9592 msgid "Eastern Time - Indiana - Pike County" 9593 msgstr "" 9594 9595 #. i18n: comment to the previous timezone 9596 #: kdecore/TIMEZONES:329 9597 #, kde-format 9598 msgid "Eastern - IN (Pike)" 9599 msgstr "" 9600 9601 #: kdecore/TIMEZONES:330 9602 #, kde-format 9603 msgid "America/Indiana/Tell_City" 9604 msgstr "अमेरिका/इंडियाना/टेल_सिटी" 9605 9606 #. i18n: comment to the previous timezone 9607 #: kdecore/TIMEZONES:332 9608 #, kde-format 9609 msgid "Central Time - Indiana - Perry County" 9610 msgstr "" 9611 9612 #. i18n: comment to the previous timezone 9613 #: kdecore/TIMEZONES:334 9614 #, kde-format 9615 msgid "Central - IN (Perry)" 9616 msgstr "" 9617 9618 #: kdecore/TIMEZONES:335 9619 #, kde-format 9620 msgid "America/Indiana/Vevay" 9621 msgstr "अमेरिका/इंडियाना/वेवेय" 9622 9623 #. i18n: comment to the previous timezone 9624 #: kdecore/TIMEZONES:337 9625 #, kde-format 9626 msgid "Eastern Time - Indiana - Switzerland County" 9627 msgstr "" 9628 9629 #. i18n: comment to the previous timezone 9630 #: kdecore/TIMEZONES:339 9631 #, kde-format 9632 msgid "Eastern - IN (Switzerland)" 9633 msgstr "" 9634 9635 #: kdecore/TIMEZONES:340 9636 #, kde-format 9637 msgid "America/Indiana/Vincennes" 9638 msgstr "अमेरिका/इंडियाना/विसेंस" 9639 9640 #. i18n: comment to the previous timezone 9641 #: kdecore/TIMEZONES:342 9642 #, kde-format 9643 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9644 msgstr "" 9645 9646 #. i18n: comment to the previous timezone 9647 #: kdecore/TIMEZONES:344 9648 #, kde-format 9649 msgid "Eastern - IN (Da, Du, K, Mn)" 9650 msgstr "" 9651 9652 #: kdecore/TIMEZONES:345 9653 #, kde-format 9654 msgid "America/Indiana/Winamac" 9655 msgstr "अमेरिका/इंडियाना/विनैमाक" 9656 9657 #. i18n: comment to the previous timezone 9658 #: kdecore/TIMEZONES:347 9659 #, kde-format 9660 msgid "Eastern Time - Indiana - Pulaski County" 9661 msgstr "" 9662 9663 #. i18n: comment to the previous timezone 9664 #: kdecore/TIMEZONES:349 9665 #, kde-format 9666 msgid "Eastern - IN (Pulaski)" 9667 msgstr "" 9668 9669 #: kdecore/TIMEZONES:350 9670 #, kde-format 9671 msgid "America/Indianapolis" 9672 msgstr "अमेरिका/इंडियापॉलिस" 9673 9674 #: kdecore/TIMEZONES:353 9675 #, kde-format 9676 msgid "America/Inuvik" 9677 msgstr "अमेरिका/इनुविक" 9678 9679 #. i18n: comment to the previous timezone 9680 #: kdecore/TIMEZONES:355 9681 #, kde-format 9682 msgid "Mountain Time - west Northwest Territories" 9683 msgstr "" 9684 9685 #. i18n: comment to the previous timezone 9686 #: kdecore/TIMEZONES:357 9687 #, kde-format 9688 msgid "Mountain - NT (west)" 9689 msgstr "" 9690 9691 #: kdecore/TIMEZONES:358 9692 #, kde-format 9693 msgid "America/Iqaluit" 9694 msgstr "अमेरिका/इक़्लुइट" 9695 9696 #. i18n: comment to the previous timezone 9697 #: kdecore/TIMEZONES:360 9698 #, kde-format 9699 msgid "Eastern Time - east Nunavut - most locations" 9700 msgstr "" 9701 9702 #. i18n: comment to the previous timezone 9703 #: kdecore/TIMEZONES:362 9704 #, kde-format 9705 msgid "Eastern - NU (most east areas)" 9706 msgstr "" 9707 9708 #: kdecore/TIMEZONES:363 9709 #, kde-format 9710 msgid "America/Jamaica" 9711 msgstr "अमेरिका/जैमाएका" 9712 9713 #: kdecore/TIMEZONES:364 9714 #, kde-format 9715 msgid "America/Jujuy" 9716 msgstr "अमेरिका/जुजुई" 9717 9718 #: kdecore/TIMEZONES:367 9719 #, kde-format 9720 msgid "America/Juneau" 9721 msgstr "अमेरिका/जुनेआयू" 9722 9723 #. i18n: comment to the previous timezone 9724 #: kdecore/TIMEZONES:369 9725 #, kde-format 9726 msgid "Alaska Time - Alaska panhandle" 9727 msgstr "" 9728 9729 #. i18n: comment to the previous timezone 9730 #: kdecore/TIMEZONES:371 9731 #, kde-format 9732 msgid "Alaska - Juneau area" 9733 msgstr "" 9734 9735 #: kdecore/TIMEZONES:372 9736 #, kde-format 9737 msgid "America/Kentucky/Louisville" 9738 msgstr "अमेरिका/केंटुकी/लुइविले" 9739 9740 #. i18n: comment to the previous timezone 9741 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9742 #, fuzzy, kde-format 9743 #| msgid "America/Kentucky/Louisville" 9744 msgid "Eastern Time - Kentucky - Louisville area" 9745 msgstr "अमेरिका/केंटुकी/लुइविले" 9746 9747 #. i18n: comment to the previous timezone 9748 #: kdecore/TIMEZONES:376 9749 #, fuzzy, kde-format 9750 #| msgid "America/Kentucky/Louisville" 9751 msgid "Eastern - KY (Louisville area)" 9752 msgstr "अमेरिका/केंटुकी/लुइविले" 9753 9754 #: kdecore/TIMEZONES:377 9755 #, kde-format 9756 msgid "America/Kentucky/Monticello" 9757 msgstr "अमेरिका/कैंटकी/मॉंटिसेलो" 9758 9759 #. i18n: comment to the previous timezone 9760 #: kdecore/TIMEZONES:379 9761 #, kde-format 9762 msgid "Eastern Time - Kentucky - Wayne County" 9763 msgstr "" 9764 9765 #. i18n: comment to the previous timezone 9766 #: kdecore/TIMEZONES:381 9767 #, kde-format 9768 msgid "Eastern - KY (Wayne)" 9769 msgstr "" 9770 9771 #: kdecore/TIMEZONES:382 9772 #, fuzzy, kde-format 9773 #| msgid "America/Indiana/Knox" 9774 msgid "America/Knox_IN" 9775 msgstr "अमेरिका/इंडियाना/नॉक्स" 9776 9777 #: kdecore/TIMEZONES:385 9778 #, fuzzy, kde-format 9779 #| msgid "America/Grenada" 9780 msgid "America/Kralendijk" 9781 msgstr "अमेरिका/ग्रेनडा" 9782 9783 #: kdecore/TIMEZONES:386 9784 #, kde-format 9785 msgid "America/La_Paz" 9786 msgstr "अमेरिका/ला_पाज" 9787 9788 #: kdecore/TIMEZONES:387 9789 #, kde-format 9790 msgid "America/Lima" 9791 msgstr "अमेरिका/लिमा" 9792 9793 #: kdecore/TIMEZONES:388 9794 #, kde-format 9795 msgid "America/Los_Angeles" 9796 msgstr "अमेरिका/लॉस_एंजेलिस" 9797 9798 #. i18n: comment to the previous timezone 9799 #: kdecore/TIMEZONES:392 9800 #, fuzzy, kde-format 9801 #| msgid "Pacific/Yap" 9802 msgid "Pacific" 9803 msgstr "प्रशांत/याप" 9804 9805 #: kdecore/TIMEZONES:393 9806 #, kde-format 9807 msgid "America/Louisville" 9808 msgstr "अमेरिका/लुइसवेल" 9809 9810 #: kdecore/TIMEZONES:396 9811 #, fuzzy, kde-format 9812 #| msgid "America/Port-au-Prince" 9813 msgid "America/Lower_Princes" 9814 msgstr "अमेरिका/पॉर्ट_ऑ_प्रिंस" 9815 9816 #: kdecore/TIMEZONES:397 9817 #, kde-format 9818 msgid "America/Maceio" 9819 msgstr "अमेरिका/मैसिओ" 9820 9821 #. i18n: comment to the previous timezone 9822 #: kdecore/TIMEZONES:399 9823 #, kde-format 9824 msgid "Alagoas, Sergipe" 9825 msgstr "" 9826 9827 #: kdecore/TIMEZONES:400 9828 #, kde-format 9829 msgid "America/Managua" 9830 msgstr "अमेरिका/मानागुआ" 9831 9832 #: kdecore/TIMEZONES:401 9833 #, kde-format 9834 msgid "America/Manaus" 9835 msgstr "अमेरिका/मनौअस" 9836 9837 #. i18n: comment to the previous timezone 9838 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9839 #, kde-format 9840 msgid "E Amazonas" 9841 msgstr "" 9842 9843 #. i18n: comment to the previous timezone 9844 #: kdecore/TIMEZONES:405 9845 #, kde-format 9846 msgid "Amazonas (east)" 9847 msgstr "" 9848 9849 #: kdecore/TIMEZONES:406 9850 #, fuzzy, kde-format 9851 #| msgid "America/Maceio" 9852 msgid "America/Marigot" 9853 msgstr "अमेरिका/मैसिओ" 9854 9855 #: kdecore/TIMEZONES:407 9856 #, kde-format 9857 msgid "America/Martinique" 9858 msgstr "अमेरिका/मार्टिनिक" 9859 9860 #: kdecore/TIMEZONES:408 9861 #, fuzzy, kde-format 9862 #| msgid "America/Manaus" 9863 msgid "America/Matamoros" 9864 msgstr "अमेरिका/मनौअस" 9865 9866 #. i18n: comment to the previous timezone 9867 #: kdecore/TIMEZONES:410 9868 #, kde-format 9869 msgid "" 9870 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9871 msgstr "" 9872 9873 #. i18n: comment to the previous timezone 9874 #: kdecore/TIMEZONES:412 9875 #, kde-format 9876 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9877 msgstr "" 9878 9879 #: kdecore/TIMEZONES:413 9880 #, kde-format 9881 msgid "America/Mazatlan" 9882 msgstr "अमेरिका/मजाटलान" 9883 9884 #. i18n: comment to the previous timezone 9885 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9886 #, kde-format 9887 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9888 msgstr "" 9889 9890 #. i18n: comment to the previous timezone 9891 #: kdecore/TIMEZONES:417 9892 #, kde-format 9893 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9894 msgstr "" 9895 9896 #: kdecore/TIMEZONES:418 9897 #, kde-format 9898 msgid "America/Mendoza" 9899 msgstr "अमेरिका/मेंडोज़ा" 9900 9901 #: kdecore/TIMEZONES:421 9902 #, kde-format 9903 msgid "America/Menominee" 9904 msgstr "अमेरिका/मेनोमिनी" 9905 9906 #. i18n: comment to the previous timezone 9907 #: kdecore/TIMEZONES:423 9908 #, kde-format 9909 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9910 msgstr "" 9911 9912 #. i18n: comment to the previous timezone 9913 #: kdecore/TIMEZONES:425 9914 #, kde-format 9915 msgid "Central - MI (Wisconsin border)" 9916 msgstr "" 9917 9918 #: kdecore/TIMEZONES:426 9919 #, kde-format 9920 msgid "America/Merida" 9921 msgstr "अमेरिका/मरिदा" 9922 9923 #. i18n: comment to the previous timezone 9924 #: kdecore/TIMEZONES:428 9925 #, kde-format 9926 msgid "Central Time - Campeche, Yucatan" 9927 msgstr "" 9928 9929 #: kdecore/TIMEZONES:429 9930 #, fuzzy, kde-format 9931 #| msgid "America/Mazatlan" 9932 msgid "America/Metlakatla" 9933 msgstr "अमेरिका/मजाटलान" 9934 9935 #. i18n: comment to the previous timezone 9936 #: kdecore/TIMEZONES:431 9937 #, kde-format 9938 msgid "Metlakatla Time - Annette Island" 9939 msgstr "" 9940 9941 #. i18n: comment to the previous timezone 9942 #: kdecore/TIMEZONES:433 9943 #, kde-format 9944 msgid "Alaska - Annette Island" 9945 msgstr "" 9946 9947 #: kdecore/TIMEZONES:434 9948 #, kde-format 9949 msgid "America/Mexico_City" 9950 msgstr "अमेरिका/मैक्सिको_शहर" 9951 9952 #. i18n: comment to the previous timezone 9953 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9954 #, kde-format 9955 msgid "Central Time - most locations" 9956 msgstr "" 9957 9958 #: kdecore/TIMEZONES:439 9959 #, kde-format 9960 msgid "America/Miquelon" 9961 msgstr "अमेरिका/मिक्यूलॉन" 9962 9963 #: kdecore/TIMEZONES:440 9964 #, kde-format 9965 msgid "America/Moncton" 9966 msgstr "अमेरिका/मोंकटन" 9967 9968 #. i18n: comment to the previous timezone 9969 #: kdecore/TIMEZONES:442 9970 #, kde-format 9971 msgid "Atlantic Time - New Brunswick" 9972 msgstr "" 9973 9974 #. i18n: comment to the previous timezone 9975 #: kdecore/TIMEZONES:444 9976 #, kde-format 9977 msgid "Atlantic - New Brunswick" 9978 msgstr "" 9979 9980 #: kdecore/TIMEZONES:445 9981 #, kde-format 9982 msgid "America/Monterrey" 9983 msgstr "अमेरिका/मॉन्टेरेय" 9984 9985 #. i18n: comment to the previous timezone 9986 #: kdecore/TIMEZONES:447 9987 #, kde-format 9988 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 9989 msgstr "" 9990 9991 #. i18n: comment to the previous timezone 9992 #: kdecore/TIMEZONES:449 9993 #, kde-format 9994 msgid "" 9995 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 9996 "US border" 9997 msgstr "" 9998 9999 #. i18n: comment to the previous timezone 10000 #: kdecore/TIMEZONES:451 10001 #, kde-format 10002 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10003 msgstr "" 10004 10005 #: kdecore/TIMEZONES:452 10006 #, kde-format 10007 msgid "America/Montevideo" 10008 msgstr "अमेरिका/मोंटेविडिओ" 10009 10010 #: kdecore/TIMEZONES:453 10011 #, kde-format 10012 msgid "America/Montreal" 10013 msgstr "अमेरिका/मॉंटरियल" 10014 10015 #. i18n: comment to the previous timezone 10016 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10017 #, kde-format 10018 msgid "Eastern Time - Quebec - most locations" 10019 msgstr "" 10020 10021 #: kdecore/TIMEZONES:456 10022 #, kde-format 10023 msgid "America/Montserrat" 10024 msgstr "अमेरिका/मॉन्टसेरट" 10025 10026 #: kdecore/TIMEZONES:457 10027 #, kde-format 10028 msgid "America/Nassau" 10029 msgstr "अमेरिका/नासाउ" 10030 10031 #: kdecore/TIMEZONES:458 10032 #, kde-format 10033 msgid "America/New_York" 10034 msgstr "अमेरिका/न्यूयॉर्क" 10035 10036 #. i18n: comment to the previous timezone 10037 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10038 #, kde-format 10039 msgid "Eastern Time" 10040 msgstr "" 10041 10042 #. i18n: comment to the previous timezone 10043 #: kdecore/TIMEZONES:462 10044 #, kde-format 10045 msgid "Eastern (most areas)" 10046 msgstr "" 10047 10048 #: kdecore/TIMEZONES:463 10049 #, kde-format 10050 msgid "America/Nipigon" 10051 msgstr "अमेरिका/निपिगन" 10052 10053 #. i18n: comment to the previous timezone 10054 #: kdecore/TIMEZONES:465 10055 #, kde-format 10056 msgid "" 10057 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10058 msgstr "" 10059 10060 #. i18n: comment to the previous timezone 10061 #: kdecore/TIMEZONES:467 10062 #, kde-format 10063 msgid "Eastern - ON, QC (no DST 1967-73)" 10064 msgstr "" 10065 10066 #: kdecore/TIMEZONES:468 10067 #, kde-format 10068 msgid "America/Nome" 10069 msgstr "अमेरिका/नोम" 10070 10071 #. i18n: comment to the previous timezone 10072 #: kdecore/TIMEZONES:470 10073 #, kde-format 10074 msgid "Alaska Time - west Alaska" 10075 msgstr "" 10076 10077 #. i18n: comment to the previous timezone 10078 #: kdecore/TIMEZONES:472 10079 #, kde-format 10080 msgid "Alaska (west)" 10081 msgstr "" 10082 10083 #: kdecore/TIMEZONES:473 10084 #, kde-format 10085 msgid "America/Noronha" 10086 msgstr "अमेरिका/नॉरॉनहा" 10087 10088 #. i18n: comment to the previous timezone 10089 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10090 #, fuzzy, kde-format 10091 #| msgid "Atlantic/Canary" 10092 msgid "Atlantic islands" 10093 msgstr "अटलांटिक/कैनरी" 10094 10095 #: kdecore/TIMEZONES:476 10096 #, fuzzy, kde-format 10097 #| msgid "America/North_Dakota/Center" 10098 msgid "America/North_Dakota/Beulah" 10099 msgstr "अमेरिका/नॉर्थ_डकोटा/सेंटर" 10100 10101 #. i18n: comment to the previous timezone 10102 #: kdecore/TIMEZONES:478 10103 #, kde-format 10104 msgid "Central Time - North Dakota - Mercer County" 10105 msgstr "" 10106 10107 #. i18n: comment to the previous timezone 10108 #: kdecore/TIMEZONES:480 10109 #, kde-format 10110 msgid "Central - ND (Mercer)" 10111 msgstr "" 10112 10113 #: kdecore/TIMEZONES:481 10114 #, kde-format 10115 msgid "America/North_Dakota/Center" 10116 msgstr "अमेरिका/नॉर्थ_डकोटा/सेंटर" 10117 10118 #. i18n: comment to the previous timezone 10119 #: kdecore/TIMEZONES:483 10120 #, kde-format 10121 msgid "Central Time - North Dakota - Oliver County" 10122 msgstr "" 10123 10124 #. i18n: comment to the previous timezone 10125 #: kdecore/TIMEZONES:485 10126 #, kde-format 10127 msgid "Central - ND (Oliver)" 10128 msgstr "" 10129 10130 #: kdecore/TIMEZONES:486 10131 #, kde-format 10132 msgid "America/North_Dakota/New_Salem" 10133 msgstr "अमेरिका/नॉर्थ_डकोटा/न्यू_सलेम" 10134 10135 #. i18n: comment to the previous timezone 10136 #: kdecore/TIMEZONES:488 10137 #, kde-format 10138 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10139 msgstr "" 10140 10141 #. i18n: comment to the previous timezone 10142 #: kdecore/TIMEZONES:490 10143 #, kde-format 10144 msgid "Central - ND (Morton rural)" 10145 msgstr "" 10146 10147 #: kdecore/TIMEZONES:491 10148 #, fuzzy, kde-format 10149 #| msgid "America/Jujuy" 10150 msgid "America/Nuuk" 10151 msgstr "अमेरिका/जुजुई" 10152 10153 #. i18n: comment to the previous timezone 10154 #: kdecore/TIMEZONES:493 10155 #, kde-format 10156 msgid "Greenland (most areas)" 10157 msgstr "" 10158 10159 #: kdecore/TIMEZONES:494 10160 #, fuzzy, kde-format 10161 #| msgid "America/Managua" 10162 msgid "America/Ojinaga" 10163 msgstr "अमेरिका/मानागुआ" 10164 10165 #. i18n: comment to the previous timezone 10166 #: kdecore/TIMEZONES:496 10167 #, kde-format 10168 msgid "US Mountain Time - Chihuahua near US border" 10169 msgstr "" 10170 10171 #. i18n: comment to the previous timezone 10172 #: kdecore/TIMEZONES:498 10173 #, kde-format 10174 msgid "Mountain Time US - Chihuahua (US border)" 10175 msgstr "" 10176 10177 #: kdecore/TIMEZONES:499 10178 #, fuzzy, kde-format 10179 #| msgid "America/Maceio" 10180 msgid "America/Ontario" 10181 msgstr "अमेरिका/मैसिओ" 10182 10183 #: kdecore/TIMEZONES:502 10184 #, kde-format 10185 msgid "America/Panama" 10186 msgstr "अमेरिका/पनामा" 10187 10188 #: kdecore/TIMEZONES:503 10189 #, kde-format 10190 msgid "America/Pangnirtung" 10191 msgstr "अमेरिका/पांगनिर्टंग" 10192 10193 #. i18n: comment to the previous timezone 10194 #: kdecore/TIMEZONES:505 10195 #, kde-format 10196 msgid "Eastern Time - Pangnirtung, Nunavut" 10197 msgstr "" 10198 10199 #. i18n: comment to the previous timezone 10200 #: kdecore/TIMEZONES:507 10201 #, kde-format 10202 msgid "Eastern - NU (Pangnirtung)" 10203 msgstr "" 10204 10205 #: kdecore/TIMEZONES:508 10206 #, kde-format 10207 msgid "America/Paramaribo" 10208 msgstr "अमेरिका/पैरामारिबो" 10209 10210 #: kdecore/TIMEZONES:509 10211 #, kde-format 10212 msgid "America/Phoenix" 10213 msgstr "अमेरिका/फीनिक्स" 10214 10215 #. i18n: comment to the previous timezone 10216 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10217 #, kde-format 10218 msgid "Mountain Standard Time - Arizona" 10219 msgstr "" 10220 10221 #. i18n: comment to the previous timezone 10222 #: kdecore/TIMEZONES:513 10223 #, kde-format 10224 msgid "MST - Arizona (except Navajo)" 10225 msgstr "" 10226 10227 #: kdecore/TIMEZONES:514 10228 #, kde-format 10229 msgid "America/Port-au-Prince" 10230 msgstr "अमेरिका/पॉर्ट_ऑ_प्रिंस" 10231 10232 #: kdecore/TIMEZONES:515 10233 #, kde-format 10234 msgid "America/Port_of_Spain" 10235 msgstr "अमेरिका/पॉर्ट_ऑफ_स्पेन" 10236 10237 #: kdecore/TIMEZONES:516 10238 #, fuzzy, kde-format 10239 #| msgid "America/Porto_Velho" 10240 msgid "America/Porto_Acre" 10241 msgstr "अमेरिका/पॉर्टो_वेलहो" 10242 10243 #. i18n: comment to the previous timezone 10244 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10245 #, kde-format 10246 msgid "Acre" 10247 msgstr "" 10248 10249 #: kdecore/TIMEZONES:519 10250 #, kde-format 10251 msgid "America/Porto_Velho" 10252 msgstr "अमेरिका/पॉर्टो_वेलहो" 10253 10254 #. i18n: comment to the