Warning, /frameworks/kdelibs4support/po/hsb/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Upper Sorbian 0002 # translation of kdelibs4.po to 0003 # Copyright (C) 2003,2004, 2005, 2007 Free Software Foundation, Inc. 0004 # Eduard Werner <e.werner@rz.uni-leipzig.de>, 2003. 0005 # Prof. Dr. Eduard Werner <e.werner@rz.uni-leipzig.de>, 2003,2004. 0006 # Eduard Werner <edi.werner@gmx.de>, 2005. 0007 # Eduard Werner/Edward Wornar <edi.werner@gmx.de>, 2007, 2008. 0008 # Bianka Šwejdźic <hertn@gmx.de>, 2007, 2008. 0009 msgid "" 0010 msgstr "" 0011 "Project-Id-Version: kdelibs4\n" 0012 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0013 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0014 "PO-Revision-Date: 2008-12-19 22:49+0100\n" 0015 "Last-Translator: Eduard Werner <edi.werner@gmx.de>\n" 0016 "Language-Team: en_US <kde-i18n-doc@lists.kde.org>\n" 0017 "Language: hsb\n" 0018 "MIME-Version: 1.0\n" 0019 "Content-Type: text/plain; charset=UTF-8\n" 0020 "Content-Transfer-Encoding: 8bit\n" 0021 "Plural-Forms: nplurals=4; plural=n%100==1 ? 0 : n%100==2 ? 1 : n%100==3 || n" 0022 "%100==4 ? 2 : 3;\n" 0023 0024 #, kde-format 0025 msgctxt "NAME OF TRANSLATORS" 0026 msgid "Your names" 0027 msgstr "Edward Wornar" 0028 0029 #, kde-format 0030 msgctxt "EMAIL OF TRANSLATORS" 0031 msgid "Your emails" 0032 msgstr "edi.werner@gmx.de" 0033 0034 #, kde-format 0035 msgctxt "color" 0036 msgid "AliceBlue" 0037 msgstr "" 0038 0039 #, kde-format 0040 msgctxt "color" 0041 msgid "AntiqueWhite" 0042 msgstr "" 0043 0044 #, kde-format 0045 msgctxt "color" 0046 msgid "AntiqueWhite1" 0047 msgstr "" 0048 0049 #, kde-format 0050 msgctxt "color" 0051 msgid "AntiqueWhite2" 0052 msgstr "" 0053 0054 #, kde-format 0055 msgctxt "color" 0056 msgid "AntiqueWhite3" 0057 msgstr "" 0058 0059 #, kde-format 0060 msgctxt "color" 0061 msgid "AntiqueWhite4" 0062 msgstr "" 0063 0064 #, kde-format 0065 msgctxt "color" 0066 msgid "BlanchedAlmond" 0067 msgstr "" 0068 0069 #, kde-format 0070 msgctxt "color" 0071 msgid "BlueViolet" 0072 msgstr "" 0073 0074 #, kde-format 0075 msgctxt "color" 0076 msgid "CadetBlue" 0077 msgstr "" 0078 0079 #, kde-format 0080 msgctxt "color" 0081 msgid "CadetBlue1" 0082 msgstr "" 0083 0084 #, kde-format 0085 msgctxt "color" 0086 msgid "CadetBlue2" 0087 msgstr "" 0088 0089 #, kde-format 0090 msgctxt "color" 0091 msgid "CadetBlue3" 0092 msgstr "" 0093 0094 #, kde-format 0095 msgctxt "color" 0096 msgid "CadetBlue4" 0097 msgstr "" 0098 0099 #, kde-format 0100 msgctxt "color" 0101 msgid "CornflowerBlue" 0102 msgstr "" 0103 0104 #, kde-format 0105 msgctxt "color" 0106 msgid "DarkBlue" 0107 msgstr "" 0108 0109 #, kde-format 0110 msgctxt "color" 0111 msgid "DarkCyan" 0112 msgstr "" 0113 0114 #, kde-format 0115 msgctxt "color" 0116 msgid "DarkGoldenrod" 0117 msgstr "" 0118 0119 #, kde-format 0120 msgctxt "color" 0121 msgid "DarkGoldenrod1" 0122 msgstr "" 0123 0124 #, kde-format 0125 msgctxt "color" 0126 msgid "DarkGoldenrod2" 0127 msgstr "" 0128 0129 #, kde-format 0130 msgctxt "color" 0131 msgid "DarkGoldenrod3" 0132 msgstr "" 0133 0134 #, kde-format 0135 msgctxt "color" 0136 msgid "DarkGoldenrod4" 0137 msgstr "" 0138 0139 #, kde-format 0140 msgctxt "color" 0141 msgid "DarkGray" 0142 msgstr "" 0143 0144 #, kde-format 0145 msgctxt "color" 0146 msgid "DarkGreen" 0147 msgstr "" 0148 0149 #, kde-format 0150 msgctxt "color" 0151 msgid "DarkGrey" 0152 msgstr "" 0153 0154 #, kde-format 0155 msgctxt "color" 0156 msgid "DarkKhaki" 0157 msgstr "" 0158 0159 #, kde-format 0160 msgctxt "color" 0161 msgid "DarkMagenta" 0162 msgstr "" 0163 0164 #, kde-format 0165 msgctxt "color" 0166 msgid "DarkOliveGreen" 0167 msgstr "" 0168 0169 #, kde-format 0170 msgctxt "color" 0171 msgid "DarkOliveGreen1" 0172 msgstr "" 0173 0174 #, kde-format 0175 msgctxt "color" 0176 msgid "DarkOliveGreen2" 0177 msgstr "" 0178 0179 #, kde-format 0180 msgctxt "color" 0181 msgid "DarkOliveGreen3" 0182 msgstr "" 0183 0184 #, kde-format 0185 msgctxt "color" 0186 msgid "DarkOliveGreen4" 0187 msgstr "" 0188 0189 #, kde-format 0190 msgctxt "color" 0191 msgid "DarkOrange" 0192 msgstr "" 0193 0194 #, kde-format 0195 msgctxt "color" 0196 msgid "DarkOrange1" 0197 msgstr "" 0198 0199 #, kde-format 0200 msgctxt "color" 0201 msgid "DarkOrange2" 0202 msgstr "" 0203 0204 #, kde-format 0205 msgctxt "color" 0206 msgid "DarkOrange3" 0207 msgstr "" 0208 0209 #, kde-format 0210 msgctxt "color" 0211 msgid "DarkOrange4" 0212 msgstr "" 0213 0214 #, kde-format 0215 msgctxt "color" 0216 msgid "DarkOrchid" 0217 msgstr "" 0218 0219 #, kde-format 0220 msgctxt "color" 0221 msgid "DarkOrchid1" 0222 msgstr "" 0223 0224 #, kde-format 0225 msgctxt "color" 0226 msgid "DarkOrchid2" 0227 msgstr "" 0228 0229 #, kde-format 0230 msgctxt "color" 0231 msgid "DarkOrchid3" 0232 msgstr "" 0233 0234 #, kde-format 0235 msgctxt "color" 0236 msgid "DarkOrchid4" 0237 msgstr "" 0238 0239 #, kde-format 0240 msgctxt "color" 0241 msgid "DarkRed" 0242 msgstr "" 0243 0244 #, kde-format 0245 msgctxt "color" 0246 msgid "DarkSalmon" 0247 msgstr "" 0248 0249 #, kde-format 0250 msgctxt "color" 0251 msgid "DarkSeaGreen" 0252 msgstr "" 0253 0254 #, kde-format 0255 msgctxt "color" 0256 msgid "DarkSeaGreen1" 0257 msgstr "" 0258 0259 #, kde-format 0260 msgctxt "color" 0261 msgid "DarkSeaGreen2" 0262 msgstr "" 0263 0264 #, kde-format 0265 msgctxt "color" 0266 msgid "DarkSeaGreen3" 0267 msgstr "" 0268 0269 #, kde-format 0270 msgctxt "color" 0271 msgid "DarkSeaGreen4" 0272 msgstr "" 0273 0274 #, kde-format 0275 msgctxt "color" 0276 msgid "DarkSlateBlue" 0277 msgstr "" 0278 0279 #, kde-format 0280 msgctxt "color" 0281 msgid "DarkSlateGray" 0282 msgstr "" 0283 0284 #, kde-format 0285 msgctxt "color" 0286 msgid "DarkSlateGray1" 0287 msgstr "" 0288 0289 #, kde-format 0290 msgctxt "color" 0291 msgid "DarkSlateGray2" 0292 msgstr "" 0293 0294 #, kde-format 0295 msgctxt "color" 0296 msgid "DarkSlateGray3" 0297 msgstr "" 0298 0299 #, kde-format 0300 msgctxt "color" 0301 msgid "DarkSlateGray4" 0302 msgstr "" 0303 0304 #, kde-format 0305 msgctxt "color" 0306 msgid "DarkSlateGrey" 0307 msgstr "" 0308 0309 #, kde-format 0310 msgctxt "color" 0311 msgid "DarkTurquoise" 0312 msgstr "" 0313 0314 #, kde-format 0315 msgctxt "color" 0316 msgid "DarkViolet" 0317 msgstr "" 0318 0319 #, kde-format 0320 msgctxt "color" 0321 msgid "DeepPink" 0322 msgstr "" 0323 0324 #, kde-format 0325 msgctxt "color" 0326 msgid "DeepPink1" 0327 msgstr "" 0328 0329 #, kde-format 0330 msgctxt "color" 0331 msgid "DeepPink2" 0332 msgstr "" 0333 0334 #, kde-format 0335 msgctxt "color" 0336 msgid "DeepPink3" 0337 msgstr "" 0338 0339 #, kde-format 0340 msgctxt "color" 0341 msgid "DeepPink4" 0342 msgstr "" 0343 0344 #, kde-format 0345 msgctxt "color" 0346 msgid "DeepSkyBlue" 0347 msgstr "" 0348 0349 #, kde-format 0350 msgctxt "color" 0351 msgid "DeepSkyBlue1" 0352 msgstr "" 0353 0354 #, kde-format 0355 msgctxt "color" 0356 msgid "DeepSkyBlue2" 0357 msgstr "" 0358 0359 #, kde-format 0360 msgctxt "color" 0361 msgid "DeepSkyBlue3" 0362 msgstr "" 0363 0364 #, kde-format 0365 msgctxt "color" 0366 msgid "DeepSkyBlue4" 0367 msgstr "" 0368 0369 #, kde-format 0370 msgctxt "color" 0371 msgid "DimGray" 0372 msgstr "" 0373 0374 #, kde-format 0375 msgctxt "color" 0376 msgid "DimGrey" 0377 msgstr "" 0378 0379 #, kde-format 0380 msgctxt "color" 0381 msgid "DodgerBlue" 0382 msgstr "" 0383 0384 #, kde-format 0385 msgctxt "color" 0386 msgid "DodgerBlue1" 0387 msgstr "" 0388 0389 #, kde-format 0390 msgctxt "color" 0391 msgid "DodgerBlue2" 0392 msgstr "" 0393 0394 #, kde-format 0395 msgctxt "color" 0396 msgid "DodgerBlue3" 0397 msgstr "" 0398 0399 #, kde-format 0400 msgctxt "color" 0401 msgid "DodgerBlue4" 0402 msgstr "" 0403 0404 #, kde-format 0405 msgctxt "color" 0406 msgid "FloralWhite" 0407 msgstr "" 0408 0409 #, kde-format 0410 msgctxt "color" 0411 msgid "ForestGreen" 0412 msgstr "" 0413 0414 #, kde-format 0415 msgctxt "color" 0416 msgid "GhostWhite" 0417 msgstr "" 0418 0419 #, kde-format 0420 msgctxt "color" 0421 msgid "GreenYellow" 0422 msgstr "" 0423 0424 #, kde-format 0425 msgctxt "color" 0426 msgid "HotPink" 0427 msgstr "" 0428 0429 #, kde-format 0430 msgctxt "color" 0431 msgid "HotPink1" 0432 msgstr "" 0433 0434 #, kde-format 0435 msgctxt "color" 0436 msgid "HotPink2" 0437 msgstr "" 0438 0439 #, kde-format 0440 msgctxt "color" 0441 msgid "HotPink3" 0442 msgstr "" 0443 0444 #, kde-format 0445 msgctxt "color" 0446 msgid "HotPink4" 0447 msgstr "" 0448 0449 #, kde-format 0450 msgctxt "color" 0451 msgid "IndianRed" 0452 msgstr "" 0453 0454 #, kde-format 0455 msgctxt "color" 0456 msgid "IndianRed1" 0457 msgstr "" 0458 0459 #, kde-format 0460 msgctxt "color" 0461 msgid "IndianRed2" 0462 msgstr "" 0463 0464 #, kde-format 0465 msgctxt "color" 0466 msgid "IndianRed3" 0467 msgstr "" 0468 0469 #, kde-format 