previous timezone 10255 #: kdecore/TIMEZONES:521 10256 #, kde-format 10257 msgid "Rondonia" 10258 msgstr "" 10259 10260 #: kdecore/TIMEZONES:522 10261 #, kde-format 10262 msgid "America/Puerto_Rico" 10263 msgstr "अमेरिका/पुएर्टो_रिको" 10264 10265 #: kdecore/TIMEZONES:523 10266 #, fuzzy, kde-format 10267 #| msgid "America/Buenos_Aires" 10268 msgid "America/Punta_Arenas" 10269 msgstr "अमेरिका/बुएनॉस_एरिस" 10270 10271 #. i18n: comment to the previous timezone 10272 #: kdecore/TIMEZONES:525 10273 #, kde-format 10274 msgid "Region of Magallanes" 10275 msgstr "" 10276 10277 #: kdecore/TIMEZONES:526 10278 #, kde-format 10279 msgid "America/Rainy_River" 10280 msgstr "अमेरिका/रेनी_रिवर" 10281 10282 #. i18n: comment to the previous timezone 10283 #: kdecore/TIMEZONES:528 10284 #, kde-format 10285 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10286 msgstr "" 10287 10288 #. i18n: comment to the previous timezone 10289 #: kdecore/TIMEZONES:530 10290 #, kde-format 10291 msgid "Central - ON (Rainy R, Ft Frances)" 10292 msgstr "" 10293 10294 #: kdecore/TIMEZONES:531 10295 #, kde-format 10296 msgid "America/Rankin_Inlet" 10297 msgstr "अमेरिका/रेंकिन_इंलेट" 10298 10299 #. i18n: comment to the previous timezone 10300 #: kdecore/TIMEZONES:533 10301 #, kde-format 10302 msgid "Central Time - central Nunavut" 10303 msgstr "" 10304 10305 #. i18n: comment to the previous timezone 10306 #: kdecore/TIMEZONES:535 10307 #, kde-format 10308 msgid "Central - NU (central)" 10309 msgstr "" 10310 10311 #: kdecore/TIMEZONES:536 10312 #, kde-format 10313 msgid "America/Recife" 10314 msgstr "अमेरिका/रेसाइफ" 10315 10316 #. i18n: comment to the previous timezone 10317 #: kdecore/TIMEZONES:538 10318 #, kde-format 10319 msgid "Pernambuco" 10320 msgstr "" 10321 10322 #: kdecore/TIMEZONES:539 10323 #, kde-format 10324 msgid "America/Regina" 10325 msgstr "अमेरिका/रेगिना" 10326 10327 #. i18n: comment to the previous timezone 10328 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10329 #: kdecore/TIMEZONES:1123 10330 #, kde-format 10331 msgid "Central Standard Time - Saskatchewan - most locations" 10332 msgstr "" 10333 10334 #. i18n: comment to the previous timezone 10335 #: kdecore/TIMEZONES:543 10336 #, kde-format 10337 msgid "CST - SK (most areas)" 10338 msgstr "" 10339 10340 #: kdecore/TIMEZONES:544 10341 #, kde-format 10342 msgid "America/Resolute" 10343 msgstr "अमेरिका/रिजाल्यूट" 10344 10345 #. i18n: comment to the previous timezone 10346 #: kdecore/TIMEZONES:546 10347 #, kde-format 10348 msgid "Eastern Time - Resolute, Nunavut" 10349 msgstr "" 10350 10351 #. i18n: comment to the previous timezone 10352 #: kdecore/TIMEZONES:548 10353 #, kde-format 10354 msgid "Central Standard Time - Resolute, Nunavut" 10355 msgstr "" 10356 10357 #. i18n: comment to the previous timezone 10358 #: kdecore/TIMEZONES:550 10359 #, kde-format 10360 msgid "Central - NU (Resolute)" 10361 msgstr "" 10362 10363 #: kdecore/TIMEZONES:551 10364 #, kde-format 10365 msgid "America/Rio_Branco" 10366 msgstr "अमेरिका/रिओ_ब्रांको" 10367 10368 #: kdecore/TIMEZONES:554 10369 #, kde-format 10370 msgid "America/Rosario" 10371 msgstr "अमेरिका/रॉसरियो" 10372 10373 #: kdecore/TIMEZONES:557 10374 #, fuzzy, kde-format 10375 #| msgid "America/Santiago" 10376 msgid "America/Santa_Isabel" 10377 msgstr "अमेरिका/सेनिटिआगो" 10378 10379 #. i18n: comment to the previous timezone 10380 #: kdecore/TIMEZONES:559 10381 #, kde-format 10382 msgid "Mexican Pacific Time - Baja California away from US border" 10383 msgstr "" 10384 10385 #: kdecore/TIMEZONES:560 10386 #, fuzzy, kde-format 10387 #| msgid "America/Santiago" 10388 msgid "America/Santarem" 10389 msgstr "अमेरिका/सेनिटिआगो" 10390 10391 #. i18n: comment to the previous timezone 10392 #: kdecore/TIMEZONES:562 10393 #, fuzzy, kde-format 10394 msgid "W Para" 10395 msgstr "मार्च क' " 10396 10397 #. i18n: comment to the previous timezone 10398 #: kdecore/TIMEZONES:564 10399 #, kde-format 10400 msgid "Para (west)" 10401 msgstr "" 10402 10403 #: kdecore/TIMEZONES:565 10404 #, kde-format 10405 msgid "America/Santiago" 10406 msgstr "अमेरिका/सेनिटिआगो" 10407 10408 #. i18n: comment to the previous timezone 10409 #: kdecore/TIMEZONES:569 10410 #, kde-format 10411 msgid "Chile (most areas)" 10412 msgstr "" 10413 10414 #: kdecore/TIMEZONES:570 10415 #, kde-format 10416 msgid "America/Santo_Domingo" 10417 msgstr "अमेरिका/सेंटो_डोमिनिका" 10418 10419 #: kdecore/TIMEZONES:571 10420 #, kde-format 10421 msgid "America/Sao_Paulo" 10422 msgstr "अमेरिका/साओ_पालॉ" 10423 10424 #. i18n: comment to the previous timezone 10425 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10426 #, kde-format 10427 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10428 msgstr "" 10429 10430 #. i18n: comment to the previous timezone 10431 #: kdecore/TIMEZONES:575 10432 #, kde-format 10433 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10434 msgstr "" 10435 10436 #: kdecore/TIMEZONES:576 10437 #, fuzzy, kde-format 10438 #| msgid "America/Dawson" 10439 msgid "America/Saskatoon" 10440 msgstr "अमेरिका/डॉसन" 10441 10442 #: kdecore/TIMEZONES:579 10443 #, kde-format 10444 msgid "America/Scoresbysund" 10445 msgstr "अमेरिका/स्कोर्सबाइसुंड" 10446 10447 #. i18n: comment to the previous timezone 10448 #: kdecore/TIMEZONES:581 10449 #, kde-format 10450 msgid "Scoresbysund / Ittoqqortoormiit" 10451 msgstr "" 10452 10453 #. i18n: comment to the previous timezone 10454 #: kdecore/TIMEZONES:583 10455 #, kde-format 10456 msgid "Scoresbysund/Ittoqqortoormiit" 10457 msgstr "" 10458 10459 #: kdecore/TIMEZONES:584 10460 #, kde-format 10461 msgid "America/Shiprock" 10462 msgstr "अमेरिका/शिपरॉक" 10463 10464 #. i18n: comment to the previous timezone 10465 #: kdecore/TIMEZONES:586 10466 #, kde-format 10467 msgid "Mountain Time - Navajo" 10468 msgstr "" 10469 10470 #: kdecore/TIMEZONES:587 10471 #, fuzzy, kde-format 10472 #| msgid "America/Atikokan" 10473 msgid "America/Sitka" 10474 msgstr "अमेरिका/एटिकोकन" 10475 10476 #. i18n: comment to the previous timezone 10477 #: kdecore/TIMEZONES:589 10478 #, kde-format 10479 msgid "Alaska Time - southeast Alaska panhandle" 10480 msgstr "" 10481 10482 #. i18n: comment to the previous timezone 10483 #: kdecore/TIMEZONES:591 10484 #, kde-format 10485 msgid "Alaska - Sitka area" 10486 msgstr "" 10487 10488 #: kdecore/TIMEZONES:592 10489 #, fuzzy, kde-format 10490 #| msgid "America/Belem" 10491 msgid "America/St_Barthelemy" 10492 msgstr "अमेरिका/बेलेम" 10493 10494 #: kdecore/TIMEZONES:593 10495 #, kde-format 10496 msgid "America/St_Johns" 10497 msgstr "अमेरिका/सेंट_जॉहंस" 10498 10499 #. i18n: comment to the previous timezone 10500 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10501 #, kde-format 10502 msgid "Newfoundland Time, including SE Labrador" 10503 msgstr "" 10504 10505 #. i18n: comment to the previous timezone 10506 #: kdecore/TIMEZONES:597 10507 #, kde-format 10508 msgid "Newfoundland; Labrador (southeast)" 10509 msgstr "" 10510 10511 #: kdecore/TIMEZONES:598 10512 #, kde-format 10513 msgid "America/St_Kitts" 10514 msgstr "अमेरिका/सेंट_किटस" 10515 10516 #: kdecore/TIMEZONES:599 10517 #, kde-format 10518 msgid "America/St_Lucia" 10519 msgstr "अमेरिका/सेंट_लुसिया" 10520 10521 #: kdecore/TIMEZONES:600 10522 #, kde-format 10523 msgid "America/St_Thomas" 10524 msgstr "अमेरिका/सेंट_थॉमस" 10525 10526 #: kdecore/TIMEZONES:601 10527 #, kde-format 10528 msgid "America/St_Vincent" 10529 msgstr "अमेरिका/सेंट_विंसेंट" 10530 10531 #: kdecore/TIMEZONES:602 10532 #, kde-format 10533 msgid "America/Swift_Current" 10534 msgstr "अमेरिका/स्फिट_करेंट" 10535 10536 #. i18n: comment to the previous timezone 10537 #: kdecore/TIMEZONES:604 10538 #, kde-format 10539 msgid "Central Standard Time - Saskatchewan - midwest" 10540 msgstr "" 10541 10542 #. i18n: comment to the previous timezone 10543 #: kdecore/TIMEZONES:606 10544 #, kde-format 10545 msgid "CST - SK (midwest)" 10546 msgstr "" 10547 10548 #: kdecore/TIMEZONES:607 10549 #, kde-format 10550 msgid "America/Tegucigalpa" 10551 msgstr "अमेरिका/टेगुसिगलपा" 10552 10553 #: kdecore/TIMEZONES:608 10554 #, kde-format 10555 msgid "America/Thule" 10556 msgstr "अमेरिका/थूले" 10557 10558 #. i18n: comment to the previous timezone 10559 #: kdecore/TIMEZONES:610 10560 #, kde-format 10561 msgid "Thule / Pituffik" 10562 msgstr "" 10563 10564 #. i18n: comment to the previous timezone 10565 #: kdecore/TIMEZONES:612 10566 #, kde-format 10567 msgid "Thule/Pituffik" 10568 msgstr "" 10569 10570 #: kdecore/TIMEZONES:613 10571 #, kde-format 10572 msgid "America/Thunder_Bay" 10573 msgstr "अमेरिका/थंडर_बे" 10574 10575 #. i18n: comment to the previous timezone 10576 #: kdecore/TIMEZONES:615 10577 #, kde-format 10578 msgid "Eastern Time - Thunder Bay, Ontario" 10579 msgstr "" 10580 10581 #. i18n: comment to the previous timezone 10582 #: kdecore/TIMEZONES:617 10583 #, kde-format 10584 msgid "Eastern - ON (Thunder Bay)" 10585 msgstr "" 10586 10587 #: kdecore/TIMEZONES:618 10588 #, kde-format 10589 msgid "America/Tijuana" 10590 msgstr "अमेरिका/टिजुआना" 10591 10592 #. i18n: comment to the previous timezone 10593 #: kdecore/TIMEZONES:622 10594 #, kde-format 10595 msgid "US Pacific Time - Baja California near US border" 10596 msgstr "" 10597 10598 #. i18n: comment to the previous timezone 10599 #: kdecore/TIMEZONES:624 10600 #, kde-format 10601 msgid "Pacific Time US - Baja California" 10602 msgstr "" 10603 10604 #: kdecore/TIMEZONES:625 10605 #, kde-format 10606 msgid "America/Toronto" 10607 msgstr "अमेरिका/टोरंटो" 10608 10609 #. i18n: comment to the previous timezone 10610 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10611 #, kde-format 10612 msgid "Eastern Time - Ontario - most locations" 10613 msgstr "" 10614 10615 #. i18n: comment to the previous timezone 10616 #: kdecore/TIMEZONES:629 10617 #, kde-format 10618 msgid "Eastern - ON, QC (most areas)" 10619 msgstr "" 10620 10621 #: kdecore/TIMEZONES:630 10622 #, kde-format 10623 msgid "America/Tortola" 10624 msgstr "अमेरिका/टॉरटोला" 10625 10626 #: kdecore/TIMEZONES:631 10627 #, kde-format 10628 msgid "America/Vancouver" 10629 msgstr "अमेरिका/वनकाउवर" 10630 10631 #. i18n: comment to the previous timezone 10632 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10633 #, kde-format 10634 msgid "Pacific Time - west British Columbia" 10635 msgstr "" 10636 10637 #. i18n: comment to the previous timezone 10638 #: kdecore/TIMEZONES:635 10639 #, kde-format 10640 msgid "Pacific - BC (most areas)" 10641 msgstr "" 10642 10643 #: kdecore/TIMEZONES:636 10644 #, fuzzy, kde-format 10645 #| msgid "America/Regina" 10646 msgid "America/Virgin" 10647 msgstr "अमेरिका/रेगिना" 10648 10649 #: kdecore/TIMEZONES:637 10650 #, kde-format 10651 msgid "America/Whitehorse" 10652 msgstr "अमेरिका/वाइट_हॉर्स" 10653 10654 #. i18n: comment to the previous timezone 10655 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10656 #, kde-format 10657 msgid "Pacific Time - south Yukon" 10658 msgstr "" 10659 10660 #. i18n: comment to the previous timezone 10661 #: kdecore/TIMEZONES:641 10662 #, kde-format 10663 msgid "MST - Yukon (east)" 10664 msgstr "" 10665 10666 #: kdecore/TIMEZONES:642 10667 #, kde-format 10668 msgid "America/Winnipeg" 10669 msgstr "अमेरिका/विनीपेग" 10670 10671 #. i18n: comment to the previous timezone 10672 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10673 #, kde-format 10674 msgid "Central Time - Manitoba & west Ontario" 10675 msgstr "" 10676 10677 #. i18n: comment to the previous timezone 10678 #: kdecore/TIMEZONES:646 10679 #, kde-format 10680 msgid "Central - ON (west); Manitoba" 10681 msgstr "" 10682 10683 #: kdecore/TIMEZONES:647 10684 #, kde-format 10685 msgid "America/Yakutat" 10686 msgstr "अमेरिका/यकुटट" 10687 10688 #. i18n: comment to the previous timezone 10689 #: kdecore/TIMEZONES:649 10690 #, kde-format 10691 msgid "Alaska Time - Alaska panhandle neck" 10692 msgstr "" 10693 10694 #. i18n: comment to the previous timezone 10695 #: kdecore/TIMEZONES:651 10696 #, kde-format 10697 msgid "Alaska - Yakutat" 10698 msgstr "" 10699 10700 #: kdecore/TIMEZONES:652 10701 #, kde-format 10702 msgid "America/Yellowknife" 10703 msgstr "अमेरिका/येलोनाइफ" 10704 10705 #. i18n: comment to the previous timezone 10706 #: kdecore/TIMEZONES:654 10707 #, kde-format 10708 msgid "Mountain Time - central Northwest Territories" 10709 msgstr "" 10710 10711 #. i18n: comment to the previous timezone 10712 #: kdecore/TIMEZONES:656 10713 #, kde-format 10714 msgid "Mountain - NT (central)" 10715 msgstr "" 10716 10717 #: kdecore/TIMEZONES:657 10718 #, kde-format 10719 msgid "Antarctica/Casey" 10720 msgstr "एंटार्कटिका/कसेय" 10721 10722 #. i18n: comment to the previous timezone 10723 #: kdecore/TIMEZONES:659 10724 #, kde-format 10725 msgid "Casey Station, Bailey Peninsula" 10726 msgstr "" 10727 10728 #. i18n: comment to the previous timezone 10729 #: kdecore/TIMEZONES:661 10730 #, kde-format 10731 msgid "Casey" 10732 msgstr "" 10733 10734 #: kdecore/TIMEZONES:662 10735 #, kde-format 10736 msgid "Antarctica/Davis" 10737 msgstr "एंटार्कटिका/डेविस" 10738 10739 #. i18n: comment to the previous timezone 10740 #: kdecore/TIMEZONES:664 10741 #, kde-format 10742 msgid "Davis Station, Vestfold Hills" 10743 msgstr "" 10744 10745 #. i18n: comment to the previous timezone 10746 #: kdecore/TIMEZONES:666 10747 #, kde-format 10748 msgid "Davis" 10749 msgstr "" 10750 10751 #: kdecore/TIMEZONES:667 10752 #, kde-format 10753 msgid "Antarctica/DumontDUrville" 10754 msgstr "एंटार्कटिका/डुमॉंटडुवेल" 10755 10756 #. i18n: comment to the previous timezone 10757 #: kdecore/TIMEZONES:669 10758 #, kde-format 10759 msgid "Dumont-d'Urville Station, Terre Adelie" 10760 msgstr "" 10761 10762 #. i18n: comment to the previous timezone 10763 #: kdecore/TIMEZONES:671 10764 #, fuzzy, kde-format 10765 #| msgid "Antarctica/DumontDUrville" 10766 msgid "Dumont-d'Urville" 10767 msgstr "एंटार्कटिका/डुमॉंटडुवेल" 10768 10769 #: kdecore/TIMEZONES:672 10770 #, fuzzy, kde-format 10771 #| msgid "Antarctica/McMurdo" 10772 msgid "Antarctica/Macquarie" 10773 msgstr "एंटार्कटिका/मैकमुर्दो" 10774 10775 #. i18n: comment to the previous timezone 10776 #: kdecore/TIMEZONES:674 10777 #, kde-format 10778 msgid "Macquarie Island Station, Macquarie Island" 10779 msgstr "" 10780 10781 #. i18n: comment to the previous timezone 10782 #: kdecore/TIMEZONES:676 10783 #, kde-format 10784 msgid "Macquarie Island" 10785 msgstr "" 10786 10787 #: kdecore/TIMEZONES:677 10788 #, kde-format 10789 msgid "Antarctica/Mawson" 10790 msgstr "एंटार्कटिका/माकसन" 10791 10792 #. i18n: comment to the previous timezone 10793 #: kdecore/TIMEZONES:679 10794 #, kde-format 10795 msgid "Mawson Station, Holme Bay" 10796 msgstr "" 10797 10798 #. i18n: comment to the previous timezone 10799 #: kdecore/TIMEZONES:681 10800 #, kde-format 10801 msgid "Mawson" 10802 msgstr "" 10803 10804 #: kdecore/TIMEZONES:682 10805 #, kde-format 10806 msgid "Antarctica/McMurdo" 10807 msgstr "एंटार्कटिका/मैकमुर्दो" 10808 10809 #. i18n: comment to the previous timezone 10810 #: kdecore/TIMEZONES:684 10811 #, kde-format 10812 msgid "McMurdo Station, Ross Island" 10813 msgstr "" 10814 10815 #. i18n: comment to the previous timezone 10816 #: kdecore/TIMEZONES:686 10817 #, kde-format 10818 msgid "New Zealand time - McMurdo, South Pole" 10819 msgstr "" 10820 10821 #: kdecore/TIMEZONES:687 10822 #, kde-format 10823 msgid "Antarctica/Palmer" 10824 msgstr "एंटार्कटिका/पलमेर" 10825 10826 #. i18n: comment to the previous timezone 10827 #: kdecore/TIMEZONES:689 10828 #, kde-format 10829 msgid "Palmer Station, Anvers Island" 10830 msgstr "" 10831 10832 #. i18n: comment to the previous timezone 10833 #: kdecore/TIMEZONES:691 10834 #, kde-format 10835 msgid "Palmer" 10836 msgstr "" 10837 10838 #: kdecore/TIMEZONES:692 10839 #, kde-format 10840 msgid "Antarctica/Rothera" 10841 msgstr "एंटार्कटिका/राथेरा" 10842 10843 #. i18n: comment to the previous timezone 10844 #: kdecore/TIMEZONES:694 10845 #, kde-format 10846 msgid "Rothera Station, Adelaide Island" 10847 msgstr "" 10848 10849 #. i18n: comment to the previous timezone 10850 #: kdecore/TIMEZONES:696 10851 #, kde-format 10852 msgid "Rothera" 10853 msgstr "" 10854 10855 #: kdecore/TIMEZONES:697 10856 #, kde-format 10857 msgid "Antarctica/South_Pole" 10858 msgstr "एंटार्कटिका/साउथपोल" 10859 10860 #. i18n: comment to the previous timezone 10861 #: kdecore/TIMEZONES:699 10862 #, kde-format 10863 msgid "Amundsen-Scott Station, South Pole" 10864 msgstr "" 10865 10866 #: kdecore/TIMEZONES:700 10867 #, kde-format 10868 msgid "Antarctica/Syowa" 10869 msgstr "एंटार्कटिका/स्योवा" 10870 10871 #. i18n: comment to the previous timezone 10872 #: kdecore/TIMEZONES:702 10873 #, kde-format 10874 msgid "Syowa Station, E Ongul I" 10875 msgstr "" 10876 10877 #. i18n: comment to the previous timezone 10878 #: kdecore/TIMEZONES:704 10879 #, kde-format 10880 msgid "Syowa" 10881 msgstr "" 10882 10883 #: kdecore/TIMEZONES:705 10884 #, fuzzy, kde-format 10885 #| msgid "Antarctica/McMurdo" 10886 msgid "Antarctica/Troll" 10887 msgstr "एंटार्कटिका/मैकमुर्दो" 10888 10889 #. i18n: comment to the previous timezone 10890 #: kdecore/TIMEZONES:707 10891 #, kde-format 10892 msgid "Troll" 10893 msgstr "" 10894 10895 #: kdecore/TIMEZONES:708 10896 #, kde-format 10897 msgid "Antarctica/Vostok" 10898 msgstr "एंटार्कटिका/वॉस्टोक" 10899 10900 #. i18n: comment to the previous timezone 10901 #: kdecore/TIMEZONES:710 10902 #, kde-format 10903 msgid "Vostok Station, S Magnetic Pole" 10904 msgstr "" 10905 10906 #. i18n: comment to the previous timezone 10907 #: kdecore/TIMEZONES:712 10908 #, kde-format 10909 msgid "Vostok Station, Lake Vostok" 10910 msgstr "" 10911 10912 #. i18n: comment