0470 msgctxt "color" 0471 msgid "IndianRed4" 0472 msgstr "" 0473 0474 #, kde-format 0475 msgctxt "color" 0476 msgid "LavenderBlush" 0477 msgstr "" 0478 0479 #, kde-format 0480 msgctxt "color" 0481 msgid "LavenderBlush1" 0482 msgstr "" 0483 0484 #, kde-format 0485 msgctxt "color" 0486 msgid "LavenderBlush2" 0487 msgstr "" 0488 0489 #, kde-format 0490 msgctxt "color" 0491 msgid "LavenderBlush3" 0492 msgstr "" 0493 0494 #, kde-format 0495 msgctxt "color" 0496 msgid "LavenderBlush4" 0497 msgstr "" 0498 0499 #, kde-format 0500 msgctxt "color" 0501 msgid "LawnGreen" 0502 msgstr "" 0503 0504 #, kde-format 0505 msgctxt "color" 0506 msgid "LemonChiffon" 0507 msgstr "" 0508 0509 #, kde-format 0510 msgctxt "color" 0511 msgid "LemonChiffon1" 0512 msgstr "" 0513 0514 #, kde-format 0515 msgctxt "color" 0516 msgid "LemonChiffon2" 0517 msgstr "" 0518 0519 #, kde-format 0520 msgctxt "color" 0521 msgid "LemonChiffon3" 0522 msgstr "" 0523 0524 #, kde-format 0525 msgctxt "color" 0526 msgid "LemonChiffon4" 0527 msgstr "" 0528 0529 #, kde-format 0530 msgctxt "color" 0531 msgid "LightBlue" 0532 msgstr "" 0533 0534 #, kde-format 0535 msgctxt "color" 0536 msgid "LightBlue1" 0537 msgstr "" 0538 0539 #, kde-format 0540 msgctxt "color" 0541 msgid "LightBlue2" 0542 msgstr "" 0543 0544 #, kde-format 0545 msgctxt "color" 0546 msgid "LightBlue3" 0547 msgstr "" 0548 0549 #, kde-format 0550 msgctxt "color" 0551 msgid "LightBlue4" 0552 msgstr "" 0553 0554 #, kde-format 0555 msgctxt "color" 0556 msgid "LightCoral" 0557 msgstr "" 0558 0559 #, kde-format 0560 msgctxt "color" 0561 msgid "LightCyan" 0562 msgstr "" 0563 0564 #, kde-format 0565 msgctxt "color" 0566 msgid "LightCyan1" 0567 msgstr "" 0568 0569 #, kde-format 0570 msgctxt "color" 0571 msgid "LightCyan2" 0572 msgstr "" 0573 0574 #, kde-format 0575 msgctxt "color" 0576 msgid "LightCyan3" 0577 msgstr "" 0578 0579 #, kde-format 0580 msgctxt "color" 0581 msgid "LightCyan4" 0582 msgstr "" 0583 0584 #, kde-format 0585 msgctxt "color" 0586 msgid "LightGoldenrod" 0587 msgstr "" 0588 0589 #, kde-format 0590 msgctxt "color" 0591 msgid "LightGoldenrod1" 0592 msgstr "" 0593 0594 #, kde-format 0595 msgctxt "color" 0596 msgid "LightGoldenrod2" 0597 msgstr "" 0598 0599 #, kde-format 0600 msgctxt "color" 0601 msgid "LightGoldenrod3" 0602 msgstr "" 0603 0604 #, kde-format 0605 msgctxt "color" 0606 msgid "LightGoldenrod4" 0607 msgstr "" 0608 0609 #, kde-format 0610 msgctxt "color" 0611 msgid "LightGoldenrodYellow" 0612 msgstr "" 0613 0614 #, kde-format 0615 msgctxt "color" 0616 msgid "LightGray" 0617 msgstr "" 0618 0619 #, kde-format 0620 msgctxt "color" 0621 msgid "LightGreen" 0622 msgstr "" 0623 0624 #, kde-format 0625 msgctxt "color" 0626 msgid "LightGrey" 0627 msgstr "" 0628 0629 #, kde-format 0630 msgctxt "color" 0631 msgid "LightPink" 0632 msgstr "" 0633 0634 #, kde-format 0635 msgctxt "color" 0636 msgid "LightPink1" 0637 msgstr "" 0638 0639 #, kde-format 0640 msgctxt "color" 0641 msgid "LightPink2" 0642 msgstr "" 0643 0644 #, kde-format 0645 msgctxt "color" 0646 msgid "LightPink3" 0647 msgstr "" 0648 0649 #, kde-format 0650 msgctxt "color" 0651 msgid "LightPink4" 0652 msgstr "" 0653 0654 #, kde-format 0655 msgctxt "color" 0656 msgid "LightSalmon" 0657 msgstr "" 0658 0659 #, kde-format 0660 msgctxt "color" 0661 msgid "LightSalmon1" 0662 msgstr "" 0663 0664 #, kde-format 0665 msgctxt "color" 0666 msgid "LightSalmon2" 0667 msgstr "" 0668 0669 #, kde-format 0670 msgctxt "color" 0671 msgid "LightSalmon3" 0672 msgstr "" 0673 0674 #, kde-format 0675 msgctxt "color" 0676 msgid "LightSalmon4" 0677 msgstr "" 0678 0679 #, kde-format 0680 msgctxt "color" 0681 msgid "LightSeaGreen" 0682 msgstr "" 0683 0684 #, kde-format 0685 msgctxt "color" 0686 msgid "LightSkyBlue" 0687 msgstr "" 0688 0689 #, kde-format 0690 msgctxt "color" 0691 msgid "LightSkyBlue1" 0692 msgstr "" 0693 0694 #, kde-format 0695 msgctxt "color" 0696 msgid "LightSkyBlue2" 0697 msgstr "" 0698 0699 #, kde-format 0700 msgctxt "color" 0701 msgid "LightSkyBlue3" 0702 msgstr "" 0703 0704 #, kde-format 0705 msgctxt "color" 0706 msgid "LightSkyBlue4" 0707 msgstr "" 0708 0709 #, kde-format 0710 msgctxt "color" 0711 msgid "LightSlateBlue" 0712 msgstr "" 0713 0714 #, kde-format 0715 msgctxt "color" 0716 msgid "LightSlateGray" 0717 msgstr "" 0718 0719 #, kde-format 0720 msgctxt "color" 0721 msgid "LightSlateGrey" 0722 msgstr "" 0723 0724 #, kde-format 