to the previous timezone 10913 #: kdecore/TIMEZONES:714 10914 #, kde-format 10915 msgid "Vostok" 10916 msgstr "" 10917 10918 #: kdecore/TIMEZONES:715 10919 #, kde-format 10920 msgid "Arctic/Longyearbyen" 10921 msgstr "आर्टिक/लॉगयेआर्वियन" 10922 10923 #: kdecore/TIMEZONES:716 10924 #, kde-format 10925 msgid "Asia/Aden" 10926 msgstr "एशिया/एडेन" 10927 10928 #: kdecore/TIMEZONES:717 10929 #, kde-format 10930 msgid "Asia/Almaty" 10931 msgstr "एशिया/अलमाती" 10932 10933 #. i18n: comment to the previous timezone 10934 #: kdecore/TIMEZONES:721 10935 #, kde-format 10936 msgid "Kazakhstan (most areas)" 10937 msgstr "" 10938 10939 #: kdecore/TIMEZONES:722 10940 #, kde-format 10941 msgid "Asia/Amman" 10942 msgstr "एशिया/अमान" 10943 10944 #: kdecore/TIMEZONES:723 10945 #, kde-format 10946 msgid "Asia/Anadyr" 10947 msgstr "एशिया/अनादीर" 10948 10949 #. i18n: comment to the previous timezone 10950 #: kdecore/TIMEZONES:725 10951 #, kde-format 10952 msgid "Moscow+10 - Bering Sea" 10953 msgstr "" 10954 10955 #. i18n: comment to the previous timezone 10956 #: kdecore/TIMEZONES:727 10957 #, kde-format 10958 msgid "Moscow+08 - Bering Sea" 10959 msgstr "" 10960 10961 #. i18n: comment to the previous timezone 10962 #: kdecore/TIMEZONES:729 10963 #, kde-format 10964 msgid "MSK+09 - Bering Sea" 10965 msgstr "" 10966 10967 #: kdecore/TIMEZONES:730 10968 #, kde-format 10969 msgid "Asia/Aqtau" 10970 msgstr "एशिया/अक़्ताउ" 10971 10972 #. i18n: comment to the previous timezone 10973 #: kdecore/TIMEZONES:732 10974 #, kde-format 10975 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 10976 msgstr "" 10977 10978 #. i18n: comment to the previous timezone 10979 #: kdecore/TIMEZONES:734 10980 #, kde-format 10981 msgid "Mangghystau/Mankistau" 10982 msgstr "" 10983 10984 #: kdecore/TIMEZONES:735 10985 #, kde-format 10986 msgid "Asia/Aqtobe" 10987 msgstr "एशिया/अक़्टोब" 10988 10989 #. i18n: comment to the previous timezone 10990 #: kdecore/TIMEZONES:737 10991 #, kde-format 10992 msgid "Aqtobe (Aktobe)" 10993 msgstr "" 10994 10995 #. i18n: comment to the previous timezone 10996 #: kdecore/TIMEZONES:739 10997 #, kde-format 10998 msgid "Aqtobe/Aktobe" 10999 msgstr "" 11000 11001 #: kdecore/TIMEZONES:740 11002 #, kde-format 11003 msgid "Asia/Ashgabat" 11004 msgstr "एशिया/अशगाबाट" 11005 11006 #: kdecore/TIMEZONES:741 11007 #, fuzzy, kde-format 11008 #| msgid "Asia/Ashgabat" 11009 msgid "Asia/Ashkhabad" 11010 msgstr "एशिया/अशगाबाट" 11011 11012 #: kdecore/TIMEZONES:742 11013 #, fuzzy, kde-format 11014 #| msgid "Asia/Aqtau" 11015 msgid "Asia/Atyrau" 11016 msgstr "एशिया/अक़्ताउ" 11017 11018 #. i18n: comment to the previous timezone 11019 #: kdecore/TIMEZONES:744 11020 #, kde-format 11021 msgid "Atyrau/Atirau/Gur'yev" 11022 msgstr "" 11023 11024 #: kdecore/TIMEZONES:745 11025 #, kde-format 11026 msgid "Asia/Baghdad" 11027 msgstr "एशिया/बगदाद" 11028 11029 #: kdecore/TIMEZONES:746 11030 #, kde-format 11031 msgid "Asia/Bahrain" 11032 msgstr "एश्या/बहरिन" 11033 11034 #: kdecore/TIMEZONES:747 11035 #, kde-format 11036 msgid "Asia/Baku" 11037 msgstr "एशिया/बाकू" 11038 11039 #: kdecore/TIMEZONES:748 11040 #, kde-format 11041 msgid "Asia/Bangkok" 11042 msgstr "एशिया/बैंककॉक" 11043 11044 #: kdecore/TIMEZONES:749 11045 #, fuzzy, kde-format 11046 #| msgid "Asia/Baku" 11047 msgid "Asia/Barnaul" 11048 msgstr "एशिया/बाकू" 11049 11050 #. i18n: comment to the previous timezone 11051 #: kdecore/TIMEZONES:751 11052 #, kde-format 11053 msgid "MSK+04 - Altai" 11054 msgstr "" 11055 11056 #: kdecore/TIMEZONES:752 11057 #, fuzzy, kde-format 11058 #| msgid "Asia/Beirut" 11059 msgid "Asia/Beijing" 11060 msgstr "एशिया/बेरुत" 11061 11062 #. i18n: comment to the previous timezone 11063 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11064 #, kde-format 11065 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11066 msgstr "" 11067 11068 #. i18n: comment to the previous timezone 11069 #: kdecore/TIMEZONES:756 11070 #, kde-format 11071 msgid "China Standard Time" 11072 msgstr "" 11073 11074 #: kdecore/TIMEZONES:757 11075 #, kde-format 11076 msgid "Asia/Beirut" 11077 msgstr "एशिया/बेरुत" 11078 11079 #: kdecore/TIMEZONES:758 11080 #, kde-format 11081 msgid "Asia/Bishkek" 11082 msgstr "एशिया/बिशकेक" 11083 11084 #: kdecore/TIMEZONES:759 11085 #, kde-format 11086 msgid "Asia/Brunei" 11087 msgstr "एशिया/ब्रुनइ" 11088 11089 #: kdecore/TIMEZONES:760 11090 #, kde-format 11091 msgid "Asia/Calcutta" 11092 msgstr "एशिया/कोलकाता" 11093 11094 #: kdecore/TIMEZONES:761 11095 #, fuzzy, kde-format 11096 #| msgid "Asia/Choibalsan" 11097 msgid "Asia/Chita" 11098 msgstr "एशिया/चोइबालसन" 11099 11100 #. i18n: comment to the previous timezone 11101 #: kdecore/TIMEZONES:763 11102 #, kde-format 11103 msgid "MSK+06 - Zabaykalsky" 11104 msgstr "" 11105 11106 #: kdecore/TIMEZONES:764 11107 #, kde-format 11108 msgid "Asia/Choibalsan" 11109 msgstr "एशिया/चोइबालसन" 11110 11111 #. i18n: comment to the previous timezone 11112 #: kdecore/TIMEZONES:766 11113 #, kde-format 11114 msgid "Dornod, Sukhbaatar" 11115 msgstr "" 11116 11117 #: kdecore/TIMEZONES:767 11118 #, kde-format 11119 msgid "Asia/Chongqing" 11120 msgstr "एशिया/चोंगकिंग" 11121 11122 #. i18n: comment to the previous timezone 11123 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11124 #, kde-format 11125 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11126 msgstr "" 11127 11128 #. i18n: comment to the previous timezone 11129 #: kdecore/TIMEZONES:771 11130 #, kde-format 11131 msgid "China mountains" 11132 msgstr "" 11133 11134 #: kdecore/TIMEZONES:772 11135 #, fuzzy, kde-format 11136 #| msgid "Asia/Chongqing" 11137 msgid "Asia/Chungking" 11138 msgstr "एशिया/चोंगकिंग" 11139 11140 #: kdecore/TIMEZONES:775 11141 #, kde-format 11142 msgid "Asia/Colombo" 11143 msgstr "एशिया/कोलोंबो" 11144 11145 #: kdecore/TIMEZONES:776 11146 #, fuzzy, kde-format 11147 #| msgid "Asia/Dhaka" 11148 msgid "Asia/Dacca" 11149 msgstr "एशिया/ढाका" 11150 11151 #: kdecore/TIMEZONES:777 11152 #, kde-format 11153 msgid "Asia/Damascus" 11154 msgstr "एशिया/डमास्कस" 11155 11156 #: kdecore/TIMEZONES:778 11157 #, kde-format 11158 msgid "Asia/Dhaka" 11159 msgstr "एशिया/ढाका" 11160 11161 #: kdecore/TIMEZONES:779 11162 #, kde-format 11163 msgid "Asia/Dili" 11164 msgstr "एशिया/दिली" 11165 11166 #: kdecore/TIMEZONES:780 11167 #, kde-format 11168 msgid "Asia/Dubai" 11169 msgstr "एशिया/दुबई" 11170 11171 #: kdecore/TIMEZONES:781 11172 #, fuzzy, kde-format 11173 #| msgid "Do shanbe" 11174 msgid "Asia/Dushanbe" 11175 msgstr "दुइ शान्बे" 11176 11177 #: kdecore/TIMEZONES:782 11178 #, fuzzy, kde-format 11179 #| msgid "Asia/Damascus" 11180 msgid "Asia/Famagusta" 11181 msgstr "एशिया/डमास्कस" 11182 11183 #. i18n: comment to the previous timezone 11184 #: kdecore/TIMEZONES:784 11185 #, kde-format 11186 msgid "Northern Cyprus" 11187 msgstr "" 11188 11189 #: kdecore/TIMEZONES:785 11190 #, kde-format 11191 msgid "Asia/Gaza" 11192 msgstr "एशिया/गाज़ा" 11193 11194 #. i18n: comment to the previous timezone 11195 #: kdecore/TIMEZONES:787 11196 #, kde-format 11197 msgid "Gaza Strip" 11198 msgstr "" 11199 11200 #: kdecore/TIMEZONES:788 11201 #, kde-format 11202 msgid "Asia/Harbin" 11203 msgstr "एशिया/हरबिन" 11204 11205 #. i18n: comment to the previous timezone 11206 #: kdecore/TIMEZONES:790 11207 #, kde-format 11208 msgid "Heilongjiang (except Mohe), Jilin" 11209 msgstr "" 11210 11211 #. i18n: comment to the previous timezone 11212 #: kdecore/TIMEZONES:792 11213 #, kde-format 11214 msgid "China north" 11215 msgstr "" 11216 11217 #: kdecore/TIMEZONES:793 11218 #, fuzzy, kde-format 11219 #| msgid "Asia/Harbin" 11220 msgid "Asia/Hebron" 11221 msgstr "एशिया/हरबिन" 11222 11223 #. i18n: comment to the previous timezone 11224 #: kdecore/TIMEZONES:795 11225 #, kde-format 11226 msgid "West Bank" 11227 msgstr "" 11228 11229 #: kdecore/TIMEZONES:796 11230 #, fuzzy, kde-format 11231 #| msgid "Asia/Chongqing" 11232 msgid "Asia/Ho_Chi_Minh" 11233 msgstr "एशिया/चोंगकिंग" 11234 11235 #: kdecore/TIMEZONES:797 11236 #, kde-format 11237 msgid "Asia/Hong_Kong" 11238 msgstr "एशिया/हॉंग_कॉंग" 11239 11240 #: kdecore/TIMEZONES:798 11241 #, kde-format 11242 msgid "Asia/Hovd" 11243 msgstr "एशिया/हावड" 11244 11245 #. i18n: comment to the previous timezone 11246 #: kdecore/TIMEZONES:800 11247 #, kde-format 11248 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11249 msgstr "" 11250 11251 #: kdecore/TIMEZONES:801 11252 #, kde-format 11253 msgid "Asia/Irkutsk" 11254 msgstr "एशिया/इरकुटस्क" 11255 11256 #. i18n: comment to the previous timezone 11257 #: kdecore/TIMEZONES:803 11258 #, kde-format 11259 msgid "Moscow+05 - Lake Baikal" 11260 msgstr "" 11261 11262 #. i18n: comment to the previous timezone 11263 #: kdecore/TIMEZONES:805 11264 #, kde-format 11265 msgid "MSK+05 - Irkutsk, Buryatia" 11266 msgstr "" 11267 11268 #: kdecore/TIMEZONES:806 11269 #, kde-format 11270 msgid "Asia/Jakarta" 11271 msgstr "एशिया/जकार्ता" 11272 11273 #. i18n: comment to the previous timezone 11274 #: kdecore/TIMEZONES:808 11275 #, kde-format 11276 msgid "Java & Sumatra" 11277 msgstr "" 11278 11279 #. i18n: comment to the previous timezone 11280 #: kdecore/TIMEZONES:810 11281 #, kde-format 11282 msgid "Java, Sumatra" 11283 msgstr "" 11284 11285 #: kdecore/TIMEZONES:811 11286 #, kde-format 11287 msgid "Asia/Jayapura" 11288 msgstr "एशिया/जयापुरा" 11289 11290 #. i18n: comment to the previous timezone 11291 #: kdecore/TIMEZONES:813 11292 #, kde-format 11293 msgid "Irian Jaya & the Moluccas" 11294 msgstr "" 11295 11296 #. i18n: comment to the previous timezone 11297 #: kdecore/TIMEZONES:815 11298 #, kde-format 11299 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11300 msgstr "" 11301 11302 #. i18n: comment to the previous timezone 11303 #: kdecore/TIMEZONES:817 11304 #, kde-format 11305 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11306 msgstr "" 11307 11308 #: kdecore/TIMEZONES:818 11309 #, kde-format 11310 msgid "Asia/Jerusalem" 11311 msgstr "एशिया/जेरुशलम" 11312 11313 #: kdecore/TIMEZONES:819 11314 #, kde-format 11315 msgid "Asia/Kabul" 11316 msgstr "एशिया/काबुल" 11317 11318 #: kdecore/TIMEZONES:820 11319 #, kde-format 11320 msgid "Asia/Kamchatka" 11321 msgstr "एशिया/कैमचटका" 11322 11323 #. i18n: comment to the previous timezone 11324 #: kdecore/TIMEZONES:822 11325 #, kde-format 11326 msgid "Moscow+09 - Kamchatka" 11327 msgstr "" 11328 11329 #. i18n: comment to the previous timezone 11330 #: kdecore/TIMEZONES:824 11331 #, kde-format 11332 msgid "Moscow+08 - Kamchatka" 11333 msgstr "" 11334 11335 #. i18n: comment to the previous timezone 11336 #: kdecore/TIMEZONES:826 11337 #, kde-format 11338 msgid "MSK+09 - Kamchatka" 11339 msgstr "" 11340 11341 #: kdecore/TIMEZONES:827 11342 #, kde-format 11343 msgid "Asia/Karachi" 11344 msgstr "एशिया/कराची" 11345 11346 #: kdecore/TIMEZONES:828 11347 #, kde-format 11348 msgid "Asia/Kashgar" 11349 msgstr "एशिया/काशगर" 11350 11351 #. i18n: comment to the previous timezone 11352 #: kdecore/TIMEZONES:830 11353 #, kde-format 11354 msgid "west Tibet & Xinjiang" 11355 msgstr "" 11356 11357 #. i18n: comment to the previous timezone 11358 #: kdecore/TIMEZONES:832 11359 #, kde-format 11360 msgid "China west Xinjiang" 11361 msgstr "" 11362 11363 #: kdecore/TIMEZONES:833 11364 #, fuzzy, kde-format 11365 #| msgid "Asia/Katmandu" 11366 msgid "Asia/Kathmandu" 11367 msgstr "एशिया/काठमांडू" 11368 11369 #: kdecore/TIMEZONES:834 11370 #, kde-format 11371 msgid "Asia/Katmandu" 11372 msgstr "एशिया/काठमांडू" 11373 11374 #: kdecore/TIMEZONES:835 11375 #, fuzzy, kde-format 11376 #| msgid "Asia/Shanghai" 11377 msgid "Asia/Khandyga" 11378 msgstr "एशिया/शैंघाई" 11379 11380 #. i18n: comment to the previous timezone 11381 #: kdecore/TIMEZONES:837 11382 #, kde-format 11383 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11384 msgstr "" 11385 11386 #: kdecore/TIMEZONES:838 11387 #, fuzzy, kde-format 11388 #| msgid "Asia/Jakarta" 11389 msgid "Asia/Kolkata" 11390 msgstr "एशिया/जकार्ता" 11391 11392 #: kdecore/TIMEZONES:839 11393 #, kde-format 11394 msgid "Asia/Krasnoyarsk" 11395 msgstr "एशिया/क्रास्नोयार्सक" 11396 11397 #. i18n: comment to the previous timezone 11398 #: kdecore/TIMEZONES:841 11399 #, kde-format 11400 msgid "Moscow+04 - Yenisei River" 11401 msgstr "" 11402 11403 #. i18n: comment to the previous timezone 11404 #: kdecore/TIMEZONES:843 11405 #, kde-format 11406 msgid "MSK+04 - Krasnoyarsk area" 11407 msgstr "" 11408 11409 #: kdecore/TIMEZONES:844 11410 #, kde-format 11411 msgid "Asia/Kuala_Lumpur" 11412 msgstr "एशिया/कौला_लामपुर" 11413 11414 #. i18n: comment to the previous timezone 11415 #: kdecore/TIMEZONES:846 11416 #, kde-format 11417 msgid "peninsular Malaysia" 11418 msgstr "" 11419 11420 #. i18n: comment to the previous timezone 11421 #: kdecore/TIMEZONES:848 11422 #, kde-format 11423 msgid "Malaysia (peninsula)" 11424 msgstr "" 11425 11426 #: kdecore/TIMEZONES:849 11427 #, kde-format 11428 msgid "Asia/Kuching" 11429 msgstr "एशिया/कुचिंग" 11430 11431 #. i18n: comment to the previous timezone 11432 #: kdecore/TIMEZONES:851 11433 #, kde-format 11434 msgid "Sabah & Sarawak" 11435 msgstr "" 11436 11437 #. i18n: comment to the previous timezone 11438 #: kdecore/TIMEZONES:853 11439 #, kde-format 11440 msgid "Sabah, Sarawak" 11441 msgstr "" 11442 11443 #: kdecore/TIMEZONES:854 11444 #, kde-format 11445 msgid "Asia/Kuwait" 11446 msgstr "एशिया/कुबैत" 11447 11448 #: kdecore/TIMEZONES:855 11449 #, fuzzy, kde-format 11450 #| msgid "Asia/Macau" 11451 msgid "Asia/Macao" 11452 msgstr "एशिया/मक्का" 11453 11454 #: kdecore/TIMEZONES:856 11455 #, kde-format 11456 msgid "Asia/Macau" 11457 msgstr "एशिया/मक्का" 11458 11459 #: kdecore/TIMEZONES:857 11460 #, kde-format 11461 msgid "Asia/Magadan" 11462 msgstr "एशिया/मगदान" 11463 11464 #. i18n: comment to the previous timezone 11465 #: kdecore/TIMEZONES:859 11466 #, kde-format 11467 msgid "Moscow+08 - Magadan" 11468 msgstr "" 11469 11470 #. i18n: comment to the previous timezone 11471 #: kdecore/TIMEZONES:861 11472 #, kde-format 11473 msgid "MSK+08 - Magadan" 11474 msgstr "" 11475 11476 #: kdecore/TIMEZONES:862 11477 #, kde-format 11478 msgid "Asia/Makassar" 11479 msgstr "एशिया/मकासार" 11480 11481 #. i18n: comment to the previous timezone 11482 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11483 #, kde-format 11484 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11485 msgstr "" 11486 11487 #. i18n: comment to the previous timezone 11488 #: kdecore/TIMEZONES:866 11489 #, kde-format 11490 msgid "" 11491 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11492 msgstr "" 11493 11494 #. i18n: comment to the previous timezone 11495 #: kdecore/TIMEZONES:868 11496 #, kde-format 11497 msgid "" 11498 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11499 msgstr "" 11500 11501 #: kdecore/TIMEZONES:869 11502 #, kde-format 11503 msgid "Asia/Manila" 11504 msgstr "एशिया/मनीला" 11505 11506 #: kdecore/TIMEZONES:870 11507 #, kde-format 11508 msgid "Asia/Muscat" 11509 msgstr "एशिया/मसकट" 11510 11511 #: kdecore/TIMEZONES:871 11512 #, kde-format 11513 msgid "Asia/Nicosia" 11514 msgstr "एशिया/निकोसिया" 11515 11516 #. i18n: comment to the previous timezone 11517 #: kdecore/TIMEZONES:873 11518 #, kde-format 11519 msgid "Cyprus (most areas)" 11520 msgstr "" 11521 11522 #: kdecore/TIMEZONES:874 11523 #, fuzzy, kde-format 11524 #| msgid "Asia/Irkutsk" 11525 msgid "Asia/Novokuznetsk" 11526 msgstr "एशिया/इरकुटस्क" 11527 11528 #. i18n: comment to the previous timezone 11529 #: kdecore/TIMEZONES:876 11530 #, fuzzy, kde-format 11531 #| msgid "Asia/Novosibirsk" 11532 msgid "Moscow+03 - Novokuznetsk" 11533 msgstr "एशिया/नोवोसिबिर्क" 11534 11535 #. i18n: comment to the previous timezone 11536 #: kdecore/TIMEZONES:878 11537 #, kde-format 11538 msgid "MSK+04 - Kemerovo" 11539 msgstr "" 11540 11541 #: kdecore/TIMEZONES:879 11542 #, kde-format 11543 msgid "Asia/Novosibirsk" 11544 msgstr "एशिया/नोवोसिबिर्क" 11545 11546 #. i18n: comment to the previous timezone 11547 #: kdecore/TIMEZONES:881 11548 #, fuzzy, kde-format 11549 #| msgid "Asia/Novosibirsk" 11550 msgid "Moscow+03 - Novosibirsk" 11551 msgstr "एशिया/नोवोसिबिर्क" 11552 11553 #. i18n: comment to the previous timezone 11554 #: kdecore/TIMEZONES:883 11555 #, fuzzy, kde-format 11556 #| msgid "Asia/Novosibirsk" 11557 msgid "MSK+04 - Novosibirsk" 11558 msgstr "एशिया/नोवोसिबिर्क" 11559 11560 #: kdecore/TIMEZONES:884 11561 #, kde-format 11562 msgid "Asia/Omsk" 11563 msgstr "एशिया/ओमस्क" 11564 11565 #. i18n: comment to the previous timezone 11566 #: kdecore/TIMEZONES:886 11567 #, kde-format 11568 msgid "Moscow+03 - west Siberia" 11569 msgstr "" 11570 11571 #. i18n: comment to the previous timezone 11572 #: kdecore/TIMEZONES:888 11573 #, kde-format 11574 msgid "MSK+03 - Omsk" 11575 msgstr "" 11576 11577 #: kdecore/TIMEZONES:889 11578 #, kde-format 11579 msgid "Asia/Oral" 11580 msgstr "एशिया/ऑराल" 11581 11582 #. i18n: comment to the previous timezone 11583 #: kdecore/TIMEZONES:891 11584 #, kde-format 11585 msgid "West Kazakhstan" 11586 msgstr "" 11587 11588 #: kdecore/TIMEZONES:892 11589 #, kde-format 11590 msgid "Asia/Phnom_Penh" 11591 msgstr "एशिया/फेनॉम_पेनह" 11592 11593 #: kdecore/TIMEZONES:893 11594 #, kde-format 11595 msgid "Asia/Pontianak" 11596 msgstr "एशिया/पांटिआनाक" 11597 11598 #. i18n: comment to the previous timezone 11599 #: kdecore/TIMEZONES:895 11600 #, kde-format 11601 msgid "west & central Borneo" 11602 msgstr "" 11603 11604 #. i18n: comment to the previous timezone 11605 #: kdecore/TIMEZONES:897 11606 #, kde-format 11607 msgid "Borneo (west, central)" 11608 msgstr "" 11609 11610 #: kdecore/TIMEZONES:898 11611 #, kde-format 11612 msgid "Asia/Pyongyang" 11613 msgstr "एशिया/प्योंगयाग" 11614 11615 #: kdecore/TIMEZONES:899 11616 #, kde-format 11617 msgid "Asia/Qatar" 11618 msgstr "एशिया/क़तर" 11619 11620 #: kdecore/TIMEZONES:900 11621 #, fuzzy, kde-format 11622 #| msgid "Asia/Pontianak" 11623 msgid "Asia/Qostanay" 11624 msgstr "एशिया/पांटिआनाक" 11625 11626 #. i18n: comment to the previous timezone 11627 #: kdecore/TIMEZONES:902 11628 #, kde-format 11629 msgid "Qostanay/Kostanay/Kustanay" 11630 msgstr "" 11631 11632 #: kdecore/TIMEZONES:903 11633 #, kde-format 11634 msgid "Asia/Qyzylorda" 11635 msgstr "एशिया/क़्योज़ाइलोर्डा" 11636 11637 #. i18n: comment to the previous timezone 11638 #: kdecore/TIMEZONES:905 11639 #, kde-format 11640 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11641 msgstr "" 11642 11643 #. i18n: comment to the previous timezone 11644 #: kdecore/TIMEZONES:907 11645 #, kde-format 11646 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11647 msgstr "" 11648 11649 #: kdecore/TIMEZONES:908 11650 #, kde-format 11651 msgid "Asia/Rangoon" 11652 msgstr "एशिया/रंगून" 11653 11654 #: kdecore/TIMEZONES:909 11655 #, kde-format 11656 msgid "Asia/Riyadh" 11657 msgstr "एशिया/रियाद" 11658 11659 #: kdecore/TIMEZONES:910 11660 #, kde-format 11661 msgid "Asia/Saigon" 11662 msgstr "एशिया/साइगॉन" 11663 11664 #: kdecore/TIMEZONES:911 11665 #, kde-format 11666 msgid "Asia/Sakhalin" 11667 msgstr "एशिया/सकहालिन" 11668 11669 #. i18n: comment to the previous timezone 11670 #: kdecore/TIMEZONES:913 11671 #, kde-format 11672 msgid "Moscow+07 - Sakhalin Island" 11673 msgstr "" 11674 11675 #. i18n: comment to the previous timezone 11676 #: kdecore/TIMEZONES:915 11677 #, kde-format 11678 msgid "MSK+08 - Sakhalin Island" 11679 msgstr "" 11680 11681 #: kdecore/TIMEZONES:916 11682 #, kde-format 11683 msgid "Asia/Samarkand" 11684 msgstr "एशिया/समरकंद" 11685 11686 #. i18n: comment to the previous timezone 11687 #: kdecore/TIMEZONES:918 11688 #, kde-format 11689 msgid "west Uzbekistan" 11690 msgstr "" 11691 11692 #. i18n: comment to the previous timezone 11693 #: kdecore/TIMEZONES:920 11694 #, kde-format 11695 msgid "Uzbekistan (west)" 11696 msgstr "" 11697 11698 #: kdecore/TIMEZONES:921 11699 #, kde-format 11700 msgid "Asia/Seoul" 11701 msgstr "एशिया/सियोल" 11702 11703 #: kdecore/TIMEZONES:922 11704 #, kde-format 11705 msgid "Asia/Shanghai" 11706 msgstr "एशिया/शैंघाई" 11707 11708 #. i18n: comment to the previous timezone 11709 #: kdecore/TIMEZONES:926 11710 #, kde-format 11711 msgid "China east" 11712 msgstr "" 11713 11714 #. i18n: comment to the previous timezone 11715 #: kdecore/TIMEZONES:928 11716 #, kde-format 11717 msgid "Beijing Time" 11718 msgstr "" 11719 11720 #: kdecore/TIMEZONES:929 11721 #, kde-format 11722 msgid "Asia/Singapore" 11723 msgstr "एशिया/सिंगापुर" 11724 11725 #: kdecore/TIMEZONES:930 11726 #, fuzzy, kde-format 11727 #| msgid "Asia/Krasnoyarsk" 11728 msgid "Asia/Srednekolymsk" 11729 msgstr "एशिया/क्रास्नोयार्सक" 11730 11731 #. i18n: comment to the previous timezone 11732 #: kdecore/TIMEZONES:932 11733 #, kde-format 11734 msgid "MSK+08 - Sakha (E); North Kuril Is" 11735 msgstr "" 11736 11737 #: kdecore/TIMEZONES:933 11738 #, kde-format 11739 msgid "Asia/Taipei" 11740 msgstr "एशिया/ताइवान" 11741 11742 #: kdecore/TIMEZONES:934 11743 #, kde-format 11744 msgid "Asia/Tashkent" 11745 msgstr "एशिया/ताशकंद" 11746 11747 #. i18n: comment to the previous timezone 11748 #: kdecore/TIMEZONES:936 11749 #, kde-format 11750 msgid "east Uzbekistan" 11751 msgstr "" 11752 11753 #. i18n: comment to the previous timezone 11754 #: kdecore/TIMEZONES:938 11755 #, kde-format 11756 msgid "Uzbekistan (east)" 11757 msgstr "" 11758 11759 #: kdecore/TIMEZONES:939 11760 #, kde-format 11761 msgid "Asia/Tbilisi" 11762 msgstr "एशिया/बिलिसी" 11763 11764 #: kdecore/TIMEZONES:940 11765 #, kde-format 11766 msgid "Asia/Tehran" 11767 msgstr "एशिया/तेहरान" 11768 11769 #: kdecore/TIMEZONES:941 11770 #, fuzzy, kde-format 11771 #| msgid "Asia/Taipei" 11772 msgid "Asia/Tel_Aviv" 11773 msgstr "एशिया/ताइवान" 11774 11775 #: kdecore/TIMEZONES:942 11776 #, fuzzy, kde-format 11777 #| msgid "Asia/Thimphu" 11778 msgid "Asia/Thimbu" 11779 msgstr "एशिया/थिमफू" 11780 11781 #: kdecore/TIMEZONES:943 11782 #, kde-format 11783 msgid "Asia/Thimphu" 11784 msgstr "एशिया/थिमफू" 11785 11786 #: kdecore/TIMEZONES:944 11787 #, kde-format 11788 msgid "Asia/Tokyo" 11789 msgstr "एशिया/टोक्यो" 11790 11791 #: kdecore/TIMEZONES:945 11792 #, fuzzy, kde-format 11793 #| msgid "Asia/Omsk" 11794 msgid "Asia/Tomsk" 11795 msgstr "एशिया/ओमस्क" 11796 11797 #. i18n: comment to the previous timezone 11798 #: kdecore/TIMEZONES:947 11799 #, kde-format 11800 msgid "MSK+04 - Tomsk" 11801 msgstr "" 11802 11803 #: kdecore/TIMEZONES:948 11804 #, kde-format 11805 msgid "Asia/Ujung_Pandang" 11806 msgstr "एशिया/उजंग_पंगडांग" 11807 11808 #: kdecore/TIMEZONES:951 11809 #, kde-format 11810 msgid "Asia/Ulaanbaatar" 11811 msgstr "एशिया/उलानबाटर" 11812 11813 #. i18n: comment to the previous timezone 11814 #: kdecore/TIMEZONES:955 11815 #, kde-format 11816 msgid "Mongolia (most areas)" 11817 msgstr "" 11818 11819 #: kdecore/TIMEZONES:956 11820 #, fuzzy, kde-format 11821 #| msgid "Asia/Ulaanbaatar" 11822 msgid "Asia/Ulan_Bator" 11823 msgstr "एशिया/उलानबाटर" 11824 11825 #: kdecore/TIMEZONES:959 11826 #, kde-format 11827 msgid "Asia/Urumqi" 11828 msgstr "एशिया/उरुंगी" 11829 11830 #. i18n: comment to the previous timezone 11831 #: kdecore/TIMEZONES:961 11832 #, kde-format 11833 msgid "most of Tibet & Xinjiang" 11834 msgstr "" 11835 11836 #. i18n: comment to the previous timezone 11837 #: kdecore/TIMEZONES:963 11838 #, kde-format 11839 msgid "China Xinjiang-Tibet" 11840 msgstr "" 11841 11842 #. i18n: comment to the previous timezone 11843 #: kdecore/TIMEZONES:965 11844 #, kde-format 11845 msgid "Xinjiang Time" 11846 msgstr "" 11847 11848 #: kdecore/TIMEZONES:966 11849 #, fuzzy, kde-format 11850 #| msgid "Asia/Tehran" 11851 msgid "Asia/Ust-Nera" 11852 msgstr "एशिया/तेहरान" 11853 11854 #. i18n: comment to the previous timezone 11855 #: kdecore/TIMEZONES:968 11856 #, kde-format 11857 msgid "MSK+07 - Oymyakonsky" 11858 msgstr "" 11859 11860 #: kdecore/TIMEZONES:969 11861 #, kde-format 11862 msgid "Asia/Vientiane" 11863 msgstr "एशिया/वियतनाम" 11864 11865 #: kdecore/TIMEZONES:970 11866 #, kde-format 11867 msgid "Asia/Vladivostok" 11868 msgstr "एशिया/वलादिवोस्टोक" 11869 11870 #. i18n: comment to the previous timezone 11871 #: kdecore/TIMEZONES:972 11872 #, kde-format 11873 msgid "Moscow+07 - Amur River" 11874 msgstr "" 11875 11876 #. i18n: comment to the previous timezone 11877 #: kdecore/TIMEZONES:974 11878 #, kde-format 11879 msgid "MSK+07 - Amur River" 11880 msgstr "" 11881 11882 #: kdecore/TIMEZONES:975 11883 #, kde-format 11884 msgid "Asia/Yakutsk" 11885 msgstr "एशिया/याकुटस्क" 11886 11887 #. i18n: comment to the previous timezone 11888 #: kdecore/TIMEZONES:977 11889 #, kde-format 11890 msgid "Moscow+06 - Lena River" 11891 msgstr "" 11892 11893 #. i18n: comment to the previous timezone 11894 #: kdecore/TIMEZONES:979 11895 #, kde-format 11896 msgid "MSK+06 - Lena River" 11897 msgstr "" 11898 11899 #: kdecore/TIMEZONES:980 11900 #, fuzzy, kde-format 11901 #| msgid "Asia/Rangoon" 11902 msgid "Asia/Yangon" 11903 msgstr "एशिया/रंगून" 11904 11905 #: kdecore/TIMEZONES:981 11906 #, kde-format 11907 msgid "Asia/Yekaterinburg" 11908 msgstr "एशिया/येकाटेरिंबर्ग" 11909 11910 #. i18n: comment to the previous timezone 11911 #: kdecore/TIMEZONES:983 11912 #, kde-format 11913 msgid "Moscow+02 - Urals" 11914 msgstr "" 11915 11916 #. i18n: comment to the previous timezone 11917 #: kdecore/TIMEZONES:985 11918 #, kde-format 11919 msgid "MSK+02 - Urals" 11920 msgstr "" 11921 11922 #: kdecore/TIMEZONES:986 11923 #, kde-format 11924 msgid "Asia/Yerevan" 11925 msgstr "एशिया/येरेवन" 11926 11927 #: kdecore/TIMEZONES:987 11928 #, kde-format 11929 msgid "Atlantic/Azores" 11930 msgstr "अटलांटिक/अज़ोरेस" 11931 11932 #. i18n: comment to the previous timezone 11933 #: kdecore/TIMEZONES:989 11934 #, kde-format 11935 msgid "Azores" 11936 msgstr "" 11937 11938 #: kdecore/TIMEZONES:990 11939 #, kde-format 11940 msgid "Atlantic/Bermuda" 11941 msgstr "अटलांटिक/बरमुडा" 11942 11943 #: kdecore/TIMEZONES:991 11944 #, kde-format 11945 msgid "Atlantic/Canary" 11946 msgstr "अटलांटिक/कैनरी" 11947 11948 #. i18n: comment to the previous timezone 11949 #: kdecore/TIMEZONES:993 11950 #, kde-format 11951 msgid "Canary Islands" 11952 msgstr "" 11953 11954 #: kdecore/TIMEZONES:994 11955 #, kde-format 11956 msgid "Atlantic/Cape_Verde" 11957 msgstr "अमेरिका/केप_वर्डे" 11958 11959 #: kdecore/TIMEZONES:995 11960 #, kde-format 11961 msgid "Atlantic/Faeroe" 11962 msgstr "अटलांटिक/फाएरे" 11963 11964 #: kdecore/TIMEZONES:996 11965 #, kde-format 11966 msgid "Atlantic/Faroe" 11967 msgstr "अटलांटिक/फरोए" 11968 11969 #: kdecore/TIMEZONES:997 11970 #, kde-format 11971 msgid "Atlantic/Jan_Mayen" 11972 msgstr "अटलांटिक/जैन_मायेन" 11973 11974 #: kdecore/TIMEZONES:998 11975 #, kde-format 11976 msgid "Atlantic/Madeira" 11977 msgstr "अटलांटिक/मैडेरा" 11978 11979 #. i18n: comment to the previous timezone 11980 #: kdecore/TIMEZONES:1000 11981 #, kde-format 11982 msgid "Madeira Islands" 11983 msgstr "" 11984 11985 #: kdecore/TIMEZONES:1001 11986 #, kde-format 11987 msgid "Atlantic/Reykjavik" 11988 msgstr "अटलांटिक/रेकजाविक" 11989 11990 #: kdecore/TIMEZONES:1002 11991 #, kde-format 11992 msgid "Atlantic/South_Georgia" 11993 msgstr "अटलांटिक/साउथ_जोर्जिया" 11994 11995 #: kdecore/TIMEZONES:1003 11996 #, kde-format 11997 msgid "Atlantic/St_Helena" 11998 msgstr "अटलांटिक/सेंट_हेलेना" 11999 12000 #: kdecore/TIMEZONES:1004 12001 #, kde-format 12002 msgid "Atlantic/Stanley" 12003 msgstr "अटलांटिक/स्टांले" 12004 12005 #: kdecore/TIMEZONES:1005 12006 #, fuzzy, kde-format 12007 #| msgid "Australia/Currie" 12008 msgid "Australia/ACT" 12009 msgstr "ऑस्ट्रेलिया/क्यूरी" 12010 12011 #. i18n: comment to the previous timezone 12012 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12013 #: kdecore/TIMEZONES:1073 12014 #, kde-format 12015 msgid "New South Wales - most locations" 12016 msgstr "" 12017 12018 #: kdecore/TIMEZONES:1008 12019 #, kde-format 12020 msgid "Australia/Adelaide" 12021 msgstr "ऑस्ट्रेलिया/एडलेड" 12022 12023 #. i18n: comment to the previous timezone 12024 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12025 #, fuzzy, kde-format 12026 #| msgid "Australia/Eucla" 12027 msgid "South Australia" 12028 msgstr "ऑस्ट्रेलिया/युक्ला" 12029 12030 #: kdecore/TIMEZONES:1011 12031 #, kde-format 12032 msgid "Australia/Brisbane" 12033 msgstr "ऑस्ट्रेलिया/ब्रिसबन" 12034 12035 #. i18n: comment to the previous timezone 12036 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12037 #, kde-format 12038 msgid "Queensland - most locations" 12039 msgstr "" 12040 12041 #. i18n: comment to the previous timezone 12042 #: kdecore/TIMEZONES:1015 12043 #, kde-format 12044 msgid "Queensland (most areas)" 12045 msgstr "" 12046 12047 #: kdecore/TIMEZONES:1016 12048 #, kde-format 12049 msgid "Australia/Broken_Hill" 12050 msgstr "ऑस्ट्रेलिया/ब्रोकन_हिल" 12051 12052 #. i18n: comment to the previous timezone 12053 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12054 #, kde-format 12055 msgid "New South Wales - Yancowinna" 12056 msgstr "" 12057 12058 #. i18n: comment to the previous timezone 12059 #: kdecore/TIMEZONES:1020 12060 #, kde-format 12061 msgid "New South Wales (Yancowinna)" 12062 msgstr "" 12063 12064 #: kdecore/TIMEZONES:1021 12065 #, fuzzy, kde-format 12066 #| msgid "Australia/Currie" 12067 msgid "Australia/Canberra" 12068 msgstr "ऑस्ट्रेलिया/क्यूरी" 12069 12070 #: kdecore/TIMEZONES:1024 12071 #, kde-format 12072 msgid "Australia/Currie" 12073 msgstr "ऑस्ट्रेलिया/क्यूरी" 12074 12075 #. i18n: comment to the previous timezone 12076 #: kdecore/TIMEZONES:1026 12077 #, kde-format 12078 msgid "Tasmania - King Island" 12079 msgstr "" 12080 12081 #: kdecore/TIMEZONES:1027 12082 #, kde-format 12083 msgid "Australia/Darwin" 12084 msgstr "ऑस्ट्रेलिया/डार्विन" 12085 12086 #. i18n: comment to the previous timezone 12087 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12088 #, kde-format 12089 msgid "Northern Territory" 12090 msgstr "" 12091 12092 #: kdecore/TIMEZONES:1030 12093 #, kde-format 12094 msgid "Australia/Eucla" 12095 msgstr "ऑस्ट्रेलिया/युक्ला" 12096 12097 #. i18n: comment to the previous timezone 12098 #: kdecore/TIMEZONES:1032 12099 #, fuzzy, kde-format 12100 #| msgid "Australia/Eucla" 12101 msgid "Western Australia - Eucla area" 12102 msgstr "ऑस्ट्रेलिया/युक्ला" 12103 12104 #. i18n: comment to the previous timezone 12105 #: kdecore/TIMEZONES:1034 12106 #, fuzzy, kde-format 12107 #| msgid "Australia/Eucla" 12108 msgid "Western Australia (Eucla)" 12109 msgstr "ऑस्ट्रेलिया/युक्ला" 12110 12111 #: kdecore/TIMEZONES:1035 12112 #, kde-format 12113 msgid "Australia/Hobart" 12114 msgstr "ऑस्ट्रेलिया/हॉबर्ट" 12115 12116 #. i18n: comment to the previous timezone 12117 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12118 #, kde-format 12119 msgid "Tasmania - most locations" 12120 msgstr "" 12121 12122 #. i18n: comment to the previous timezone 12123 #: kdecore/TIMEZONES:1039 12124 #, fuzzy, kde-format 12125 #| msgid "Australia/Brisbane" 12126 msgid "Tasmania" 12127 msgstr "ऑस्ट्रेलिया/ब्रिसबन" 12128 12129 #: kdecore/TIMEZONES:1040 12130 #, fuzzy, kde-format 12131 #| msgid "Australia/Hobart" 12132 msgid "Australia/LHI" 12133 msgstr "ऑस्ट्रेलिया/हॉबर्ट" 12134 12135 #. i18n: comment to the previous timezone 12136 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12137 #, kde-format 12138 msgid "Lord Howe Island" 12139 msgstr "" 12140 12141 #: kdecore/TIMEZONES:1043 12142 #, kde-format 12143 msgid "Australia/Lindeman" 12144 msgstr "ऑस्ट्रेलिया/लिंडमन" 12145 12146 #. i18n: comment to the previous timezone 12147 #: kdecore/TIMEZONES:1045 12148 #, kde-format 12149 msgid "Queensland - Holiday Islands" 12150 msgstr "" 12151 12152 #. i18n: comment to the previous timezone 12153 #: kdecore/TIMEZONES:1047 12154 #, kde-format 12155 msgid "Queensland (Whitsunday Islands)" 12156 msgstr "" 12157 12158 #: kdecore/TIMEZONES:1048 12159 #, kde-format 12160 msgid "Australia/Lord_Howe" 12161 msgstr "ऑस्ट्रेलिया/लॉर्ड_हॉव" 12162 12163 #: kdecore/TIMEZONES:1051 12164 #, kde-format 12165 msgid "Australia/Melbourne" 12166 msgstr "ऑस्ट्रेलिया/मेलबर्न" 12167 12168 #. i18n: comment to the previous timezone 12169 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12170 #, kde-format 12171 msgid "Victoria" 12172 msgstr "" 12173 12174 #: kdecore/TIMEZONES:1054 12175 #, fuzzy, kde-format 12176 #| msgid "Australia/Sydney" 12177 msgid "Australia/NSW" 12178 msgstr "ऑस्ट्रेलिया/सिडनी" 12179 12180 #: kdecore/TIMEZONES:1057 12181 #, fuzzy, kde-format 12182 #| msgid "Australia/Perth" 12183 msgid "Australia/North" 12184 msgstr "ऑस्ट्रेलिया/पर्थ" 12185 12186 #: kdecore/TIMEZONES:1060 12187 #, kde-format 12188 msgid "Australia/Perth" 12189 msgstr "ऑस्ट्रेलिया/पर्थ" 12190 12191 #. i18n: comment to the previous timezone 12192 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12193 #, kde-format 12194 msgid "Western Australia - most locations" 12195 msgstr "" 12196 12197 #. i18n: comment to the previous timezone 12198 #: kdecore/TIMEZONES:1064 12199 #, fuzzy, kde-format 12200 #| msgid "Australia/Eucla" 12201 msgid "Western Australia (most areas)" 12202 msgstr "ऑस्ट्रेलिया/युक्ला" 12203 12204 #: kdecore/TIMEZONES:1065 12205 #, fuzzy, kde-format 12206 #| msgid "Australia/Eucla" 12207 msgid "Australia/Queensland" 12208 msgstr "ऑस्ट्रेलिया/युक्ला" 12209 12210 #: kdecore/TIMEZONES:1068 12211 #, fuzzy, kde-format 12212 #| msgid "Australia/Perth" 12213 msgid "Australia/South" 12214 msgstr "ऑस्ट्रेलिया/पर्थ" 12215 12216 #: kdecore/TIMEZONES:1071 12217 #, kde-format 12218 msgid "Australia/Sydney" 12219 msgstr "ऑस्ट्रेलिया/सिडनी" 12220 12221 #. i18n: comment to the previous timezone 12222 #: kdecore/TIMEZONES:1075 12223 #, kde-format 12224 msgid "New South Wales (most areas)" 12225 msgstr "" 12226 12227 #: kdecore/TIMEZONES:1076 12228 #, fuzzy, kde-format 12229 #| msgid "Australia/Brisbane" 12230 msgid "Australia/Tasmania" 12231 msgstr "ऑस्ट्रेलिया/ब्रिसबन" 12232 12233 #: kdecore/TIMEZONES:1079 12234 #, fuzzy, kde-format 12235 #| msgid "Australia/Eucla" 12236 msgid "Australia/Victoria" 12237 msgstr "ऑस्ट्रेलिया/युक्ला" 12238 12239 #: kdecore/TIMEZONES:1082 12240 #, fuzzy, kde-format 12241 #| msgid "Australia/Perth" 12242 msgid "Australia/West" 12243 msgstr "ऑस्ट्रेलिया/पर्थ" 12244 12245 #: kdecore/TIMEZONES:1085 12246 #, fuzzy, kde-format 12247 #| msgid "Australia/Darwin" 12248 msgid "Australia/Yancowinna" 12249 msgstr "ऑस्ट्रेलिया/डार्विन" 12250 12251 #: kdecore/TIMEZONES:1088 12252 #, kde-format 12253 msgid "Brazil/Acre" 12254 msgstr "" 12255 12256 #: kdecore/TIMEZONES:1091 12257 #, fuzzy, kde-format 12258 #| msgid "America/Noronha" 12259 msgid "Brazil/DeNoronha" 12260 msgstr "अमेरिका/नॉरॉनहा" 12261 12262 #: kdecore/TIMEZONES:1094 12263 #, kde-format 12264 msgid "Brazil/East" 12265 msgstr "" 12266 12267 #: kdecore/TIMEZONES:1097 12268 #, kde-format 12269 msgid "Brazil/West" 12270 msgstr "" 12271 12272 #: kdecore/TIMEZONES:1100 12273 #, kde-format 12274 msgid "Canada/Atlantic" 12275 msgstr "" 12276 12277 #: kdecore/TIMEZONES:1103 12278 #, kde-format 12279 msgid "Canada/Central" 12280 msgstr "" 12281 12282 #: kdecore/TIMEZONES:1106 12283 #, kde-format 12284 msgid "Canada/East-Saskatchewan" 12285 msgstr "" 12286 12287 #: kdecore/TIMEZONES:1109 12288 #, kde-format 12289 msgid "Canada/Eastern" 12290 msgstr "" 12291 12292 #: kdecore/TIMEZONES:1112 12293 #, kde-format 12294 msgid "Canada/Mountain" 12295 msgstr "" 12296 12297 #: kdecore/TIMEZONES:1115 12298 #, kde-format 12299 msgid "Canada/Newfoundland" 12300 msgstr "" 12301 12302 #: kdecore/TIMEZONES:1118 12303 #, kde-format 12304 msgid "Canada/Pacific" 12305 msgstr "" 12306 12307 #: kdecore/TIMEZONES:1121 12308 #, kde-format 12309 msgid "Canada/Saskatchewan" 12310 msgstr "" 12311 12312 #: kdecore/TIMEZONES:1124 12313 #, kde-format 12314 msgid "Canada/Yukon" 12315 msgstr "" 12316 12317 #: kdecore/TIMEZONES:1127 12318 #, kde-format 12319 msgid "Chile/Continental" 12320 msgstr "" 12321 12322 #: kdecore/TIMEZONES:1130 12323 #, kde-format 12324 msgid "Chile/EasterIsland" 12325 msgstr "" 12326 12327 #. i18n: comment to the previous timezone 12328 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12329 #, kde-format 12330 msgid "Easter Island & Sala y Gomez" 12331 msgstr "" 12332 12333 #: kdecore/TIMEZONES:1133 12334 #, kde-format 12335 msgid "Cuba" 12336 msgstr "" 12337 12338 #: kdecore/TIMEZONES:1134 12339 #, kde-format 12340 msgid "Egypt" 12341 msgstr "" 12342 12343 #: kdecore/TIMEZONES:1135 12344 #, kde-format 12345 msgid "Eire" 12346 msgstr "" 12347 12348 #: kdecore/TIMEZONES:1136 12349 #, kde-format 12350 msgid "Europe/Amsterdam" 12351 msgstr "यूरोप/एमस्टरडम" 12352 12353 #: kdecore/TIMEZONES:1137 12354 #, kde-format 12355 msgid "Europe/Andorra" 12356 msgstr "यूरोप/एंडोरा" 12357 12358 #: kdecore/TIMEZONES:1138 12359 #, fuzzy, kde-format 12360 #| msgid "Europe/Athens" 12361 msgid "Europe/Astrakhan" 12362 msgstr "यूरोप/एथेंस" 12363 12364 #. i18n: comment to the previous timezone 12365 #: kdecore/TIMEZONES:1140 12366 #, kde-format 12367 msgid "MSK+01 - Astrakhan" 12368 msgstr "" 12369 12370 #: kdecore/TIMEZONES:1141 12371 #, kde-format 12372 msgid "Europe/Athens" 12373 msgstr "यूरोप/एथेंस" 12374 12375 #: kdecore/TIMEZONES:1142 12376 #, kde-format 12377 msgid "Europe/Belfast" 12378 msgstr "यूरोप/बेलफास्ट" 12379 12380 #: kdecore/TIMEZONES:1143 12381 #, kde-format 12382 msgid "Europe/Belgrade" 12383 msgstr "यूरोप/बेलग्रेड" 12384 12385 #: kdecore/TIMEZONES:1144 12386 #, kde-format 12387 msgid "Europe/Berlin" 12388 msgstr "यूरोप/बर्लिन" 12389 12390 #. i18n: comment to the previous timezone 12391 #: kdecore/TIMEZONES:1146 12392 #, kde-format 12393 msgid "Germany (most areas)" 12394 msgstr "" 12395 12396 #: kdecore/TIMEZONES:1147 12397 #, kde-format 12398 msgid "Europe/Bratislava" 12399 msgstr "यूरोप/ब्राटिस्लवा" 12400 12401 #: kdecore/TIMEZONES:1148 12402 #, kde-format 12403 msgid "Europe/Brussels" 12404 msgstr "यूरोप/ब्रुसल्स" 12405 12406 #: kdecore/TIMEZONES:1149 12407 #, kde-format 12408 msgid "Europe/Bucharest" 12409 msgstr "यूरोप/बुचारेस्ट" 12410 12411 #: kdecore/TIMEZONES:1150 12412 #, kde-format 12413 msgid "Europe/Budapest" 12414 msgstr "यूरोप/बुडापेस्ट" 12415 12416 #: kdecore/TIMEZONES:1151 12417 #, fuzzy, kde-format 12418 #| msgid "Europe/Brussels" 12419 msgid "Europe/Busingen" 12420 msgstr "यूरोप/ब्रुसल्स" 12421 12422 #. i18n: comment to the previous timezone 12423 #: kdecore/TIMEZONES:1153 12424 #, kde-format 12425 msgid "Busingen" 12426 msgstr "" 12427 12428 #: kdecore/TIMEZONES:1154 12429 #, kde-format 12430 msgid "Europe/Chisinau" 12431 msgstr "यूरोप/चिसिंनाउ" 12432 12433 #: kdecore/TIMEZONES:1155 12434 #, kde-format 12435 msgid "Europe/Copenhagen" 12436 msgstr "यूरोप/कोपेनहागन" 12437 12438 #: kdecore/TIMEZONES:1156 12439 #, kde-format 12440 msgid "Europe/Dublin" 12441 msgstr "यूरोप/डबलिन" 12442 12443 #: kdecore/TIMEZONES:1157 12444 #, kde-format 12445 msgid "Europe/Gibraltar" 12446 msgstr "यूरोप/गिब्रालटर" 12447 12448 #: kdecore/TIMEZONES:1158 12449 #, kde-format 12450 msgid "Europe/Guernsey" 12451 msgstr "यूरोप/गुयरेंसी" 12452 12453 #: kdecore/TIMEZONES:1159 12454 #, kde-format 12455 msgid "Europe/Helsinki" 12456 msgstr "यूरोप/हेलसिंकी" 12457 12458 #: kdecore/TIMEZONES:1160 12459 #, kde-format 12460 msgid "Europe/Isle_of_Man" 12461 msgstr "यूरोप/आइल_आफ_मैन" 12462 12463 #: kdecore/TIMEZONES:1161 12464 #, kde-format 12465 msgid "Europe/Istanbul" 12466 msgstr "यूरोप/इसतानबुल" 12467 12468 #: kdecore/TIMEZONES:1162 12469 #, kde-format 12470 msgid "Europe/Jersey" 12471 msgstr "यूरोप/जर्सी" 12472 12473 #: kdecore/TIMEZONES:1163 12474 #, kde-format 12475 msgid "Europe/Kaliningrad" 12476 msgstr "यूरोप/कैलिनिंग्राद" 12477 12478 #. i18n: comment to the previous timezone 12479 #: kdecore/TIMEZONES:1165 12480 #, kde-format 12481 msgid "Moscow-01 - Kaliningrad" 12482 msgstr "" 12483 12484 #. i18n: comment to the previous timezone 12485 #: kdecore/TIMEZONES:1167 12486 #, kde-format 12487 msgid "MSK-01 - Kaliningrad" 12488 msgstr "" 12489 12490 #: kdecore/TIMEZONES:1168 12491 #, kde-format 12492 msgid "Europe/Kiev" 12493 msgstr "यूरोप/केव" 12494 12495 #. i18n: comment to the previous timezone 12496 #: kdecore/TIMEZONES:1172 12497 #, kde-format 12498 msgid "Ukraine (most areas)" 12499 msgstr "" 12500 12501 #: kdecore/TIMEZONES:1173 12502 #, fuzzy, kde-format 12503 #| msgid "Europe/Kiev" 12504 msgid "Europe/Kirov" 12505 msgstr "यूरोप/केव" 12506 12507 #. i18n: comment to the previous timezone 12508 #: kdecore/TIMEZONES:1175 12509 #, kde-format 12510 msgid "MSK+00 - Kirov" 12511 msgstr "" 12512 12513 #: kdecore/TIMEZONES:1176 12514 #, kde-format 12515 msgid "Europe/Lisbon" 12516 msgstr "यूरोप/लिस्बन" 12517 12518 #. i18n: comment to the previous timezone 12519 #: kdecore/TIMEZONES:1180 12520 #, kde-format 12521 msgid "Portugal (mainland)" 12522 msgstr "" 12523 12524 #: kdecore/TIMEZONES:1181 12525 #, kde-format 12526 msgid "Europe/Ljubljana" 12527 msgstr "यूरोप/ज़ुबज़ाना" 12528 12529 #: kdecore/TIMEZONES:1182 12530 #, kde-format 12531 msgid "Europe/London" 12532 msgstr "यूरोप/लंडन" 12533 12534 #: kdecore/TIMEZONES:1183 12535 #, kde-format 12536 msgid "Europe/Luxembourg" 12537 msgstr "यूरोप/लक्सेमबर्ग" 12538 12539 #: kdecore/TIMEZONES:1184 12540 #, kde-format 12541 msgid "Europe/Madrid" 12542 msgstr "यूरोप/मैड्रिड" 12543 12544 #. i18n: comment to the previous timezone 12545 #: kdecore/TIMEZONES:1188 12546 #, kde-format 12547 msgid "Spain (mainland)" 12548 msgstr "" 12549 12550 #: kdecore/TIMEZONES:1189 12551 #, kde-format 12552 msgid "Europe/Malta" 12553 msgstr "यूरोप/मालटा" 12554 12555 #: kdecore/TIMEZONES:1190 12556 #, kde-format 12557 msgid "Europe/Mariehamn" 12558 msgstr "यूरोप/मरेयहेम" 12559 12560 #: kdecore/TIMEZONES:1191 12561 #, kde-format 12562 msgid "Europe/Minsk" 12563 msgstr "यूरोप/मिंस्क" 12564 12565 #: kdecore/TIMEZONES:1192 12566 #, kde-format 12567 msgid "Europe/Monaco" 12568 msgstr "यूरोप/मोनाको" 12569 12570 #: kdecore/TIMEZONES:1193 12571 #, kde-format 12572 msgid "Europe/Moscow" 12573 msgstr "यूरोप/मास्को" 12574 12575 #. i18n: comment to the previous timezone 12576 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12577 #, kde-format 12578 msgid "Moscow+00 - west Russia" 12579 msgstr "" 12580 12581 #. i18n: comment to the previous timezone 12582 #: kdecore/TIMEZONES:1197 12583 #, kde-format 12584 msgid "MSK+00 - Moscow area" 12585 msgstr "" 12586 12587 #: kdecore/TIMEZONES:1198 12588 #, kde-format 12589 msgid "Europe/Oslo" 12590 msgstr "यूरोप/ओस्लो" 12591 12592 #: kdecore/TIMEZONES:1199 12593 #, kde-format 12594 msgid "Europe/Paris" 12595 msgstr "यूरोप/पेरिस" 12596 12597 #: kdecore/TIMEZONES:1200 12598 #, kde-format 12599 msgid "Europe/Podgorica" 12600 msgstr "यूरोप/पैडगोरिका" 12601 12602 #: kdecore/TIMEZONES:1201 12603 #, kde-format 12604 msgid "Europe/Prague" 12605 msgstr "यूरोप/प्रग" 12606 12607 #: kdecore/TIMEZONES:1202 12608 #, kde-format 12609 msgid "Europe/Riga" 12610 msgstr "यूरोप/रिगा" 12611 12612 #: kdecore/TIMEZONES:1203 12613 #, kde-format 12614 msgid "Europe/Rome" 12615 msgstr "यूरोप/रोम" 12616 12617 #: kdecore/TIMEZONES:1204 12618 #, kde-format 12619 msgid "Europe/Samara" 12620 msgstr "यूरोप/समारा" 12621 12622 #. i18n: comment to the previous timezone 12623 #: kdecore/TIMEZONES:1206 12624 #, kde-format 12625 msgid "Moscow+01 - Samara, Udmurtia" 12626 msgstr "" 12627 12628 #. i18n: comment to the previous timezone 12629 #: kdecore/TIMEZONES:1208 12630 #, kde-format 12631 msgid "Moscow+00 - Samara, Udmurtia" 12632 msgstr "" 12633 12634 #. i18n: comment to the previous timezone 12635 #: kdecore/TIMEZONES:1210 12636 #, kde-format 12637 msgid "MSK+01 - Samara, Udmurtia" 12638 msgstr "" 12639 12640 #: kdecore/TIMEZONES:1211 12641 #, kde-format 12642 msgid "Europe/San_Marino" 12643 msgstr "यूरोप/सेन_मेरिनो" 12644 12645 #: kdecore/TIMEZONES:1212 12646 #, kde-format 12647 msgid "Europe/Sarajevo" 12648 msgstr "यूरोप/साराजवो" 12649 12650 #: kdecore/TIMEZONES:1213 12651 #, fuzzy, kde-format 12652 #| msgid "Europe/Sarajevo" 12653 msgid "Europe/Saratov" 12654 msgstr "यूरोप/साराजवो" 12655 12656 #. i18n: comment to the previous timezone 12657 #: kdecore/TIMEZONES:1215 12658 #, kde-format 12659 msgid "MSK+01 - Saratov" 12660 msgstr "" 12661 12662 #: kdecore/TIMEZONES:1216 12663 #, kde-format 12664 msgid "Europe/Simferopol" 12665 msgstr "यूरोप/सिमफेरोपॉल" 12666 12667 #. i18n: comment to the previous timezone 12668 #: kdecore/TIMEZONES:1218 12669 #, kde-format 12670 msgid "central Crimea" 12671 msgstr "" 12672 12673 #. i18n: comment to the previous timezone 12674 #: kdecore/TIMEZONES:1220 12675 #, fuzzy, kde-format 12676 #| msgid "Prime: " 12677 msgid "Crimea" 12678 msgstr "प्राइम: " 12679 12680 #: kdecore/TIMEZONES:1221 12681 #, kde-format 12682 msgid "Europe/Skopje" 12683 msgstr "यूरोप/स्कोपज" 12684 12685 #: kdecore/TIMEZONES:1222 12686 #, kde-format 12687 msgid "Europe/Sofia" 12688 msgstr "यूरोप/सोफिया" 12689 12690 #: kdecore/TIMEZONES:1223 12691 #, kde-format 12692 msgid "Europe/Stockholm" 12693 msgstr "यूरोप/स्टॉकहॉम" 12694 12695 #: kdecore/TIMEZONES:1224 12696 #, kde-format 12697 msgid "Europe/Tallinn" 12698 msgstr "यूरोप/टलिन" 12699 12700 #: kdecore/TIMEZONES:1225 12701 #, kde-format 12702 msgid "Europe/Tirane" 12703 msgstr "यूरोप/तिराने" 12704 12705 #: kdecore/TIMEZONES:1226 12706 #, fuzzy, kde-format 12707 #| msgid "Europe/Tirane" 12708 msgid "Europe/Tiraspol" 12709 msgstr "यूरोप/तिराने" 12710 12711 #: kdecore/TIMEZONES:1227 12712 #, fuzzy, kde-format 12713 #| msgid "Europe/Minsk" 12714 msgid "Europe/Ulyanovsk" 12715 msgstr "यूरोप/मिंस्क" 12716 12717 #. i18n: comment to the previous timezone 12718 #: kdecore/TIMEZONES:1229 12719 #, kde-format 12720 msgid "MSK+01 - Ulyanovsk" 12721 msgstr "" 12722 12723 #: kdecore/TIMEZONES:1230 12724 #, kde-format 12725 msgid "Europe/Uzhgorod" 12726 msgstr "यूरोप/उज़गोरोड" 12727 12728 #. i18n: comment to the previous timezone 12729 #: kdecore/TIMEZONES:1232 12730 #, kde-format 12731 msgid "Ruthenia" 12732 msgstr "" 12733 12734 #. i18n: comment to the previous timezone 12735 #: kdecore/TIMEZONES:1234 12736 #, kde-format 12737 msgid "Transcarpathia" 12738 msgstr "" 12739 12740 #: kdecore/TIMEZONES:1235 12741 #, kde-format 12742 msgid "Europe/Vaduz" 12743 msgstr "यूरोप/वदुज़" 12744 12745 #: kdecore/TIMEZONES:1236 12746 #, kde-format 12747 msgid "Europe/Vatican" 12748 msgstr "यूरोप/वेटिकन" 12749 12750 #: kdecore/TIMEZONES:1237 12751 #, kde-format 12752 msgid "Europe/Vienna" 12753 msgstr "यूरोप/वियना" 12754 12755 #: kdecore/TIMEZONES:1238 12756 #, kde-format 12757 msgid "Europe/Vilnius" 12758 msgstr "यूरोप/विलनियस" 12759 12760 #: kdecore/TIMEZONES:1239 12761 #, kde-format 12762 msgid "Europe/Volgograd" 12763 msgstr "यूरोप/बोल्गोग्रैड" 12764 12765 #. i18n: comment to the previous timezone 12766 #: kdecore/TIMEZONES:1241 12767 #, kde-format 12768 msgid "Moscow+00 - Caspian Sea" 12769 msgstr "" 12770 12771 #. i18n: comment to the previous timezone 12772 #: kdecore/TIMEZONES:1243 12773 #, kde-format 12774 msgid "MSK+00 - Volgograd" 12775 msgstr "" 12776 12777 #: kdecore/TIMEZONES:1244 12778 #, kde-format 12779 msgid "Europe/Warsaw" 12780 msgstr "यूरोप/वारसॉ" 12781 12782 #: kdecore/TIMEZONES:1245 12783 #, kde-format 12784 msgid "Europe/Zagreb" 12785 msgstr "यूरोप/जग्रेब" 12786 12787 #: kdecore/TIMEZONES:1246 12788 #, kde-format 12789 msgid "Europe/Zaporozhye" 12790 msgstr "यूरोप/ज़पोरोज़ाय" 12791 12792 #. i18n: comment to the previous timezone 12793 #: kdecore/TIMEZONES:1248 12794 #, kde-format 12795 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12796 msgstr "" 12797 12798 #. i18n: comment to the previous timezone 12799 #: kdecore/TIMEZONES:1250 12800 #, kde-format 12801 msgid "Zaporozhye and east Lugansk" 12802 msgstr "" 12803 12804 #: kdecore/TIMEZONES:1251 12805 #, kde-format 12806 msgid "Europe/Zurich" 12807 msgstr "यूरोप/जुरिच" 12808 12809 #: kdecore/TIMEZONES:1252 12810 #, kde-format 12811 msgid "GB" 12812 msgstr "" 12813 12814 #: kdecore/TIMEZONES:1253 12815 #, kde-format 12816 msgid "GB-Eire" 12817 msgstr "" 12818 12819 #: kdecore/TIMEZONES:1254 12820 #, fuzzy, kde-format 12821 #| msgid "Asia/Hong_Kong" 12822 msgid "Hongkong" 12823 msgstr "एशिया/हॉंग_कॉंग" 12824 12825 #: kdecore/TIMEZONES:1255 12826 #, kde-format 12827 msgid "Iceland" 12828 msgstr "" 12829 12830 #: kdecore/TIMEZONES:1256 12831 #, kde-format 12832 msgid "Indian/Antananarivo" 12833 msgstr "इंडियन/एंटानानारिवो" 12834 12835 #: kdecore/TIMEZONES:1257 12836 #, kde-format 12837 msgid "Indian/Chagos" 12838 msgstr "इंडियन/चगोस" 12839 12840 #: kdecore/TIMEZONES:1258 12841 #, kde-format 12842 msgid "Indian/Christmas" 12843 msgstr "इंडियन/क्रिसमस" 12844 12845 #: kdecore/TIMEZONES:1259 12846 #, kde-format 12847 msgid "Indian/Cocos" 12848 msgstr "इंडियन/कोकोस" 12849 12850 #: kdecore/TIMEZONES:1260 12851 #, kde-format 12852 msgid "Indian/Comoro" 12853 msgstr "इंडियन/कोमोरो" 12854 12855 #: kdecore/TIMEZONES:1261 12856 #, kde-format 12857 msgid "Indian/Kerguelen" 12858 msgstr "इंडियन/केर्गुएलिन" 12859 12860 #: kdecore/TIMEZONES:1262 12861 #, kde-format 12862 msgid "Indian/Mahe" 12863 msgstr "इंडियन/माहे" 12864 12865 #: kdecore/TIMEZONES:1263 12866 #, kde-format 12867 msgid "Indian/Maldives" 12868 msgstr "इंडियन/मालद्वीप" 12869 12870 #: kdecore/TIMEZONES:1264 12871 #, kde-format 12872 msgid "Indian/Mauritius" 12873 msgstr "इंडियन/मौरिसस" 12874 12875 #: kdecore/TIMEZONES:1265 12876 #, kde-format 12877 msgid "Indian/Mayotte" 12878 msgstr "इंडियन/मयोट्टे" 12879 12880 #: kdecore/TIMEZONES:1266 12881 #, kde-format 12882 msgid "Indian/Reunion" 12883 msgstr "इंडियन/रियुनियन" 12884 12885 #: kdecore/TIMEZONES:1267 12886 #, kde-format 12887 msgid "Iran" 12888 msgstr "" 12889 12890 #: kdecore/TIMEZONES:1268 12891 #, fuzzy, kde-format 12892 #| msgid "Pacific/Kosrae" 12893 msgid "Israel" 12894 msgstr "प्रशांत/कोस्रे" 12895 12896 #: kdecore/TIMEZONES:1269 12897 #, fuzzy, kde-format 12898 #| msgid "America/Jamaica" 12899 msgid "Jamaica" 12900 msgstr "अमेरिका/जैमाएका" 12901 12902 #: kdecore/TIMEZONES:1270 12903 #, kde-format 12904 msgid "Japan" 12905 msgstr "" 12906 12907 #. i18n: comment to the previous timezone 12908 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12909 #, fuzzy, kde-format 12910 #| msgid "Pacific/Kwajalein" 12911 msgid "Kwajalein" 12912 msgstr "प्रशांत/क्वाजलिन" 12913 12914 #: kdecore/TIMEZONES:1274 12915 #, kde-format 12916 msgid "Libya" 12917 msgstr "" 12918 12919 #: kdecore/TIMEZONES:1275 12920 #, kde-format 12921 msgid "Mexico/BajaNorte" 12922 msgstr "" 12923 12924 #: kdecore/TIMEZONES:1278 12925 #, kde-format 12926 msgid "Mexico/BajaSur" 12927 msgstr "" 12928 12929 #: kdecore/TIMEZONES:1281 12930 #, kde-format 12931 msgid "Mexico/General" 12932 msgstr "" 12933 12934 #: kdecore/TIMEZONES:1284 12935 #, kde-format 12936 msgid "NZ" 12937 msgstr "" 12938 12939 #: kdecore/TIMEZONES:1287 12940 #, kde-format 12941 msgid "NZ-CHAT" 12942 msgstr "" 12943 12944 #. i18n: comment to the previous timezone 12945 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12946 #, kde-format 12947 msgid "Chatham Islands" 12948 msgstr "" 12949 12950 #: kdecore/TIMEZONES:1290 12951 #, kde-format 12952 msgid "Navajo" 12953 msgstr "" 12954 12955 #: kdecore/TIMEZONES:1293 12956 #, kde-format 12957 msgid "PRC" 12958 msgstr "" 12959 12960 #: kdecore/TIMEZONES:1296 12961 #, kde-format 12962 msgid "Pacific/Apia" 12963 msgstr "प्रशांत/एपिया" 12964 12965 #: kdecore/TIMEZONES:1297 12966 #, kde-format 12967 msgid "Pacific/Auckland" 12968 msgstr "प्रशांत/ऑकलैंड" 12969 12970 #. i18n: comment to the previous timezone 12971 #: kdecore/TIMEZONES:1301 12972 #, kde-format 12973 msgid "New Zealand (most areas)" 12974 msgstr "" 12975 12976 #: kdecore/TIMEZONES:1302 12977 #, fuzzy, kde-format 12978 #| msgid "Pacific/Honolulu" 12979 msgid "Pacific/Bougainville" 12980 msgstr "प्रशांत/होनोलूलू" 12981 12982 #. i18n: comment to the previous timezone 12983 #: kdecore/TIMEZONES:1304 12984 #, kde-format 12985 msgid "Bougainville" 12986 msgstr "" 12987 12988 #: kdecore/TIMEZONES:1305 12989 #, kde-format 12990 msgid "Pacific/Chatham" 12991 msgstr "प्रशांत/चटहाम" 12992 12993 #: kdecore/TIMEZONES:1308 12994 #, fuzzy, kde-format 12995 #| msgid "Pacific/Truk" 12996 msgid "Pacific/Chuuk" 12997 msgstr "प्रशांत/ट्रुक" 12998 12999 #. i18n: comment to the previous timezone 13000 #: kdecore/TIMEZONES:1310 13001 #, kde-format 13002 msgid "Chuuk (Truk) and Yap" 13003 msgstr "" 13004 13005 #. i18n: comment to the previous timezone 13006 #: kdecore/TIMEZONES:1312 13007 #, kde-format 13008 msgid "Chuuk/Truk, Yap" 13009 msgstr "" 13010 13011 #: kdecore/TIMEZONES:1313 13012 #, kde-format 13013 msgid "Pacific/Easter" 13014 msgstr "प्रशांत/इस्टर" 13015 13016 #. i18n: comment to the previous timezone 13017 #: kdecore/TIMEZONES:1317 13018 #, fuzzy, kde-format 13019 #| msgctxt "digit set" 13020 #| msgid "Eastern Arabic-Indic" 13021 msgid "Easter Island" 13022 msgstr "पूरबक अरबी-इंडिक" 13023 13024 #: kdecore/TIMEZONES:1318 13025 #, kde-format 13026 msgid "Pacific/Efate" 13027 msgstr "प्रशांत/इफेट" 13028 13029 #: kdecore/TIMEZONES:1319 13030 #, kde-format 13031 msgid "Pacific/Enderbury" 13032 msgstr "प्रशांत/एंडरबरी" 13033 13034 #. i18n: comment to the