0725 msgctxt "color" 0726 msgid "LightSteelBlue" 0727 msgstr "" 0728 0729 #, kde-format 0730 msgctxt "color" 0731 msgid "LightSteelBlue1" 0732 msgstr "" 0733 0734 #, kde-format 0735 msgctxt "color" 0736 msgid "LightSteelBlue2" 0737 msgstr "" 0738 0739 #, kde-format 0740 msgctxt "color" 0741 msgid "LightSteelBlue3" 0742 msgstr "" 0743 0744 #, kde-format 0745 msgctxt "color" 0746 msgid "LightSteelBlue4" 0747 msgstr "" 0748 0749 #, kde-format 0750 msgctxt "color" 0751 msgid "LightYellow" 0752 msgstr "" 0753 0754 #, kde-format 0755 msgctxt "color" 0756 msgid "LightYellow1" 0757 msgstr "" 0758 0759 #, kde-format 0760 msgctxt "color" 0761 msgid "LightYellow2" 0762 msgstr "" 0763 0764 #, kde-format 0765 msgctxt "color" 0766 msgid "LightYellow3" 0767 msgstr "" 0768 0769 #, kde-format 0770 msgctxt "color" 0771 msgid "LightYellow4" 0772 msgstr "" 0773 0774 #, kde-format 0775 msgctxt "color" 0776 msgid "LimeGreen" 0777 msgstr "" 0778 0779 #, kde-format 0780 msgctxt "color" 0781 msgid "MediumAquamarine" 0782 msgstr "" 0783 0784 #, kde-format 0785 msgctxt "color" 0786 msgid "MediumBlue" 0787 msgstr "" 0788 0789 #, kde-format 0790 msgctxt "color" 0791 msgid "MediumOrchid" 0792 msgstr "" 0793 0794 #, kde-format 0795 msgctxt "color" 0796 msgid "MediumOrchid1" 0797 msgstr "" 0798 0799 #, kde-format 0800 msgctxt "color" 0801 msgid "MediumOrchid2" 0802 msgstr "" 0803 0804 #, kde-format 0805 msgctxt "color" 0806 msgid "MediumOrchid3" 0807 msgstr "" 0808 0809 #, kde-format 0810 msgctxt "color" 0811 msgid "MediumOrchid4" 0812 msgstr "" 0813 0814 #, kde-format 0815 msgctxt "color" 0816 msgid "MediumPurple" 0817 msgstr "" 0818 0819 #, kde-format 0820 msgctxt "color" 0821 msgid "MediumPurple1" 0822 msgstr "" 0823 0824 #, kde-format 0825 msgctxt "color" 0826 msgid "MediumPurple2" 0827 msgstr "" 0828 0829 #, kde-format 0830 msgctxt "color" 0831 msgid "MediumPurple3" 0832 msgstr "" 0833 0834 #, kde-format 0835 msgctxt "color" 0836 msgid "MediumPurple4" 0837 msgstr "" 0838 0839 #, kde-format 0840 msgctxt "color" 0841 msgid "MediumSeaGreen" 0842 msgstr "" 0843 0844 #, kde-format 0845 msgctxt "color" 0846 msgid "MediumSlateBlue" 0847 msgstr "" 0848 0849 #, kde-format 0850 msgctxt "color" 0851 msgid "MediumSpringGreen" 0852 msgstr "" 0853 0854 #, kde-format 0855 msgctxt "color" 0856 msgid "MediumTurquoise" 0857 msgstr "" 0858 0859 #, kde-format 0860 msgctxt "color" 0861 msgid "MediumVioletRed" 0862 msgstr "" 0863 0864 #, kde-format 0865 msgctxt "color" 0866 msgid "MidnightBlue" 0867 msgstr "" 0868 0869 #, kde-format 0870 msgctxt "color" 0871 msgid "MintCream" 0872 msgstr "" 0873 0874 #, kde-format 0875 msgctxt "color" 0876 msgid "MistyRose" 0877 msgstr "" 0878 0879 #, kde-format 0880 msgctxt "color" 0881 msgid "MistyRose1" 0882 msgstr "" 0883 0884 #, kde-format 0885 msgctxt "color" 0886 msgid "MistyRose2" 0887 msgstr "" 0888 0889 #, kde-format 0890 msgctxt "color" 0891 msgid "MistyRose3" 0892 msgstr "" 0893 0894 #, kde-format 0895 msgctxt "color" 0896 msgid "MistyRose4" 0897 msgstr "" 0898 0899 #, kde-format 0900 msgctxt "color" 0901 msgid "NavajoWhite" 0902 msgstr "" 0903 0904 #, kde-format 0905 msgctxt "color" 0906 msgid "NavajoWhite1" 0907 msgstr "" 0908 0909 #, kde-format 0910 msgctxt "color" 0911 msgid "NavajoWhite2" 0912 msgstr "" 0913 0914 #, kde-format 0915 msgctxt "color" 0916 msgid "NavajoWhite3" 0917 msgstr "" 0918 0919 #, kde-format 0920 msgctxt "color" 0921 msgid "NavajoWhite4" 0922 msgstr "" 0923 0924 #, kde-format 0925 msgctxt "color" 0926 msgid "NavyBlue" 0927 msgstr "" 0928 0929 #, kde-format 0930 msgctxt "color" 0931 msgid "OldLace" 0932 msgstr "" 0933 0934 #, kde-format 0935 msgctxt "color" 0936 msgid "OliveDrab" 0937 msgstr "" 0938 0939 #, kde-format 0940 msgctxt "color" 0941 msgid "OliveDrab1" 0942 msgstr "" 0943 0944 #, kde-format 0945 msgctxt "color" 0946 msgid "OliveDrab2" 0947 msgstr "" 0948 0949 #, kde-format 0950 msgctxt "color" 0951 msgid "OliveDrab3" 0952 msgstr "" 0953 0954 #, kde-format 0955 msgctxt "color" 0956 msgid "OliveDrab4" 0957 msgstr "" 0958 0959 #, kde-format 0960 msgctxt "color" 0961 msgid "OrangeRed" 0962 msgstr "" 0963 0964 #, kde-format 0965 msgctxt "color" 0966 msgid "OrangeRed1" 0967 msgstr "" 0968 0969 #, kde-format 0970 msgctxt "color" 0971 msgid "OrangeRed2" 0972 msgstr "" 0973 0974 #, kde-format 0975 msgctxt "color" 0976 msgid "OrangeRed3" 0977 msgstr "" 0978 0979 #, kde-format 0980 