previous timezone 13035 #: kdecore/TIMEZONES:1321 13036 #, kde-format 13037 msgid "Phoenix Islands" 13038 msgstr "" 13039 13040 #: kdecore/TIMEZONES:1322 13041 #, kde-format 13042 msgid "Pacific/Fakaofo" 13043 msgstr "प्रशांत/फकाओफो" 13044 13045 #: kdecore/TIMEZONES:1323 13046 #, kde-format 13047 msgid "Pacific/Fiji" 13048 msgstr "प्रशांत/फिजी" 13049 13050 #: kdecore/TIMEZONES:1324 13051 #, kde-format 13052 msgid "Pacific/Funafuti" 13053 msgstr "प्रशांत/फुनाफुटी" 13054 13055 #: kdecore/TIMEZONES:1325 13056 #, kde-format 13057 msgid "Pacific/Galapagos" 13058 msgstr "प्रशांत/गलापगोस" 13059 13060 #. i18n: comment to the previous timezone 13061 #: kdecore/TIMEZONES:1327 13062 #, kde-format 13063 msgid "Galapagos Islands" 13064 msgstr "" 13065 13066 #: kdecore/TIMEZONES:1328 13067 #, kde-format 13068 msgid "Pacific/Gambier" 13069 msgstr "प्रशांत/गैंबियर" 13070 13071 #. i18n: comment to the previous timezone 13072 #: kdecore/TIMEZONES:1330 13073 #, kde-format 13074 msgid "Gambier Islands" 13075 msgstr "" 13076 13077 #: kdecore/TIMEZONES:1331 13078 #, kde-format 13079 msgid "Pacific/Guadalcanal" 13080 msgstr "प्रशांत/गुआडालकनल" 13081 13082 #: kdecore/TIMEZONES:1332 13083 #, kde-format 13084 msgid "Pacific/Guam" 13085 msgstr "प्रशांत/गुआम" 13086 13087 #: kdecore/TIMEZONES:1333 13088 #, kde-format 13089 msgid "Pacific/Honolulu" 13090 msgstr "प्रशांत/होनोलूलू" 13091 13092 #. i18n: comment to the previous timezone 13093 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13094 #, kde-format 13095 msgid "Hawaii" 13096 msgstr "" 13097 13098 #: kdecore/TIMEZONES:1336 13099 #, kde-format 13100 msgid "Pacific/Johnston" 13101 msgstr "प्रशांत/जॉनस्टन" 13102 13103 #. i18n: comment to the previous timezone 13104 #: kdecore/TIMEZONES:1338 13105 #, kde-format 13106 msgid "Johnston Atoll" 13107 msgstr "" 13108 13109 #: kdecore/TIMEZONES:1339 13110 #, kde-format 13111 msgid "Pacific/Kiritimati" 13112 msgstr "प्रशांत/किरितिमाती" 13113 13114 #. i18n: comment to the previous timezone 13115 #: kdecore/TIMEZONES:1341 13116 #, kde-format 13117 msgid "Line Islands" 13118 msgstr "" 13119 13120 #: kdecore/TIMEZONES:1342 13121 #, kde-format 13122 msgid "Pacific/Kosrae" 13123 msgstr "प्रशांत/कोस्रे" 13124 13125 #. i18n: comment to the previous timezone 13126 #: kdecore/TIMEZONES:1344 13127 #, fuzzy, kde-format 13128 #| msgid "Pacific/Kosrae" 13129 msgid "Kosrae" 13130 msgstr "प्रशांत/कोस्रे" 13131 13132 #: kdecore/TIMEZONES:1345 13133 #, kde-format 13134 msgid "Pacific/Kwajalein" 13135 msgstr "प्रशांत/क्वाजलिन" 13136 13137 #: kdecore/TIMEZONES:1348 13138 #, kde-format 13139 msgid "Pacific/Majuro" 13140 msgstr "प्रशांत/मजुरा" 13141 13142 #. i18n: comment to the previous timezone 13143 #: kdecore/TIMEZONES:1352 13144 #, kde-format 13145 msgid "Marshall Islands (most areas)" 13146 msgstr "" 13147 13148 #: kdecore/TIMEZONES:1353 13149 #, kde-format 13150 msgid "Pacific/Marquesas" 13151 msgstr "प्रशांत/मारक्यूसास" 13152 13153 #. i18n: comment to the previous timezone 13154 #: kdecore/TIMEZONES:1355 13155 #, kde-format 13156 msgid "Marquesas Islands" 13157 msgstr "" 13158 13159 #: kdecore/TIMEZONES:1356 13160 #, kde-format 13161 msgid "Pacific/Midway" 13162 msgstr "प्रशांत/मिडवे" 13163 13164 #. i18n: comment to the previous timezone 13165 #: kdecore/TIMEZONES:1358 13166 #, kde-format 13167 msgid "Midway Islands" 13168 msgstr "" 13169 13170 #: kdecore/TIMEZONES:1359 13171 #, kde-format 13172 msgid "Pacific/Nauru" 13173 msgstr "प्रशांत/नाउरू" 13174 13175 #: kdecore/TIMEZONES:1360 13176 #, kde-format 13177 msgid "Pacific/Niue" 13178 msgstr "प्रशांत/निउ" 13179 13180 #: kdecore/TIMEZONES:1361 13181 #, kde-format 13182 msgid "Pacific/Norfolk" 13183 msgstr "प्रशांत/नॉरफॉक" 13184 13185 #: kdecore/TIMEZONES:1362 13186 #, kde-format 13187 msgid "Pacific/Noumea" 13188 msgstr "प्रशांत/नाउमिया" 13189 13190 #: kdecore/TIMEZONES:1363 13191 #, kde-format 13192 msgid "Pacific/Pago_Pago" 13193 msgstr "प्रशांत/पागो_पादो" 13194 13195 #: kdecore/TIMEZONES:1364 13196 #, kde-format 13197 msgid "Pacific/Palau" 13198 msgstr "प्रशांत/पलाउ" 13199 13200 #: kdecore/TIMEZONES:1365 13201 #, kde-format 13202 msgid "Pacific/Pitcairn" 13203 msgstr "प्रशांत/पिटकैम" 13204 13205 #: kdecore/TIMEZONES:1366 13206 #, fuzzy, kde-format 13207 #| msgid "Pacific/Ponape" 13208 msgid "Pacific/Pohnpei" 13209 msgstr "प्रशांत/पोनेप" 13210 13211 #. i18n: comment to the previous timezone 13212 #: kdecore/TIMEZONES:1368 13213 #, kde-format 13214 msgid "Pohnpei (Ponape)" 13215 msgstr "" 13216 13217 #. i18n: comment to the previous timezone 13218 #: kdecore/TIMEZONES:1370 13219 #, fuzzy, kde-format 13220 #| msgid "Pacific/Ponape" 13221 msgid "Pohnpei/Ponape" 13222 msgstr "प्रशांत/पोनेप" 13223 13224 #: kdecore/TIMEZONES:1371 13225 #, kde-format 13226 msgid "Pacific/Ponape" 13227 msgstr "प्रशांत/पोनेप" 13228 13229 #. i18n: comment to the previous timezone 13230 #: kdecore/TIMEZONES:1373 13231 #, kde-format 13232 msgid "Ponape (Pohnpei)" 13233 msgstr "" 13234 13235 #: kdecore/TIMEZONES:1374 13236 #, kde-format 13237 msgid "Pacific/Port_Moresby" 13238 msgstr "प्रशांत/पॉर्ट_मोरेस्बी" 13239 13240 #. i18n: comment to the previous timezone 13241 #: kdecore/TIMEZONES:1376 13242 #, kde-format 13243 msgid "Papua New Guinea (most areas)" 13244 msgstr "" 13245 13246 #: kdecore/TIMEZONES:1377 13247 #, kde-format 13248 msgid "Pacific/Rarotonga" 13249 msgstr "प्रशांत/रारोटोंगा" 13250 13251 #: kdecore/TIMEZONES:1378 13252 #, kde-format 13253 msgid "Pacific/Saipan" 13254 msgstr "प्रशांत/सैपान" 13255 13256 #: kdecore/TIMEZONES:1379 13257 #, fuzzy, kde-format 13258 #| msgid "Pacific/Saipan" 13259 msgid "Pacific/Samoa" 13260 msgstr "प्रशांत/सैपान" 13261 13262 #: kdecore/TIMEZONES:1380 13263 #, kde-format 13264 msgid "Pacific/Tahiti" 13265 msgstr "प्रशांत/तहिती" 13266 13267 #. i18n: comment to the previous timezone 13268 #: kdecore/TIMEZONES:1382 13269 #, kde-format 13270 msgid "Society Islands" 13271 msgstr "" 13272 13273 #: kdecore/TIMEZONES:1383 13274 #, kde-format 13275 msgid "Pacific/Tarawa" 13276 msgstr "प्रशांत/टरावा" 13277 13278 #. i18n: comment to the previous timezone 13279 #: kdecore/TIMEZONES:1385 13280 #, kde-format 13281 msgid "Gilbert Islands" 13282 msgstr "" 13283 13284 #: kdecore/TIMEZONES:1386 13285 #, kde-format 13286 msgid "Pacific/Tongatapu" 13287 msgstr "प्रशांत/टॉन्गाटापु" 13288 13289 #: kdecore/TIMEZONES:1387 13290 #, kde-format 13291 msgid "Pacific/Truk" 13292 msgstr "प्रशांत/ट्रुक" 13293 13294 #. i18n: comment to the previous timezone 13295 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13296 #, kde-format 13297 msgid "Truk (Chuuk) and Yap" 13298 msgstr "" 13299 13300 #: kdecore/TIMEZONES:1390 13301 #, kde-format 13302 msgid "Pacific/Wake" 13303 msgstr "प्रशांत/वेक" 13304 13305 #. i18n: comment to the previous timezone 13306 #: kdecore/TIMEZONES:1392 13307 #, kde-format 13308 msgid "Wake Island" 13309 msgstr "" 13310 13311 #: kdecore/TIMEZONES:1393 13312 #, kde-format 13313 msgid "Pacific/Wallis" 13314 msgstr "प्रशांत/वालिस" 13315 13316 #: kdecore/TIMEZONES:1394 13317 #, kde-format 13318 msgid "Pacific/Yap" 13319 msgstr "प्रशांत/याप" 13320 13321 #: kdecore/TIMEZONES:1397 13322 #, kde-format 13323 msgid "Poland" 13324 msgstr "" 13325 13326 #: kdecore/TIMEZONES:1398 13327 #, kde-format 13328 msgid "Portugal" 13329 msgstr "" 13330 13331 #: kdecore/TIMEZONES:1401 13332 #, kde-format 13333 msgid "ROC" 13334 msgstr "" 13335 13336 #: kdecore/TIMEZONES:1402 13337 #, kde-format 13338 msgid "ROK" 13339 msgstr "" 13340 13341 #: kdecore/TIMEZONES:1403 13342 #, fuzzy, kde-format 13343 #| msgid "Asia/Singapore" 13344 msgid "Singapore" 13345 msgstr "एशिया/सिंगापुर" 13346 13347 #: kdecore/TIMEZONES:1404 13348 #, kde-format 13349 msgid "Turkey" 13350 msgstr "" 13351 13352 #: kdecore/TIMEZONES:1405 13353 #, kde-format 13354 msgid "US/Alaska" 13355 msgstr "" 13356 13357 #: kdecore/TIMEZONES:1408 13358 #, kde-format 13359 msgid "US/Aleutian" 13360 msgstr "" 13361 13362 #: kdecore/TIMEZONES:1411 13363 #, kde-format 13364 msgid "US/Arizona" 13365 msgstr "" 13366 13367 #: kdecore/TIMEZONES:1414 13368 #, kde-format 13369 msgid "US/Central" 13370 msgstr "" 13371 13372 #: kdecore/TIMEZONES:1417 13373 #, kde-format 13374 msgid "US/East-Indiana" 13375 msgstr "" 13376 13377 #: kdecore/TIMEZONES:1420 13378 #, kde-format 13379 msgid "US/Eastern" 13380 msgstr "" 13381 13382 #: kdecore/TIMEZONES:1423 13383 #, kde-format 13384 msgid "US/Hawaii" 13385 msgstr "" 13386 13387 #: kdecore/TIMEZONES:1426 13388 #, kde-format 13389 msgid "US/Indiana-Starke" 13390 msgstr "" 13391 13392 #: kdecore/TIMEZONES:1429 13393 #, kde-format 13394 msgid "US/Michigan" 13395 msgstr "" 13396 13397 #: kdecore/TIMEZONES:1432 13398 #, kde-format 13399 msgid "US/Mountain" 13400 msgstr "" 13401 13402 #: kdecore/TIMEZONES:1435 13403 #, fuzzy, kde-format 13404 #| msgid "Pacific/Yap" 13405 msgid "US/Pacific" 13406 msgstr "प्रशांत/याप" 13407 13408 #: kdecore/TIMEZONES:1438 13409 #, kde-format 13410 msgid "US/Samoa" 13411 msgstr "" 13412 13413 #: kdecore/TIMEZONES:1439 13414 #, kde-format 13415 msgid "W-SU" 13416 msgstr "" 13417 13418 #. i18n: Generic sans serif font presented in font choosers. When selected, 13419 #. the system will choose a real font, mandated by distro settings. 13420 #: kdeui/fonthelpers.cpp:29 13421 #, kde-format 13422 msgctxt "@item Font name" 13423 msgid "Sans Serif" 13424 msgstr "सन्स सेरिफ" 13425 13426 #. i18n: Generic serif font presented in font choosers. When selected, 13427 #. the system will choose a real font, mandated by distro settings. 13428 #: kdeui/fonthelpers.cpp:32 13429 #, kde-format 13430 msgctxt "@item Font name" 13431 msgid "Serif" 13432 msgstr "सेरिफ" 13433 13434 #. i18n: Generic monospace font presented in font choosers. When selected, 13435 #. the system will choose a real font, mandated by distro settings. 13436 #: kdeui/fonthelpers.cpp:35 13437 #, kde-format 13438 msgctxt "@item Font name" 13439 msgid "Monospace" 13440 msgstr "मोनोस्पेस" 13441 13442 #: kdeui/k4timezonewidget.cpp:62 13443 #, kde-format 13444 msgctxt "Define an area in the time zone, like a town area" 13445 msgid "Area" 13446 msgstr "क्षेत्र" 13447 13448 #: kdeui/k4timezonewidget.cpp:62 13449 #, kde-format 13450 msgctxt "Time zone" 13451 msgid "Region" 13452 msgstr "क्षेत्र" 13453 13454 #: kdeui/k4timezonewidget.cpp:62 13455 #, fuzzy, kde-format 13456 msgid "Comment" 13457 msgstr "टिप्पणी" 13458 13459 #: kdeui/kapplication.cpp:741 13460 #, kde-format 13461 msgid "The style '%1' was not found" 13462 msgstr "शैली '%1' नहि भेटल" 13463 13464 #: kdeui/kcolordialog.cpp:102 13465 #, kde-format 13466 msgctxt "palette name" 13467 msgid "* Recent Colors *" 13468 msgstr "* हाल ही केर रंग *" 13469 13470 #: kdeui/kcolordialog.cpp:103 13471 #, kde-format 13472 msgctxt "palette name" 13473 msgid "* Custom Colors *" 13474 msgstr "* मनपसिन्न रंग *" 13475 13476 #: kdeui/kcolordialog.cpp:104 13477 #, kde-format 13478 msgctxt "palette name" 13479 msgid "Forty Colors" 13480 msgstr "चालीस रंग" 13481 13482 #: kdeui/kcolordialog.cpp:105 13483 #, kde-format 13484 msgctxt "palette name" 13485 msgid "Oxygen Colors" 13486 msgstr "ऑक्सीजन रंग" 13487 13488 #: kdeui/kcolordialog.cpp:106 13489 #, kde-format 13490 msgctxt "palette name" 13491 msgid "Rainbow Colors" 13492 msgstr "इंद्रधनुषी रंग" 13493 13494 #: kdeui/kcolordialog.cpp:107 13495 #, kde-format 13496 msgctxt "palette name" 13497 msgid "Royal Colors" 13498 msgstr "राजसी रंग" 13499 13500 #: kdeui/kcolordialog.cpp:108 13501 #, kde-format 13502 msgctxt "palette name" 13503 msgid "Web Colors" 13504 msgstr "वेब रंग" 13505 13506 #: kdeui/kcolordialog.cpp:572 13507 #, kde-format 13508 msgid "Named Colors" 13509 msgstr "नामांकित रंग " 13510 13511 #: kdeui/kcolordialog.cpp:746 13512 #, kde-format 13513 msgctxt "" 13514 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13515 "them)" 13516 msgid "" 13517 "Unable to read X11 RGB color strings. The following file location was " 13518 "examined:\n" 13519 "%2" 13520 msgid_plural "" 13521 "Unable to read X11 RGB color strings. The following file locations were " 13522 "examined:\n" 13523 "%2" 13524 msgstr[0] "" 13525 msgstr[1] "" 13526 13527 #: kdeui/kcolordialog.cpp:997 13528 #, kde-format 13529 msgid "Select Color" 13530 msgstr "रंग चुनू" 13531 13532 #: kdeui/kcolordialog.cpp:1077 13533 #, kde-format 13534 msgid "Hue:" 13535 msgstr "वर्ण:" 13536 13537 #: kdeui/kcolordialog.cpp:1083 13538 #, kde-format 13539 msgctxt "The angular degree unit (for hue)" 13540 msgid "°" 13541 msgstr "°" 13542 13543 #: kdeui/kcolordialog.cpp:1088 13544 #, fuzzy, kde-format 13545 #| msgid "Saturday" 13546 msgid "Saturation:" 13547 msgstr "शनिवार" 13548 13549 #: kdeui/kcolordialog.cpp:1098 13550 #, kde-format 13551 msgctxt "This is the V of HSV" 13552 msgid "Value:" 13553 msgstr "मान:" 13554 13555 #: kdeui/kcolordialog.cpp:1111 13556 #, kde-format 13557 msgid "Red:" 13558 msgstr "लाल:" 13559 13560 #: kdeui/kcolordialog.cpp:1121 13561 #, kde-format 13562 msgid "Green:" 13563 msgstr "हरिअर:" 13564 13565 #: kdeui/kcolordialog.cpp:1131 13566 #, kde-format 13567 msgid "Blue:" 13568 msgstr "नीलाः" 13569 13570 #: kdeui/kcolordialog.cpp:1152 13571 #, kde-format 13572 msgid "Alpha:" 13573 msgstr "अल्फा" 13574 13575 #: kdeui/kcolordialog.cpp:1206 13576 #, kde-format 13577 msgid "&Add to Custom Colors" 13578 msgstr "पसंदीदा रंग जोड़ू मे (&A)" 13579 13580 #: kdeui/kcolordialog.cpp:1234 13581 #, kde-format 13582 msgid "Name:" 13583 msgstr "नाम:" 13584 13585 #: kdeui/kcolordialog.cpp:1241 13586 #, kde-format 13587 msgid "HTML:" 13588 msgstr "एचटीएमएलः" 13589 13590 #: kdeui/kcolordialog.cpp:1328 13591 #, kde-format 13592 msgid "Default color" 13593 msgstr "मूलभूत रंग" 13594 13595 #: kdeui/kcolordialog.cpp:1393 13596 #, kde-format 13597 msgid "-default-" 13598 msgstr "-मूलभूत-" 13599 13600 #: kdeui/kcolordialog.cpp:1668 13601 #, kde-format 13602 msgid "-unnamed-" 13603 msgstr "-बेनाम-" 13604 13605 #: kdeui/kdeprintdialog.cpp:40 13606 #, kde-format 13607 msgctxt "@title:window" 13608 msgid "Print" 13609 msgstr "छपाइ" 13610 13611 #: kdeui/kdialog.cpp:271 13612 #, kde-format 13613 msgid "&Try" 13614 msgstr "कोसिस करू (&T)" 13615 13616 #: kdeui/kdialog.cpp:484 13617 #, kde-format 13618 msgid "modified" 13619 msgstr "परिवर्धित" 13620 13621 #: kdeui/kdialog.cpp:495 13622 #, kde-format 13623 msgctxt "Document/application separator in titlebar" 13624 msgid " – " 13625 msgstr " – " 13626 13627 #: kdeui/kdialog.cpp:896 13628 #, kde-format 13629 msgid "&Details" 13630 msgstr "विवरण (&D)" 13631 13632 #: kdeui/kdialog.cpp:1054 13633 #, kde-format 13634 msgid "Get help..." 13635 msgstr "मद्दति लिअ'..." 13636 13637 #: kdeui/keditlistbox.cpp:324 13638 #, kde-format 13639 msgid "&Add" 13640 msgstr "जोड़ू (&A)" 13641 13642 #: kdeui/keditlistbox.cpp:336 13643 #, kde-format 13644 msgid "&Remove" 13645 msgstr "हटाबू (&R)" 13646 13647 #: kdeui/keditlistbox.cpp:348 13648 #, kde-format 13649 msgid "Move &Up" 13650 msgstr "उप्पर जाउ (&U)" 13651 13652 #: kdeui/keditlistbox.cpp:353 13653 #, kde-format 13654 msgid "Move &Down" 13655 msgstr "नीच्चाँ जाउ (&D)" 13656 13657 #. i18n: A shorter version of the alphabet test phrase translated in 13658 #. another message. It is displayed in the dropdown list of font previews 13659 #. (the font selection combo box), so keep it under the length equivalent 13660 #. to 60 or so proportional Latin characters. 13661 #: kdeui/kfontcombobox.cpp:48 13662 #, kde-format 13663 msgctxt "short" 13664 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13665 msgstr "सारे जहाँ सँ अच्छा हिंदोस्ताँ हमारा" 13666 13667 #. i18n: Integer which indicates the script you used in the sample text 13668 #. for font previews in your language. For the possible values, see 13669 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13670 #. If the sample text contains several scripts, their IDs can be given 13671 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13672 #: kdeui/kfontcombobox.cpp:119 13673 #, kde-format 13674 msgctxt "Numeric IDs of scripts for font previews" 13675 msgid "1" 13676 msgstr "1" 13677 13678 #: kdeui/kfontdialog.cpp:51 13679 #, kde-format 13680 msgid "Select Font" 13681 msgstr "फोन्ट चुनू" 13682 13683 #: kdeui/kprintpreview.cpp:118 13684 #, kde-format 13685 msgid "Could not load print preview part" 13686 msgstr "छपाइ पूर्वावलोकन भाग लोड नहि कएल जाए सकल" 13687 13688 #: kdeui/kprintpreview.cpp:135 13689 #, kde-format 13690 msgid "Print Preview" 13691 msgstr "छपाइ पूर्वावलोकन" 13692 13693 #: kdeui/ksystemtrayicon.cpp:153 13694 #, kde-format 13695 msgid "Minimize" 13696 msgstr "छोट करू" 13697 13698 #: kdeui/ksystemtrayicon.cpp:205 13699 #, kde-format 13700 msgid "&Minimize" 13701 msgstr "न्यूनतम (&M)" 13702 13703 #: kdeui/ksystemtrayicon.cpp:207 13704 #, kde-format 13705 msgid "&Restore" 13706 msgstr "घुराबू (&R)" 13707 13708 #: kdeui/ksystemtrayicon.cpp:226 13709 #, kde-format 13710 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13711 msgstr "<qt>की अहाँ सुनिश्चित छी जे अहाँ <b>%1</b> सँ बाहर जएनाइ चाहैत छी?</qt>" 13712 13713 #: kdeui/ksystemtrayicon.cpp:229 13714 #, kde-format 13715 msgid "Confirm Quit From System Tray" 13716 msgstr "तंत्र तश्तरी सँ बाहर जाए कए पुष्टि करू" 13717 13718 #: kdeui/kundostack.cpp:47 13719 #, kde-format 13720 msgid "Redo" 13721 msgstr "फिनु सँ करू" 13722 13723 #: kdeui/kundostack.cpp:66 13724 #, kde-format 13725 msgid "Undo" 13726 msgstr "पहिनुक जहिना" 13727 13728 #: kdeui/kuniqueapplication.cpp:79 13729 #, kde-format 13730 msgid "Do not run in the background." 13731 msgstr "पृष्ठ भूमि मे नहि चलाबू." 13732 13733 #: kdeui/kuniqueapplication.cpp:81 13734 #, kde-format 13735 msgid "Internally added if launched from Finder" 13736 msgstr "जँ फ़ाइंडर केर द्वारा चालू कएल जाइत अछि तँ आंतरिक रूपेँ जोड़ल गेल" 13737 13738 #: kio/kcommentwidget.cpp:68 13739 #, fuzzy, kde-format 13740 #| msgid "Add Entry..." 13741 msgctxt "@label" 13742 msgid "Add Comment..." 13743 msgstr "प्रविष्टि जोड़ू..." 13744 13745 #: kio/kcommentwidget.cpp:74 13746 #, kde-format 13747 msgctxt "@label" 13748 msgid "Change..." 13749 msgstr "बदलू..." 13750 13751 #: kio/kcommentwidget.cpp:128 13752 #, fuzzy, kde-format 13753 #| msgid "Comment" 13754 msgctxt "@title:window" 13755 msgid "Change Comment" 13756 msgstr "टिप्पणी" 13757 13758 #: kio/kcommentwidget.cpp:129 13759 #, fuzzy, kde-format 13760 #| msgid "Comment" 13761 msgctxt "@title:window" 13762 msgid "Add Comment" 13763 msgstr "टिप्पणी" 13764 13765 #: kio/kdevicelistmodel.cpp:115 13766 #, kde-format 13767 msgid "Device name" 13768 msgstr "डिवाइस नाम" 13769 13770 #: kio/kdirselectdialog.cpp:136 13771 #, kde-format 13772 msgctxt "folder name" 13773 msgid "New Folder" 13774 msgstr "नवीन फोल्डर" 13775 13776 #: kio/kdirselectdialog.cpp:141 13777 #, kde-format 13778 msgctxt "@title:window" 13779 msgid "New Folder" 13780 msgstr "नवीन फोल्डर" 13781 13782 #: kio/kdirselectdialog.cpp:142 13783 #, kde-format 13784 msgctxt "@label:textbox" 13785 msgid "" 13786 "Create new folder in:\n" 13787 "%1" 13788 msgstr "" 13789 "नवीन फोल्डर:\n" 13790 "%1 मे बनाबू" 13791 13792 #: kio/kdirselectdialog.cpp:172 13793 #, kde-format 13794 msgid "A file or folder named %1 already exists." 13795 msgstr "एकटा फाइल अथवा फोल्डर नाम %1 पहिने सँ अस्तित्व मे अछि. " 13796 13797 #: kio/kdirselectdialog.cpp:175 13798 #, kde-format 13799 msgid "You do not have permission to create that folder." 13800 msgstr "ई फोल्डर केँ बनाबै क' लेल अहाँक पास अनुमति नहि अछि." 13801 13802 #: kio/kdirselectdialog.cpp:290 13803 #, kde-format 13804 msgctxt "@title:window" 13805 msgid "Select Folder" 13806 msgstr "" 13807 13808 #: kio/kdirselectdialog.cpp:299 13809 #, kde-format 13810 msgctxt "@action:button" 13811 msgid "New Folder..." 13812 msgstr "नवीन फोल्डर..." 13813 13814 #: kio/kdirselectdialog.cpp:345 13815 #, kde-format 13816 msgctxt "@action:inmenu" 13817 msgid "New Folder..." 13818 msgstr "नवीन फोल्डर..." 13819 13820 #: kio/kdirselectdialog.cpp:352 13821 #, fuzzy, kde-format 13822 #| msgid "Move to Trash" 13823 msgctxt "@action:inmenu" 13824 msgid "Move to Trash" 13825 msgstr "रद्दीमे भेजू" 13826 13827 #: kio/kdirselectdialog.cpp:359 13828 #, fuzzy, kde-format 13829 #| msgid "Delete" 13830 msgctxt "@action:inmenu" 13831 msgid "Delete" 13832 msgstr "मेटाबू" 13833 13834 #: kio/kdirselectdialog.cpp:368 13835 #, kde-format 13836 msgctxt "@option:check" 13837 msgid "Show Hidden Folders" 13838 msgstr "" 13839 13840 #: kio/kdirselectdialog.cpp:375 13841 #, fuzzy, kde-format 13842 #| msgid "Properties" 13843 msgctxt "@action:inmenu" 13844 msgid "Properties" 13845 msgstr "गुण" 13846 13847 #: kio/kfiledialog.cpp:132 13848 #, kde-format 13849 msgid "*|All files" 13850 msgstr "" 13851 13852 #: kio/kfiledialog.cpp:332 13853 #, kde-format 13854 msgid "All Supported Files" 13855 msgstr "सभटा समर्थित फाइलसभ" 13856 13857 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13858 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13859 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13860 #, kde-format 13861 msgid "Open" 13862 msgstr "खोलू" 13863 13864 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13865 #: kio/kfiledialog.cpp:838 13866 #, kde-format 13867 msgid "Save As" 13868 msgstr "एहिना सहेजू" 13869 13870 #: kio/kfilemetadataprovider.cpp:245 13871 #, kde-format 13872 msgctxt "@item:intable" 13873 msgid "%1 item" 13874 msgid_plural "%1 items" 13875 msgstr[0] "" 13876 msgstr[1] "" 13877 13878 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13879 #, fuzzy, kde-format 13880 msgctxt "@label" 13881 msgid "Comment" 13882 msgstr "टिप्पणी" 13883 13884 #: kio/kfilemetadataprovider.cpp:447 13885 #, fuzzy, kde-format 13886 #| msgid "Modified:" 13887 msgctxt "@label" 13888 msgid "Modified" 13889 msgstr "परिवर्धितः" 13890 13891 #: kio/kfilemetadataprovider.cpp:448 13892 #, fuzzy, kde-format 13893 #| msgid "Owner" 13894 msgctxt "@label" 13895 msgid "Owner" 13896 msgstr "मालिक" 13897 13898 #: kio/kfilemetadataprovider.cpp:449 13899 #, fuzzy, kde-format 13900 #| msgctxt "@title:column" 13901 #| msgid "Permissions" 13902 msgctxt "@label" 13903 msgid "Permissions" 13904 msgstr "अनुमतिसभ" 13905 13906 #: kio/kfilemetadataprovider.cpp:450 13907 #, fuzzy, kde-format 13908 #| msgid "Sorting" 13909 msgctxt "@label" 13910 msgid "Rating" 13911 msgstr "छाँटनाइ" 13912 13913 #: kio/kfilemetadataprovider.cpp:451 13914 #, fuzzy, kde-format 13915 #| msgctxt "@title:column" 13916 #| msgid "Size" 13917 msgctxt "@label" 13918 msgid "Size" 13919 msgstr "आकार" 13920 13921 #: kio/kfilemetadataprovider.cpp:452 13922 #, fuzzy, kde-format 13923 #| msgid "Trash" 13924 msgctxt "@label" 13925 msgid "Tags" 13926 msgstr "रद्दी" 13927 13928 #: kio/kfilemetadataprovider.cpp:453 13929 #, fuzzy, kde-format 13930 #| msgid "Size:" 13931 msgctxt "@label" 13932 msgid "Total Size" 13933 msgstr "आकार:" 13934 13935 #: kio/kfilemetadataprovider.cpp:454 13936 #, fuzzy, kde-format 13937 #| msgid "Type" 13938 msgctxt "@label" 13939 msgid "Type" 13940 msgstr "प्रकार" 13941 13942 #: kio/kfilemetadatareaderprocess.cpp:234 13943 #, kde-format 13944 msgid "KFileMetaDataReader" 13945 msgstr "" 13946 13947 #: kio/kfilemetadatareaderprocess.cpp:236 13948 #, kde-format 13949 msgid "KFileMetaDataReader can be used to read metadata from a file" 13950 msgstr "" 13951 13952 #: kio/kfilemetadatareaderprocess.cpp:238 13953 #, kde-format 13954 msgid "(C) 2011, Peter Penz" 13955 msgstr "" 13956 13957 #: kio/kfilemetadatareaderprocess.cpp:239 13958 #, kde-format 13959 msgid "Peter Penz" 13960 msgstr "" 13961 13962 #: kio/kfilemetadatareaderprocess.cpp:239 13963 #, kde-format 13964 msgid "Current maintainer" 13965 msgstr "" 13966 13967 #: kio/kfilemetadatareaderprocess.cpp:244 13968 #, kde-format 13969 msgid "Only the meta data that is part of the file is read" 13970 msgstr "" 13971 13972 #: kio/kfilemetadatareaderprocess.cpp:245 13973 #, kde-format 13974 msgid "List of URLs where the meta-data should be read from" 13975 msgstr "" 13976 13977 #: kio/kfilemetainfowidget.cpp:161 13978 #, kde-format 13979 msgid "<Error>" 13980 msgstr "<त्रुटि>" 13981 13982 #: kio/kfiletreeview.cpp:192 13983 #, kde-format 13984 msgid "Show Hidden Folders" 13985 msgstr "" 13986 13987 #: kio/kimageio.cpp:46 13988 #, kde-format 13989 msgid "All Pictures" 13990 msgstr "सभटा छविसभ" 13991 13992 #: kio/kmetaprops.cpp:57 13993 #, kde-format 13994 msgctxt "@title:window" 13995 msgid "Configure Shown Data" 13996 msgstr "" 13997 13998 #: kio/kmetaprops.cpp:60 13999 #, kde-format 14000 msgctxt "@label::textbox" 14001 msgid "Select which data should be shown:" 14002 msgstr "" 14003 14004 #: kio/kmetaprops.cpp:123 14005 #, fuzzy, kde-format 14006 #| msgid "Calculating..." 14007 msgctxt "@action:button" 14008 msgid "Configure..." 14009 msgstr "गणनामे... " 14010 14011 #: kio/kmetaprops.cpp:133 14012 #, fuzzy, kde-format 14013 #| msgid "Information" 14014 msgctxt "@title:tab" 14015 msgid "Information" 14016 msgstr "सूचना" 14017 14018 #: kio/knfotranslator.cpp:40 14019 #, fuzzy, kde-format 14020 #| msgid "Created:" 14021 msgctxt "@label creation date" 14022 msgid "Created" 14023 msgstr "बनएलक:" 14024 14025 #: kio/knfotranslator.cpp:41 14026 #, fuzzy, kde-format 14027 #| msgctxt "@title:column" 14028 #| msgid "Size" 14029 msgctxt "@label file content size" 14030 msgid "Size" 14031 msgstr "आकार" 14032 14033 #: kio/knfotranslator.cpp:42 14034 #, kde-format 14035 msgctxt "@label file depends from" 14036 msgid "Depends" 14037 msgstr "" 14038 14039 #: kio/knfotranslator.cpp:43 14040 #, fuzzy, kde-format 14041 #| msgid "Description" 14042 msgctxt "@label" 14043 msgid "Description" 14044 msgstr "विवरण" 14045 14046 #: kio/knfotranslator.cpp:44 14047 #, fuzzy, kde-format 14048 #| msgid "&General" 14049 msgctxt "@label Software used to generate content" 14050 msgid "Generator" 14051 msgstr "सामान्य (&G)" 14052 14053 #: kio/knfotranslator.cpp:45 14054 #, kde-format 14055 msgctxt "" 14056 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14057 msgid "Has Part" 14058 msgstr "" 14059 14060 #: kio/knfotranslator.cpp:46 14061 #, kde-format 14062 msgctxt "" 14063 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14064 "nie#hasLogicalPart" 14065 msgid "Has Logical Part" 14066 msgstr "" 14067 14068 #: kio/knfotranslator.cpp:47 14069 #, fuzzy, kde-format 14070 #| msgid "Parent Folder" 14071 msgctxt "@label parent directory" 14072 msgid "Part of" 14073 msgstr "पेरेन्ट फोल्डर " 14074 14075 #: kio/knfotranslator.cpp:48 14076 #, kde-format 14077 msgctxt "@label" 14078 msgid "Keyword" 14079 msgstr "" 14080 14081 #: kio/knfotranslator.cpp:49 14082 #, fuzzy, kde-format 14083 #| msgid "Modified:" 14084 msgctxt "@label modified date of file" 14085 msgid "Modified" 14086 msgstr "परिवर्धितः" 14087 14088 #: kio/knfotranslator.cpp:50 14089 #, fuzzy, kde-format 14090 #| msgid "Mime Type" 14091 msgctxt "@label" 14092 msgid "MIME Type" 14093 msgstr "माइम प्रकार" 14094 14095 #: kio/knfotranslator.cpp:51 14096 #, fuzzy, kde-format 14097 #| msgid "Contents:" 14098 msgctxt "@label" 14099 msgid "Content" 14100 msgstr "विषय:" 14101 14102 #: kio/knfotranslator.cpp:52 14103 #, fuzzy, kde-format 14104 #| msgid "created on %1" 14105 msgctxt "@label" 14106 msgid "Related To" 14107 msgstr " %1 केँ तैआर कएल गेल" 14108 14109 #: kio/knfotranslator.cpp:53 14110 #, fuzzy, kde-format 14111 #| msgid "Subject line" 14112 msgctxt "@label" 14113 msgid "Subject" 14114 msgstr "विषय पंक्ति" 14115 14116 #: kio/knfotranslator.cpp:54 14117 #, fuzzy, kde-format 14118 #| msgid "File" 14119 msgctxt "@label music title" 14120 msgid "Title" 14121 msgstr "फाइल" 14122 14123 #: kio/knfotranslator.cpp:55 14124 #, kde-format 14125 msgctxt "@label file URL" 14126 msgid "File Location" 14127 msgstr "" 14128 14129 #: kio/knfotranslator.cpp:56 14130 #, fuzzy, kde-format 14131 #| msgid "Created:" 14132 msgctxt "@label" 14133 msgid "Creator" 14134 msgstr "बनएलक:" 14135 14136 #: kio/knfotranslator.cpp:57 14137 #, kde-format 14138 msgctxt "@label" 14139 msgid "Average Bitrate" 14140 msgstr "" 14141 14142 #: kio/knfotranslator.cpp:58 14143 #, kde-format 14144 msgctxt "@label" 14145 msgid "Channels" 14146 msgstr "" 14147 14148 #: kio/knfotranslator.cpp:59 14149 #, fuzzy, kde-format 14150 #| msgid "Categories" 14151 msgctxt "@label number of characters" 14152 msgid "Characters" 14153 msgstr "श्रेणीसभ" 14154 14155 #: kio/knfotranslator.cpp:60 14156 #, fuzzy, kde-format 14157 #| msgid "C&onnect" 14158 msgctxt "@label" 14159 msgid "Codec" 14160 msgstr "कनेक्ट (&o)" 14161 14162 #: kio/knfotranslator.cpp:61 14163 #, kde-format 14164 msgctxt "@label" 14165 msgid "Color Depth" 14166 msgstr "" 14167 14168 #: kio/knfotranslator.cpp:62 14169 #, fuzzy, kde-format 14170 #| msgctxt "The destination of a file operation" 14171 #| msgid "Destination" 14172 msgctxt "@label" 14173 msgid "Duration" 14174 msgstr "गंतव्य" 14175 14176 #: kio/knfotranslator.cpp:63 14177 #, fuzzy, kde-format 14178 #| msgid "Device name" 14179 msgctxt "@label" 14180 msgid "Filename" 14181 msgstr "डिवाइस नाम" 14182 14183 #: kio/knfotranslator.cpp:64 14184 #, kde-format 14185 msgctxt "@label" 14186 msgid "Hash" 14187 msgstr "" 14188 14189 #: kio/knfotranslator.cpp:65 14190 #, kde-format 14191 msgctxt "@label" 14192 msgid "Height" 14193 msgstr "" 14194 14195 #: kio/knfotranslator.cpp:66 14196 #, kde-format 14197 msgctxt "@label" 14198 msgid "Interlace Mode" 14199 msgstr "" 14200 14201 #: kio/knfotranslator.cpp:67 14202 #, fuzzy, kde-format 14203 #| msgid "Link" 14204 msgctxt "@label number of lines" 14205 msgid "Lines" 14206 msgstr "लिंक" 14207 14208 #: kio/knfotranslator.cpp:68 14209 #, kde-format 14210 msgctxt "@label" 14211 msgid "Programming Language" 14212 msgstr "" 14213 14214 #: kio/knfotranslator.cpp:69 14215 #, kde-format 14216 msgctxt "@label" 14217 msgid "Sample Rate" 14218 msgstr "" 14219 14220 #: kio/knfotranslator.cpp:70 14221 #, fuzzy, kde-format 14222 #| msgid "Write" 14223 msgctxt "@label" 14224 msgid "Width" 14225 msgstr "लिखू" 14226 14227 #: kio/knfotranslator.cpp:71 14228 #, kde-format 14229 msgctxt "@label number of words" 14230 msgid "Words" 14231 msgstr "" 14232 14233 #: kio/knfotranslator.cpp:72 14234 #, kde-format 14235 msgctxt "@label EXIF aperture value" 14236 msgid "Aperture" 14237 msgstr "" 14238 14239 #: kio/knfotranslator.cpp:73 14240 #, kde-format 14241 msgctxt "@label EXIF" 14242 msgid "Exposure Bias Value" 14243 msgstr "" 14244 14245 #: kio/knfotranslator.cpp:74 14246 #, fuzzy, kde-format 14247 #| msgid "Exposure:" 14248 msgctxt "@label EXIF" 14249 msgid "Exposure Time" 14250 msgstr "उद्भासन:" 14251 14252 #: kio/knfotranslator.cpp:75 14253 #, fuzzy, kde-format 14254 #| msgid "Class" 14255 msgctxt "@label EXIF" 14256 msgid "Flash" 14257 msgstr "वर्ग" 14258 14259 #: kio/knfotranslator.cpp:76 14260 #, kde-format 14261 msgctxt "@label EXIF" 14262 msgid "Focal Length" 14263 msgstr "" 14264 14265 #: kio/knfotranslator.cpp:77 14266 #, kde-format 14267 msgctxt "@label EXIF" 14268 msgid "Focal Length 35 mm" 14269 msgstr "" 14270 14271 #: kio/knfotranslator.cpp:78 14272 #, kde-format 14273 msgctxt "@label EXIF" 14274 msgid "ISO Speed Ratings" 14275 msgstr "" 14276 14277 #: kio/knfotranslator.cpp:79 14278 #, fuzzy, kde-format 14279 #| msgid "Mask" 14280 msgctxt "@label EXIF" 14281 msgid "Make" 14282 msgstr "मास्क" 14283 14284 #: kio/knfotranslator.cpp:80 14285 #, kde-format 14286 msgctxt "@label EXIF" 14287 msgid "Metering Mode" 14288 msgstr "" 14289 14290 #: kio/knfotranslator.cpp:81 14291 #, kde-format 14292 msgctxt "@label EXIF" 14293 msgid "Model" 14294 msgstr "" 14295 14296 #: kio/knfotranslator.cpp:82 14297 #, fuzzy, kde-format 14298 #| msgid "Organization:" 14299 msgctxt "@label EXIF" 14300 msgid "Orientation" 14301 msgstr "संगठन:" 14302 14303 #: kio/knfotranslator.cpp:83 14304 #, kde-format 14305 msgctxt "@label EXIF" 14306 msgid "White Balance" 14307 msgstr "" 14308 14309 #: kio/knfotranslator.cpp:84 14310 #, fuzzy, kde-format 14311 #| msgid "Directory" 14312 msgctxt "@label video director" 14313 msgid "Director" 14314 msgstr "निर्देशिका" 14315 14316 #: kio/knfotranslator.cpp:85 14317 #, fuzzy, kde-format 14318 #| msgid "&General" 14319 msgctxt "@label music genre" 14320 msgid "Genre" 14321 msgstr "सामान्य (&G)" 14322 14323 #: kio/knfotranslator.cpp:86 14324 #, kde-format 14325 msgctxt "@label music album" 14326 msgid "Album" 14327 msgstr "" 14328 14329 #: kio/knfotranslator.cpp:87 14330 #, kde-format 14331 msgctxt "@label" 14332 msgid "Performer" 14333 msgstr "" 14334 14335 #: kio/knfotranslator.cpp:88 14336 #, kde-format 14337 msgctxt "@label" 14338 msgid "Release Date" 14339 msgstr "" 14340 14341 #: kio/knfotranslator.cpp:89 14342 #, kde-format 14343 msgctxt "@label music track number" 14344 msgid "Track" 14345 msgstr "" 14346 14347 #: kio/knfotranslator.cpp:90 14348 #, fuzzy, kde-format 14349 #| msgid "URL Resource Invalid" 14350 msgctxt "@label resource created time" 14351 msgid "Resource Created" 14352 msgstr "यूआरएल संसाधन अवैध अछि" 14353 14354 #: kio/knfotranslator.cpp:91 14355 #, fuzzy, kde-format 14356 #| msgctxt "The source of a file operation" 14357 #| msgid "Source" 14358 msgctxt "@label" 14359 msgid "Sub Resource" 14360 msgstr "श्रोत" 14361 14362 #: kio/knfotranslator.cpp:92 14363 #, fuzzy, kde-format 14364 #| msgid "Modified:" 14365 msgctxt "@label resource last modified" 14366 msgid "Resource Modified" 14367 msgstr "परिवर्धितः" 14368 14369 #: kio/knfotranslator.cpp:93 14370 #, fuzzy, kde-format 14371 #| msgid "Sorting" 14372 msgctxt "@label" 14373 msgid "Numeric Rating" 14374 msgstr "छाँटनाइ" 14375 14376 #: kio/knfotranslator.cpp:94 14377 #, kde-format 14378 msgctxt "@label" 14379 msgid "Copied From" 14380 msgstr "" 14381 14382 #: kio/knfotranslator.cpp:95 14383 #, kde-format 14384 msgctxt "@label" 14385 msgid "First Usage" 14386 msgstr "" 14387 14388 #: kio/knfotranslator.cpp:96 14389 #, kde-format 14390 msgctxt "@label" 14391 msgid "Last Usage" 14392 msgstr "" 14393 14394 #: kio/knfotranslator.cpp:97 14395 #, fuzzy, kde-format 14396 #| msgid "Comment" 14397 msgctxt "@label" 14398 msgid "Usage Count" 14399 msgstr "टिप्पणी" 14400 14401 #: kio/knfotranslator.cpp:98 14402 #, kde-format 14403 msgctxt "@label" 14404 msgid "Unix File Group" 14405 msgstr "" 14406 14407 #: kio/knfotranslator.cpp:99 14408 #, kde-format 14409 msgctxt "@label" 14410 msgid "Unix File Mode" 14411 msgstr "" 14412 14413 #: kio/knfotranslator.cpp:100 14414 #, fuzzy, kde-format 14415 #| msgid "Open file dialog" 14416 msgctxt "@label" 14417 msgid "Unix File Owner" 14418 msgstr "फाइल खोलबा क' संवाद" 14419 14420 #: kio/knfotranslator.cpp:101 14421 #, fuzzy, kde-format 14422 #| msgid "Type" 14423 msgctxt "@label file type" 14424 msgid "Type" 14425 msgstr "प्रकार" 14426 14427 #: kio/knfotranslator.cpp:102 14428 #, kde-format 14429 msgctxt "@label Number of fuzzy translations" 14430 msgid "Fuzzy Translations" 14431 msgstr "" 14432 14433 #: kio/knfotranslator.cpp:103 14434 #, kde-format 14435 msgctxt "@label Name of last translator" 14436 msgid "Last Translator" 14437 msgstr "" 14438 14439 #: kio/knfotranslator.cpp:104 14440 #, kde-format 14441 msgctxt "@label Number of obsolete translations" 14442 msgid "Obsolete Translations" 14443 msgstr "" 14444 14445 #: kio/knfotranslator.cpp:105 14446 #, kde-format 14447 msgctxt "@label" 14448 msgid "Translation Source Date" 14449 msgstr "" 14450 14451 #: kio/knfotranslator.cpp:106 14452 #, kde-format 14453 msgctxt "@label Number of total translations" 14454 msgid "Total Translations" 14455 msgstr "" 14456 14457 #: kio/knfotranslator.cpp:107 14458 #, fuzzy, kde-format 14459 #| msgid "Trash File" 14460 msgctxt "@label Number of translated strings" 14461 msgid "Translated" 14462 msgstr "फाइल मेटाबू" 14463 14464 #: kio/knfotranslator.cpp:108 14465 #, kde-format 14466 msgctxt "@label" 14467 msgid "Translation Date" 14468 msgstr "" 14469 14470 #: kio/knfotranslator.cpp:109 14471 #, kde-format 14472 msgctxt "@label Number of untranslated strings" 14473 msgid "Untranslated" 14474 msgstr "" 14475 14476 #: kio/kpreviewprops.cpp:51 14477 #, kde-format 14478 msgid "P&review" 14479 msgstr "पूर्वावलोकन (&r)" 14480 14481 #: kio/kscan.cpp:49 14482 #, kde-format 14483 msgid "Acquire Image" 14484 msgstr "छवि प्राप्त करू" 14485 14486 #: kio/kscan.cpp:97 14487 #, kde-format 14488 msgid "OCR Image" 14489 msgstr "ओसीआर छवि" 14490 14491 #: kio/netaccess.cpp:102 14492 #, kde-format 14493 msgid "File '%1' is not readable" 14494 msgstr "फाइल '%1' पढ़ै लायक नहि अछि" 14495 14496 #: kio/netaccess.cpp:435 14497 #, kde-format 14498 msgid "ERROR: Unknown protocol '%1'" 14499 msgstr "त्रुटि: अनचिन्ह प्रोटोकाल '%1'" 14500 14501 #: kio/passworddialog.cpp:56 14502 #, kde-format 14503 msgid "Authorization Dialog" 14504 msgstr "अनुमोदन समाद " 14505 14506 #: kioslave/metainfo/metainfo.cpp:98 14507 #, kde-format 14508 msgid "No metainfo for %1" 14509 msgstr "%1 क' लेल कोनो मेटाजानकारी नहि " 14510 14511 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14512 #: kssl/kcm/cacertificates.ui:24 14513 #, fuzzy, kde-format 14514 #| msgid "Organization:" 14515 msgid "Organization / Common Name" 14516 msgstr "संगठन:" 14517 14518 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14519 #: kssl/kcm/cacertificates.ui:29 14520 #, fuzzy, kde-format 14521 #| msgid "Organizational unit:" 14522 msgid "Organizational Unit" 14523 msgstr "संगठनात्मक एकाइ:" 14524 14525 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14526 #: kssl/kcm/cacertificates.ui:42 14527 #, kde-format 14528 msgid "Display..." 