msgctxt "color" 0981 msgid "OrangeRed4" 0982 msgstr "" 0983 0984 #, kde-format 0985 msgctxt "color" 0986 msgid "PaleGoldenrod" 0987 msgstr "" 0988 0989 #, kde-format 0990 msgctxt "color" 0991 msgid "PaleGreen" 0992 msgstr "" 0993 0994 #, kde-format 0995 msgctxt "color" 0996 msgid "PaleGreen1" 0997 msgstr "" 0998 0999 #, kde-format 1000 msgctxt "color" 1001 msgid "PaleGreen2" 1002 msgstr "" 1003 1004 #, kde-format 1005 msgctxt "color" 1006 msgid "PaleGreen3" 1007 msgstr "" 1008 1009 #, kde-format 1010 msgctxt "color" 1011 msgid "PaleGreen4" 1012 msgstr "" 1013 1014 #, kde-format 1015 msgctxt "color" 1016 msgid "PaleTurquoise" 1017 msgstr "" 1018 1019 #, kde-format 1020 msgctxt "color" 1021 msgid "PaleTurquoise1" 1022 msgstr "" 1023 1024 #, kde-format 1025 msgctxt "color" 1026 msgid "PaleTurquoise2" 1027 msgstr "" 1028 1029 #, kde-format 1030 msgctxt "color" 1031 msgid "PaleTurquoise3" 1032 msgstr "" 1033 1034 #, kde-format 1035 msgctxt "color" 1036 msgid "PaleTurquoise4" 1037 msgstr "" 1038 1039 #, kde-format 1040 msgctxt "color" 1041 msgid "PaleVioletRed" 1042 msgstr "" 1043 1044 #, kde-format 1045 msgctxt "color" 1046 msgid "PaleVioletRed1" 1047 msgstr "" 1048 1049 #, kde-format 1050 msgctxt "color" 1051 msgid "PaleVioletRed2" 1052 msgstr "" 1053 1054 #, kde-format 1055 msgctxt "color" 1056 msgid "PaleVioletRed3" 1057 msgstr "" 1058 1059 #, kde-format 1060 msgctxt "color" 1061 msgid "PaleVioletRed4" 1062 msgstr "" 1063 1064 #, kde-format 1065 msgctxt "color" 1066 msgid "PapayaWhip" 1067 msgstr "" 1068 1069 #, kde-format 1070 msgctxt "color" 1071 msgid "PeachPuff" 1072 msgstr "" 1073 1074 #, kde-format 1075 msgctxt "color" 1076 msgid "PeachPuff1" 1077 msgstr "" 1078 1079 #, kde-format 1080 msgctxt "color" 1081 msgid "PeachPuff2" 1082 msgstr "" 1083 1084 #, kde-format 1085 msgctxt "color" 1086 msgid "PeachPuff3" 1087 msgstr "" 1088 1089 #, kde-format 1090 msgctxt "color" 1091 msgid "PeachPuff4" 1092 msgstr "" 1093 1094 #, kde-format 1095 msgctxt "color" 1096 msgid "PowderBlue" 1097 msgstr "" 1098 1099 #, kde-format 1100 msgctxt "color" 1101 msgid "RosyBrown" 1102 msgstr "" 1103 1104 #, kde-format 1105 msgctxt "color" 1106 msgid "RosyBrown1" 1107 msgstr "" 1108 1109 #, kde-format 1110 msgctxt "color" 1111 msgid "RosyBrown2" 1112 msgstr "" 1113 1114 #, kde-format 1115 msgctxt "color" 1116 msgid "RosyBrown3" 1117 msgstr "" 1118 1119 #, kde-format 1120 msgctxt "color" 1121 msgid "RosyBrown4" 1122 msgstr "" 1123 1124 #, kde-format 1125 msgctxt "color" 1126 msgid "RoyalBlue" 1127 msgstr "" 1128 1129 #, kde-format 1130 msgctxt "color" 1131 msgid "RoyalBlue1" 1132 msgstr "" 1133 1134 #, kde-format 1135 msgctxt "color" 1136 msgid "RoyalBlue2" 1137 msgstr "" 1138 1139 #, kde-format 1140 msgctxt "color" 1141 msgid "RoyalBlue3" 1142 msgstr "" 1143 1144 #, kde-format 1145 msgctxt "color" 1146 msgid "RoyalBlue4" 1147 msgstr "" 1148 1149 #, kde-format 1150 msgctxt "color" 1151 msgid "SaddleBrown" 1152 msgstr "" 1153 1154 #, kde-format 1155 msgctxt "color" 1156 msgid "SandyBrown" 1157 msgstr "" 1158 1159 #, kde-format 1160 msgctxt "color" 1161 msgid "SeaGreen" 1162 msgstr "" 1163 1164 #, kde-format 1165 msgctxt "color" 1166 msgid "SeaGreen1" 1167 msgstr "" 1168 1169 #, kde-format 1170 msgctxt "color" 1171 msgid "SeaGreen2" 1172 msgstr "" 1173 1174 #, kde-format 1175 msgctxt "color" 1176 msgid "SeaGreen3" 1177 msgstr "" 1178 1179 #, kde-format 1180 msgctxt "color" 1181 msgid "SeaGreen4" 1182 msgstr "" 1183 1184 #, kde-format 1185 msgctxt "color" 1186 msgid "SkyBlue" 1187 msgstr "" 1188 1189 #, kde-format 1190 msgctxt "color" 1191 msgid "SkyBlue1" 1192 msgstr "" 1193 1194 #, kde-format 1195 msgctxt "color" 1196 msgid "SkyBlue2" 1197 msgstr "" 1198 1199 #, kde-format 1200 msgctxt "color" 1201 msgid "SkyBlue3" 1202 msgstr "" 1203 1204 #, kde-format 1205 msgctxt "color" 1206 msgid "SkyBlue4" 1207 msgstr "" 1208 1209 #, kde-format 1210 msgctxt "color" 1211 msgid "SlateBlue" 1212 msgstr "" 1213 1214 #, kde-format 1215 msgctxt "color" 1216 msgid "SlateBlue1" 1217 msgstr "" 1218 1219 #, kde-format 1220 msgctxt "color" 1221 msgid "SlateBlue2" 1222 msgstr "" 1223 1224 #, kde-format 1225 msgctxt "color" 1226 msgid "SlateBlue3" 1227 msgstr "" 1228 1229 #, kde-format 1230 msgctxt "color" 1231 msgid "SlateBlue4" 1232 msgstr "" 1233 1234 #, kde-format 1235 msgctxt "color" 1236 msgid "SlateGray" 1237 msgstr "" 1238 1239 #, kde-format 1240 msgctxt "color" 1241 msgid "SlateGray1" 1242 msgstr "" 1243 1244 #, kde-format 1245 msgctxt "color" 1246 msgid "SlateGray2" 1247 msgstr "" 1248 1249 #, kde-format 1250 msgctxt "color" 1251 msgid "SlateGray3" 1252 msgstr "" 1253 1254 #, kde-format 1255 msgctxt "color" 1256 msgid "SlateGray4" 1257 msgstr "" 1258 1259 #, kde-format 1260 msgctxt "color" 1261 msgid "SlateGrey" 1262 msgstr "" 1263 1264 #, kde-format 1265 msgctxt "color" 1266 msgid "SpringGreen" 1267 msgstr "" 1268 1269 #, kde-format 1270 msgctxt "color" 1271 msgid "SpringGreen1" 1272 msgstr "" 1273 1274 #, kde-format 1275 msgctxt "color" 1276 msgid "SpringGreen2" 1277 msgstr "" 1278 1279 #, kde-format 1280 msgctxt "color" 1281 msgid "SpringGreen3" 1282 msgstr "" 1283 1284 #, kde-format 1285 msgctxt "color" 1286 msgid "SpringGreen4" 1287 msgstr "" 1288 1289 #, kde-format 1290 msgctxt "color" 1291 msgid "SteelBlue" 1292 msgstr "" 1293 1294 #, kde-format 1295 msgctxt "color" 1296 msgid "SteelBlue1" 1297 msgstr "" 1298 1299 #, kde-format 1300 msgctxt "color" 1301 msgid "SteelBlue2" 1302 msgstr "" 1303 1304 #, kde-format 1305 msgctxt "color" 1306 msgid "SteelBlue3" 1307 msgstr "" 1308 1309 #, kde-format 1310 msgctxt "color" 1311 msgid "SteelBlue4" 1312 msgstr "" 1313 1314 #, kde-format 1315 msgctxt "color" 1316 msgid "VioletRed" 1317 msgstr "" 1318 1319 #, kde-format 1320 msgctxt "color" 1321 msgid "VioletRed1" 1322 msgstr "" 1323 1324 #, kde-format 1325 msgctxt "color" 1326 msgid "VioletRed2" 1327 msgstr "" 1328 1329 #, kde-format 1330 msgctxt "color" 1331 msgid "VioletRed3" 1332 msgstr "" 1333 1334 #, kde-format 1335 msgctxt "color" 1336 msgid "VioletRed4" 1337 msgstr "" 1338 1339 #, kde-format 1340 msgctxt "color" 1341 msgid "WhiteSmoke" 1342 msgstr "" 1343 1344 #, kde-format 1345 msgctxt "color" 1346 msgid "YellowGreen" 1347 msgstr "" 1348 1349 #, kde-format 1350 msgctxt "color" 1351 msgid "aquamarine" 1352 msgstr "" 1353 1354 #, kde-format 1355 msgctxt "color" 1356 msgid "aquamarine1" 1357 msgstr "" 1358 1359 #, kde-format 1360 msgctxt "color" 1361 msgid "aquamarine2" 1362 msgstr "" 1363 1364 #, kde-format 1365 msgctxt "color" 1366 msgid "aquamarine3" 1367 msgstr "" 1368 1369 #, kde-format 1370 msgctxt "color" 1371 msgid "aquamarine4" 1372 msgstr "" 1373 1374 #, kde-format 1375 msgctxt "color" 1376 msgid "azure" 1377 msgstr "" 1378 1379 #, kde-format 1380 msgctxt "color" 1381 msgid "azure1" 1382 msgstr "" 1383 1384 #, kde-format 1385 msgctxt "color" 1386 msgid "azure2" 1387 msgstr "" 1388 1389 #, kde-format 1390 msgctxt "color" 1391 msgid "azure3" 1392 msgstr "" 1393 1394 #, kde-format 1395 msgctxt "color" 1396 msgid "azure4" 1397 msgstr "" 1398 1399 #, kde-format 1400 msgctxt "color" 1401 msgid "beige" 1402 msgstr "" 1403 1404 #, kde-format 1405 msgctxt "color" 1406 msgid "bisque" 1407 msgstr "" 1408 1409 #, kde-format 1410 msgctxt "color" 1411 msgid "bisque1" 1412 msgstr "" 1413 1414 #, kde-format 1415 msgctxt "color" 1416 msgid "bisque2" 1417 msgstr "" 1418 1419 #, kde-format 1420 msgctxt "color" 1421 msgid "bisque3" 1422 msgstr "" 1423 1424 #, kde-format 1425 msgctxt "color" 1426 msgid "bisque4" 1427 msgstr "" 1428 1429 #, kde-format 1430 msgctxt "color" 1431 msgid "black" 1432 msgstr "" 1433 1434 #, kde-format 1435 msgctxt "color" 1436 msgid "blue" 1437 msgstr "" 1438 1439 #, kde-format 1440 msgctxt "color" 1441 msgid "blue1" 1442 msgstr "" 1443 1444 #, kde-format 1445 msgctxt "color" 1446 msgid "blue2" 1447 msgstr "" 1448 1449 #, kde-format 1450 msgctxt "color" 1451 msgid "blue3" 1452 msgstr "" 1453 1454 #, kde-format 1455 msgctxt "color" 1456 msgid "blue4" 1457 msgstr "" 1458 1459 #, kde-format 1460 msgctxt "color" 1461 msgid "brown" 1462 msgstr "" 1463 1464 #, kde-format 1465 msgctxt "color" 1466 msgid "brown1" 1467 msgstr "" 1468 1469 #, kde-format 1470 msgctxt "color" 1471 msgid "brown2" 1472 msgstr "" 1473 1474 #, kde-format 1475 msgctxt "color" 1476 msgid "brown3" 1477 msgstr "" 1478 1479 #, kde-format 1480 msgctxt "color" 1481 msgid "brown4" 1482 msgstr "" 1483 1484 #, kde-format 1485 msgctxt "color" 1486 msgid "burlywood" 1487 msgstr "" 1488 1489 #, kde-format 1490 msgctxt "color" 1491 msgid "burlywood1" 1492 msgstr "" 1493 1494 #, kde-format 1495 msgctxt "color" 1496 msgid "burlywood2" 1497 msgstr "" 1498 1499 #, kde-format 1500 msgctxt "color" 1501 msgid "burlywood3" 1502 msgstr "" 1503 1504 #, kde-format 1505 msgctxt "color" 