14529 msgstr "" 14530 14531 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14532 #: kssl/kcm/cacertificates.ui:68 14533 #, fuzzy, kde-format 14534 #| msgid "disable XIM" 14535 msgid "Disable" 14536 msgstr "एक्सआईएम अक्षम करू" 14537 14538 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14539 #: kssl/kcm/cacertificates.ui:78 14540 #, fuzzy, kde-format 14541 #| msgid "Emblems" 14542 msgid "Enable" 14543 msgstr "प्रतीक" 14544 14545 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14546 #: kssl/kcm/cacertificates.ui:104 14547 #, kde-format 14548 msgid "Remove" 14549 msgstr "हटाबू" 14550 14551 #. i18n: ectx: property (text), widget (QPushButton, add) 14552 #: kssl/kcm/cacertificates.ui:111 14553 #, kde-format 14554 msgid "Add..." 14555 msgstr "जोड़ू..." 14556 14557 #: kssl/kcm/cacertificatespage.cpp:140 14558 #, fuzzy, kde-format 14559 #| msgid "Send certificate" 14560 msgid "System certificates" 14561 msgstr "प्रमाणपत्र भेजू" 14562 14563 #: kssl/kcm/cacertificatespage.cpp:147 14564 #, fuzzy, kde-format 14565 #| msgid "Send certificate" 14566 msgid "User-added certificates" 14567 msgstr "प्रमाणपत्र भेजू" 14568 14569 #: kssl/kcm/cacertificatespage.cpp:302 14570 #, fuzzy, kde-format 14571 #| msgid "Certificate" 14572 msgid "Pick Certificates" 14573 msgstr "प्रमाणपत्र" 14574 14575 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14576 #: kssl/kcm/displaycert.ui:23 14577 #, fuzzy, kde-format 14578 #| msgid "Security Information" 14579 msgid "<b>Subject Information</b>" 14580 msgstr "सुरक्षा जानकारी" 14581 14582 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14583 #: kssl/kcm/displaycert.ui:39 14584 #, fuzzy, kde-format 14585 #| msgid " <b>[Cross Domain]</b>" 14586 msgid "<b>Issuer Information</b>" 14587 msgstr " <b>[क्रास डोमेन]</b>" 14588 14589 #. i18n: ectx: property (text), widget (QLabel, label) 14590 #: kssl/kcm/displaycert.ui:55 14591 #, fuzzy, kde-format 14592 #| msgid "<b>%1</b>" 14593 msgid "<b>Other</b>" 14594 msgstr "<b>%1</b>" 14595 14596 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14597 #: kssl/kcm/displaycert.ui:64 14598 #, kde-format 14599 msgid "Validity period" 14600 msgstr "" 14601 14602 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14603 #: kssl/kcm/displaycert.ui:78 14604 #, kde-format 14605 msgid "Serial number" 14606 msgstr "" 14607 14608 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14609 #: kssl/kcm/displaycert.ui:92 14610 #, kde-format 14611 msgid "MD5 digest" 14612 msgstr "" 14613 14614 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14615 #: kssl/kcm/displaycert.ui:106 14616 #, kde-format 14617 msgid "SHA1 digest" 14618 msgstr "" 14619 14620 #: kssl/kcm/displaycertdialog.cpp:73 14621 #, fuzzy, kde-format 14622 #| msgctxt "items: folders, files (size)" 14623 #| msgid "%1: %2" 14624 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14625 msgid "%1 to %2" 14626 msgstr "%1: %2" 14627 14628 #: kssl/kcm/kcmssl.cpp:37 14629 #, fuzzy, kde-format 14630 #| msgid "Reload configuration file" 14631 msgid "SSL Configuration Module" 14632 msgstr "बिन्यास फाइल फिनु सँ लोड करू" 14633 14634 #: kssl/kcm/kcmssl.cpp:39 14635 #, kde-format 14636 msgid "Copyright 2010 Andreas Hartmetz" 14637 msgstr "" 14638 14639 #: kssl/kcm/kcmssl.cpp:40 14640 #, kde-format 14641 msgid "Andreas Hartmetz" 14642 msgstr "" 14643 14644 #: kssl/kcm/kcmssl.cpp:52 14645 #, fuzzy, kde-format 14646 #| msgid "Link" 14647 msgid "SSL Signers" 14648 msgstr "लिंक" 14649 14650 #: kssl/ksslcertificate.cpp:202 14651 #, kde-format 14652 msgid "Signature Algorithm: " 14653 msgstr "हस्ताक्षर एल्गोरिदम: " 14654 14655 #: kssl/ksslcertificate.cpp:203 14656 #, kde-format 14657 msgid "Unknown" 14658 msgstr "अनचिन्ह" 14659 14660 #: kssl/ksslcertificate.cpp:206 14661 #, kde-format 14662 msgid "Signature Contents:" 14663 msgstr "हस्ताक्षर विषयवस्तु: " 14664 14665 #: kssl/ksslcertificate.cpp:341 14666 #, kde-format 14667 msgctxt "Unknown" 14668 msgid "Unknown key algorithm" 14669 msgstr "अनचिन्ह कुँजी अल्गोरिद्म" 14670 14671 #: kssl/ksslcertificate.cpp:347 14672 #, kde-format 14673 msgid "Key type: RSA (%1 bit)" 14674 msgstr "कुंजी प्रकार: आरएसए (%1 बिट)" 14675 14676 #: kssl/ksslcertificate.cpp:349 14677 #, kde-format 14678 msgid "Modulus: " 14679 msgstr "माडुलस: " 14680 14681 #: kssl/ksslcertificate.cpp:362 14682 #, kde-format 14683 msgid "Exponent: 0x" 14684 msgstr "एक्सपोनेंट: 0x" 14685 14686 #: kssl/ksslcertificate.cpp:374 14687 #, kde-format 14688 msgid "Key type: DSA (%1 bit)" 14689 msgstr "कुंजी प्रकार: डीएसए (%1 बिट)" 14690 14691 #: kssl/ksslcertificate.cpp:376 14692 #, kde-format 14693 msgid "Prime: " 14694 msgstr "प्राइम: " 14695 14696 #: kssl/ksslcertificate.cpp:389 14697 #, kde-format 14698 msgid "160 bit prime factor: " 14699 msgstr "160 बिट प्राइम फैक्टर: " 14700 14701 #: kssl/ksslcertificate.cpp:417 14702 #, kde-format 14703 msgid "Public key: " 14704 msgstr "सार्वजनिक कुंजीः" 14705 14706 #: kssl/ksslcertificate.cpp:1065 14707 #, kde-format 14708 msgid "The certificate is valid." 14709 msgstr "प्रमाणपत्र वैध अछि." 14710 14711 #: kssl/ksslcertificate.cpp:1067 14712 #, kde-format 14713 msgid "" 14714 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14715 "Authority) certificate can not be found." 14716 msgstr "" 14717 14718 #: kssl/ksslcertificate.cpp:1069 14719 #, kde-format 14720 msgid "" 14721 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14722 "CA's (Certificate Authority) CRL can not be found." 14723 msgstr "" 14724 14725 #: kssl/ksslcertificate.cpp:1071 14726 #, kde-format 14727 msgid "" 14728 "The decryption of the certificate's signature failed. This means it could " 14729 "not even be calculated as opposed to just not matching the expected result." 14730 msgstr "" 14731 14732 #: kssl/ksslcertificate.cpp:1073 14733 #, kde-format 14734 msgid "" 14735 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14736 "This means it could not even be calculated as opposed to just not matching " 14737 "the expected result." 14738 msgstr "" 14739 14740 #: kssl/ksslcertificate.cpp:1075 14741 #, kde-format 14742 msgid "" 14743 "The decoding of the public key of the issuer failed. This means that the " 14744 "CA's (Certificate Authority) certificate can not be used to verify the " 14745 "certificate you wanted to use." 14746 msgstr "" 14747 14748 #: kssl/ksslcertificate.cpp:1077 14749 #, kde-format 14750 msgid "" 14751 "The certificate's signature is invalid. This means that the certificate can " 14752 "not be verified." 14753 msgstr "" 14754 14755 #: kssl/ksslcertificate.cpp:1079 14756 #, kde-format 14757 msgid "" 14758 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14759 "that the CRL can not be verified." 14760 msgstr "" 14761 14762 #: kssl/ksslcertificate.cpp:1081 14763 #, kde-format 14764 msgid "The certificate is not valid, yet." 14765 msgstr "" 14766 14767 #: kssl/ksslcertificate.cpp:1083 14768 #, kde-format 14769 msgid "The certificate is not valid, any more." 14770 msgstr "" 14771 14772 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14773 #, kde-format 14774 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14775 msgstr "" 14776 14777 #: kssl/ksslcertificate.cpp:1089 14778 #, kde-format 14779 msgid "The time format of the certificate's 'notBefore' field is invalid." 14780 msgstr "" 14781 14782 #: kssl/ksslcertificate.cpp:1091 14783 #, kde-format 14784 msgid "The time format of the certificate's 'notAfter' field is invalid." 14785 msgstr "" 14786 14787 #: kssl/ksslcertificate.cpp:1093 14788 #, kde-format 14789 msgid "" 14790 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14791 "field is invalid." 14792 msgstr "" 14793 14794 #: kssl/ksslcertificate.cpp:1095 14795 #, kde-format 14796 msgid "" 14797 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14798 "field is invalid." 14799 msgstr "" 14800 14801 #: kssl/ksslcertificate.cpp:1097 14802 #, kde-format 14803 msgid "The OpenSSL process ran out of memory." 14804 msgstr "" 14805 14806 #: kssl/ksslcertificate.cpp:1099 14807 #, kde-format 14808 msgid "" 14809 "The certificate is self-signed and not in the list of trusted certificates. " 14810 "If you want to accept this certificate, import it into the list of trusted " 14811 "certificates." 14812 msgstr "" 14813 14814 #: kssl/ksslcertificate.cpp:1102 14815 #, kde-format 14816 msgid "" 14817 "The certificate is self-signed. While the trust chain could be built up, the " 14818 "root CA's (Certificate Authority) certificate can not be found." 14819 msgstr "" 14820 14821 #: kssl/ksslcertificate.cpp:1104 14822 #, kde-format 14823 msgid "" 14824 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14825 "your trust chain is broken." 14826 msgstr "" 14827 14828 #: kssl/ksslcertificate.cpp:1106 14829 #, kde-format 14830 msgid "" 14831 "The certificate can not be verified as it is the only certificate in the " 14832 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14833 "to import it into the list of trusted certificates." 14834 msgstr "" 14835 14836 #: kssl/ksslcertificate.cpp:1108 14837 #, kde-format 14838 msgid "The certificate chain is longer than the maximum depth specified." 14839 msgstr "" 14840 14841 #: kssl/ksslcertificate.cpp:1111 14842 #, kde-format 14843 msgid "The certificate has been revoked." 14844 msgstr "" 14845 14846 #: kssl/ksslcertificate.cpp:1113 14847 #, kde-format 14848 msgid "The certificate's CA (Certificate Authority) is invalid." 14849 msgstr "" 14850 14851 #: kssl/ksslcertificate.cpp:1115 14852 #, kde-format 14853 msgid "" 14854 "The length of the trust chain exceeded one of the CA's (Certificate " 14855 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14856 msgstr "" 14857 14858 #: kssl/ksslcertificate.cpp:1117 14859 #, kde-format 14860 msgid "" 14861 "The certificate has not been signed for the purpose you tried to use it for. " 14862 "This means the CA (Certificate Authority) does not allow this usage." 14863 msgstr "" 14864 14865 #: kssl/ksslcertificate.cpp:1120 14866 #, kde-format 14867 msgid "" 14868 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14869 "to use this certificate for." 14870 msgstr "" 14871 14872 #: kssl/ksslcertificate.cpp:1123 14873 #, kde-format 14874 msgid "" 14875 "The root CA (Certificate Authority) has been marked to be rejected for the " 14876 "purpose you tried to use it for." 14877 msgstr "" 14878 14879 #: kssl/ksslcertificate.cpp:1125 14880 #, kde-format 14881 msgid "" 14882 "The certificate's CA (Certificate Authority) does not match the CA name of " 14883 "the certificate." 14884 msgstr "" 14885 14886 #: kssl/ksslcertificate.cpp:1127 14887 #, kde-format 14888 msgid "" 14889 "The CA (Certificate Authority) certificate's key ID does not match the key " 14890 "ID in the 'Issuer' section of the certificate you are trying to use." 14891 msgstr "" 14892 14893 #: kssl/ksslcertificate.cpp:1129 14894 #, kde-format 14895 msgid "" 14896 "The CA (Certificate Authority) certificate's key ID and name do not match " 14897 "the key ID and name in the 'Issuer' section of the certificate you are " 14898 "trying to use." 14899 msgstr "" 14900 14901 #: kssl/ksslcertificate.cpp:1131 14902 #, kde-format 14903 msgid "" 14904 "The certificate's CA (Certificate Authority) is not allowed to sign " 14905 "certificates." 14906 msgstr "" 14907 14908 #: kssl/ksslcertificate.cpp:1133 14909 #, kde-format 14910 msgid "OpenSSL could not be verified." 14911 msgstr "" 14912 14913 #: kssl/ksslcertificate.cpp:1137 14914 #, kde-format 14915 msgid "" 14916 "The signature test for this certificate failed. This could mean that the " 14917 "signature of this certificate or any in its trust path are invalid, could " 14918 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14919 "verified. If you see this message, please let the author of the software you " 14920 "are using know that he or she should use the new, more specific error " 14921 "messages." 14922 msgstr "" 14923 14924 #: kssl/ksslcertificate.cpp:1139 14925 #, kde-format 14926 msgid "" 14927 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14928 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14929 "valid yet or not valid any more. If you see this message, please let the " 14930 "author of the software you are using know that he or she should use the new, " 14931 "more specific error messages." 14932 msgstr "" 14933 14934 #: kssl/ksslcertificate.cpp:1145 14935 #, kde-format 14936 msgid "" 14937 "Certificate signing authority root files could not be found so the " 14938 "certificate is not verified." 14939 msgstr "" 14940 "प्रमाणपत्र हस्ताक्षर करैबला अधिकृत रूट फाइल नहि भेटल इएल लेल प्रमाणपत्र सत्यापित नहि भेल." 14941 14942 #: kssl/ksslcertificate.cpp:1147 14943 #, kde-format 14944 msgid "SSL support was not found." 14945 msgstr "एसएसएल समर्थन नहि भेटल" 14946 14947 #: kssl/ksslcertificate.cpp:1149 14948 #, kde-format 14949 msgid "Private key test failed." 14950 msgstr "प्राइवेट कुँजी परीक्षण असफल" 14951 14952 #: kssl/ksslcertificate.cpp:1151 14953 #, kde-format 14954 msgid "The certificate has not been issued for this host." 14955 msgstr "ई होस्ट क' लेल प्रमाणपत्र जारी नहि भेल अछि." 14956 14957 #: kssl/ksslcertificate.cpp:1153 14958 #, kde-format 14959 msgid "This certificate is not relevant." 14960 msgstr "प्रमाणपत्र सम्बद्ध नहि अछि." 14961 14962 #: kssl/ksslcertificate.cpp:1158 14963 #, kde-format 14964 msgid "The certificate is invalid." 14965 msgstr "प्रमाणपत्र अवैध अछि." 14966 14967 #: kssl/ksslutils.cpp:90 14968 #, kde-format 14969 msgid "GMT" 14970 msgstr "जीएमटी" 14971 14972 #, fuzzy 14973 #~ msgctxt "color" 14974 #~ msgid "hot" 14975 #~ msgstr "मंगल" 14976 14977 #, fuzzy 14978 #~ msgctxt "color" 14979 #~ msgid "sea" 14980 #~ msgstr "ठहरू" 14981 14982 #, fuzzy 14983 #~ msgctxt "@item Calendar system" 14984 #~ msgid "Gregorian (Proleptic)" 14985 #~ msgstr "ग्रेगोरियन" 14986 14987 #, fuzzy 14988 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 14989 #~ msgid "of Mes" 14990 #~ msgstr "मेह क' " 14991 14992 #, fuzzy 14993 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 14994 #~ msgid "of Ter" 14995 #~ msgstr "तिर क' " 14996 14997 #, fuzzy 14998 #~ msgctxt "Ethiopian month 1 - ShortName" 14999 #~ msgid "Mes" 15000 #~ msgstr "हँ" 15001 15002 #, fuzzy 15003 #~ msgctxt "Ethiopian month 5 - LongName" 15004 #~ msgid "Ter" 15005 #~ msgstr "मंगल" 15006 15007 #, fuzzy 15008 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15009 #~ msgid "Ham" 15010 #~ msgstr "पूर्वाह्न" 15011 15012 #, fuzzy 15013 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15014 #~ msgid "Arb" 15015 #~ msgstr "बुध" 15016 15017 #, fuzzy 15018 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15019 #~ msgid "Rob" 15020 #~ msgstr "काज" 15021 15022 #, fuzzy 15023 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15024 #~ msgid "Arb" 15025 #~ msgstr "बुध" 15026 15027 #~ msgctxt "of May long" 15028 #~ msgid "of May" 15029 #~ msgstr "मई क' " 15030 15031 #~ msgctxt "May long" 15032 #~ msgid "May" 15033 #~ msgstr "मई" 15034 15035 #~ msgid "R. Thaani" 15036 #~ msgstr "र. उस्सानी" 15037 15038 #~ msgid "J. Thaani" 15039 #~ msgstr "ज. उस्सानी " 15040 15041 #~ msgid "Hijjah" 15042 #~ msgstr "जिल्हज" 15043 15044 #~ msgctxt "of Tir long" 15045 #~ msgid "of Tir" 15046 #~ msgstr "तिर क' " 15047 15048 #~ msgctxt "of Dei long" 15049 #~ msgid "of Dei" 15050 #~ msgstr "देई क' " 15051 15052 #~ msgctxt "Tir long" 15053 #~ msgid "Tir" 15054 #~ msgstr "तिर" 15055 15056 #~ msgctxt "Dei long" 15057 #~ msgid "Dei" 15058 #~ msgstr "देई" 15059 15060 #~ msgctxt "Shanbe short" 15061 #~ msgid "shn" 15062 #~ msgstr "shn"