1506 msgid "burlywood4" 1507 msgstr "" 1508 1509 #, kde-format 1510 msgctxt "color" 1511 msgid "chartreuse" 1512 msgstr "" 1513 1514 #, kde-format 1515 msgctxt "color" 1516 msgid "chartreuse1" 1517 msgstr "" 1518 1519 #, kde-format 1520 msgctxt "color" 1521 msgid "chartreuse2" 1522 msgstr "" 1523 1524 #, kde-format 1525 msgctxt "color" 1526 msgid "chartreuse3" 1527 msgstr "" 1528 1529 #, kde-format 1530 msgctxt "color" 1531 msgid "chartreuse4" 1532 msgstr "" 1533 1534 #, kde-format 1535 msgctxt "color" 1536 msgid "chocolate" 1537 msgstr "" 1538 1539 #, kde-format 1540 msgctxt "color" 1541 msgid "chocolate1" 1542 msgstr "" 1543 1544 #, kde-format 1545 msgctxt "color" 1546 msgid "chocolate2" 1547 msgstr "" 1548 1549 #, kde-format 1550 msgctxt "color" 1551 msgid "chocolate3" 1552 msgstr "" 1553 1554 #, kde-format 1555 msgctxt "color" 1556 msgid "chocolate4" 1557 msgstr "" 1558 1559 #, kde-format 1560 msgctxt "color" 1561 msgid "coral" 1562 msgstr "" 1563 1564 #, kde-format 1565 msgctxt "color" 1566 msgid "coral1" 1567 msgstr "" 1568 1569 #, kde-format 1570 msgctxt "color" 1571 msgid "coral2" 1572 msgstr "" 1573 1574 #, kde-format 1575 msgctxt "color" 1576 msgid "coral3" 1577 msgstr "" 1578 1579 #, kde-format 1580 msgctxt "color" 1581 msgid "coral4" 1582 msgstr "" 1583 1584 #, kde-format 1585 msgctxt "color" 1586 msgid "cornsilk" 1587 msgstr "" 1588 1589 #, kde-format 1590 msgctxt "color" 1591 msgid "cornsilk1" 1592 msgstr "" 1593 1594 #, kde-format 1595 msgctxt "color" 1596 msgid "cornsilk2" 1597 msgstr "" 1598 1599 #, kde-format 1600 msgctxt "color" 1601 msgid "cornsilk3" 1602 msgstr "" 1603 1604 #, kde-format 1605 msgctxt "color" 1606 msgid "cornsilk4" 1607 msgstr "" 1608 1609 #, kde-format 1610 msgctxt "color" 1611 msgid "cyan" 1612 msgstr "" 1613 1614 #, kde-format 1615 msgctxt "color" 1616 msgid "cyan1" 1617 msgstr "" 1618 1619 #, kde-format 1620 msgctxt "color" 1621 msgid "cyan2" 1622 msgstr "" 1623 1624 #, kde-format 1625 msgctxt "color" 1626 msgid "cyan3" 1627 msgstr "" 1628 1629 #, kde-format 1630 msgctxt "color" 1631 msgid "cyan4" 1632 msgstr "" 1633 1634 #, kde-format 1635 msgctxt "color" 1636 msgid "firebrick" 1637 msgstr "" 1638 1639 #, kde-format 1640 msgctxt "color" 1641 msgid "firebrick1" 1642 msgstr "" 1643 1644 #, kde-format 1645 msgctxt "color" 1646 msgid "firebrick2" 1647 msgstr "" 1648 1649 #, kde-format 1650 msgctxt "color" 1651 msgid "firebrick3" 1652 msgstr "" 1653 1654 #, kde-format 1655 msgctxt "color" 1656 msgid "firebrick4" 1657 msgstr "" 1658 1659 #, kde-format 1660 msgctxt "color" 1661 msgid "gainsboro" 1662 msgstr "" 1663 1664 #, kde-format 1665 msgctxt "color" 1666 msgid "gold" 1667 msgstr "" 1668 1669 #, kde-format 1670 msgctxt "color" 1671 msgid "gold1" 1672 msgstr "" 1673 1674 #, kde-format 1675 msgctxt "color" 1676 msgid "gold2" 1677 msgstr "" 1678 1679 #, kde-format 1680 msgctxt "color" 1681 msgid "gold3" 1682 msgstr "" 1683 1684 #, kde-format 1685 msgctxt "color" 1686 msgid "gold4" 1687 msgstr "" 1688 1689 #, kde-format 1690 msgctxt "color" 1691 msgid "goldenrod" 1692 msgstr "" 1693 1694 #, kde-format 1695 msgctxt "color" 1696 msgid "goldenrod1" 1697 msgstr "" 1698 1699 #, kde-format 1700 msgctxt "color" 1701 msgid "goldenrod2" 1702 msgstr "" 1703 1704 #, kde-format 1705 msgctxt "color" 1706 msgid "goldenrod3" 1707 msgstr "" 1708 1709 #, kde-format 1710 msgctxt "color" 1711 msgid "goldenrod4" 1712 msgstr "" 1713 1714 #, kde-format 1715 msgctxt "color" 1716 msgid "green" 1717 msgstr "" 1718 1719 #, kde-format 1720 msgctxt "color" 1721 msgid "green1" 1722 msgstr "" 1723 1724 #, kde-format 1725 msgctxt "color" 1726 msgid "green2" 1727 msgstr "" 1728 1729 #, kde-format 1730 msgctxt "color" 1731 msgid "green3" 1732 msgstr "" 1733 1734 #, kde-format 1735 msgctxt "color" 1736 msgid "green4" 1737 msgstr "" 1738 1739 #, kde-format 1740 msgctxt "color" 1741 msgid "honeydew" 1742 msgstr "" 1743 1744 #, kde-format 1745 msgctxt "color" 1746 msgid "honeydew1" 1747 msgstr "" 1748 1749 #, kde-format 1750 msgctxt "color" 1751 msgid "honeydew2" 1752 msgstr "" 1753 1754 #, kde-format 1755 msgctxt "color" 1756 msgid "honeydew3" 1757 msgstr "" 1758 1759 #, kde-format 1760 msgctxt "color" 1761 msgid "honeydew4" 1762 msgstr "" 1763 1764 #, kde-format 1765 msgctxt "color" 1766 msgid "ivory" 1767 msgstr "" 1768 1769 #, kde-format 1770 msgctxt "color" 1771 msgid "ivory1" 1772 msgstr "" 1773 1774 #, kde-format 1775 msgctxt "color" 1776 msgid "ivory2" 1777 msgstr "" 1778 1779 #, kde-format 1780 msgctxt "color" 1781 msgid "ivory3" 1782 msgstr "" 1783 1784 #, kde-format 1785 msgctxt "color" 1786 msgid "ivory4" 1787 msgstr "" 1788 1789 #, kde-format 1790 msgctxt "color" 1791 msgid "khaki" 1792 msgstr "" 1793 1794 #, kde-format 1795 msgctxt "color" 1796 msgid "khaki1" 1797 msgstr "" 1798 1799 #, kde-format 1800 msgctxt "color" 1801 msgid "khaki2" 1802 msgstr "" 1803 1804 #, kde-format 1805 msgctxt "color" 1806 msgid "khaki3" 1807 msgstr "" 1808 1809 #, kde-format 1810 msgctxt "color" 1811 msgid "khaki4" 1812 msgstr "" 1813 1814 #, kde-format 1815 msgctxt "color" 1816 msgid "lavender" 1817 msgstr "" 1818 1819 #, kde-format 1820 msgctxt "color" 1821 msgid "linen" 1822 msgstr "" 1823 1824 #, kde-format 1825 msgctxt "color" 1826 msgid "magenta" 1827 msgstr "" 1828 1829 #, kde-format 1830 msgctxt "color" 1831 msgid "magenta1" 1832 msgstr "" 1833 1834 #, kde-format 1835 msgctxt "color" 1836 msgid "magenta2" 1837 msgstr "" 1838 1839 #, kde-format 1840 msgctxt "color" 1841 msgid "magenta3" 1842 msgstr "" 1843 1844 #, kde-format 1845 msgctxt "color" 1846 msgid "magenta4" 1847 msgstr "" 1848 1849 #, kde-format 1850 msgctxt "color" 1851 msgid "maroon" 1852 msgstr "" 1853 1854 #, kde-format 1855 msgctxt "color" 1856 msgid "maroon1" 1857 msgstr "" 1858 1859 #, kde-format 1860 msgctxt "color" 1861 msgid "maroon2" 1862 msgstr "" 1863 1864 #, kde-format 1865 msgctxt "color" 1866 msgid "maroon3" 1867 msgstr "" 1868 1869 #, kde-format 1870 msgctxt "color" 1871 msgid "maroon4" 1872 msgstr "" 1873 1874 #, kde-format 1875 msgctxt "color" 1876 msgid "moccasin" 1877 msgstr "" 1878 1879 #, kde-format 1880 msgctxt "color" 1881 msgid "navy" 1882 msgstr "" 1883 1884 #, kde-format 1885 msgctxt "color" 1886 msgid "orange" 1887 msgstr "" 1888 1889 #, kde-format 1890 msgctxt "color" 1891 msgid "orange1" 1892 msgstr "" 1893 1894 #, kde-format 1895 msgctxt "color" 1896 msgid "orange2" 1897 msgstr "" 1898 1899 #, kde-format 1900 msgctxt "color" 1901 msgid "orange3" 1902 msgstr "" 1903 1904 #, kde-format 1905 msgctxt "color" 1906 msgid "orange4" 1907 msgstr "" 1908 1909 #, kde-format 1910 msgctxt "color" 1911 msgid "orchid" 1912 msgstr "" 1913 1914 #, kde-format 1915 msgctxt "color" 1916 msgid "orchid1" 1917 msgstr "" 1918 1919 #, kde-format 1920 msgctxt "color" 1921 msgid "orchid2" 1922 msgstr "" 1923 1924 #, kde-format 1925 msgctxt "color" 1926 msgid "orchid3" 1927 msgstr "" 1928 1929 #, kde-format 1930 msgctxt "color" 1931 msgid "orchid4" 1932 msgstr "" 1933 1934 #, kde-format 1935 msgctxt "color" 1936 msgid "peru" 1937 msgstr "" 1938 1939 #, kde-format 1940 msgctxt "color" 1941 msgid "pink" 1942 msgstr "" 1943 1944 #, kde-format 1945 msgctxt "color" 1946 msgid "pink1" 1947 msgstr "" 1948 1949 #, kde-format 1950 msgctxt "color" 1951 msgid "pink2" 1952 msgstr "" 1953 1954 #, kde-format 1955 msgctxt "color" 1956 msgid "pink3" 1957 msgstr "" 1958 1959 #, kde-format 1960 msgctxt "color" 1961 msgid "pink4" 1962 msgstr "" 1963 1964 #, kde-format 1965 msgctxt "color" 1966 msgid "plum" 1967 msgstr "" 1968 1969 #, kde-format 1970 msgctxt "color" 1971 msgid "plum1" 1972 msgstr "" 1973 1974 #, kde-format 1975 msgctxt "color" 1976 msgid "plum2" 1977 msgstr "" 1978 1979 #, kde-format 1980 msgctxt "color" 1981 msgid "plum3" 1982 msgstr "" 1983 1984 #, kde-format 1985 msgctxt "color" 1986 msgid "plum4" 1987 msgstr "" 1988 1989 #, kde-format 1990 msgctxt "color" 1991 msgid "purple" 1992 msgstr "" 1993 1994 #, kde-format 1995 msgctxt "color" 1996 msgid "purple1" 1997 msgstr "" 1998 1999 #, kde-format 2000 msgctxt "color" 2001 msgid "purple2" 2002 msgstr "" 2003 2004 #, kde-format 2005 msgctxt "color" 2006 msgid "purple3" 2007 msgstr "" 2008 2009 #, kde-format 2010 msgctxt "color" 2011 msgid "purple4" 2012 msgstr "" 2013 2014 #, fuzzy, kde-format 2015 msgctxt "color" 2016 msgid "red" 2017 msgstr "Srj" 2018 2019 #, kde-format 2020 msgctxt "color" 2021 msgid "red1" 2022 msgstr "" 2023 2024 #, kde-format 2025 msgctxt "color" 2026 msgid "red2" 2027 msgstr "" 2028 2029 #, kde-format 2030 msgctxt "color" 2031 msgid "red3" 2032 msgstr "" 2033 2034 #, kde-format 2035 msgctxt "color" 2036 msgid "red4" 2037 msgstr "" 2038 2039 #, kde-format 2040 msgctxt "color" 2041 msgid "salmon" 2042 msgstr "" 2043 2044 #, kde-format 2045 msgctxt "color" 2046 msgid "salmon1" 2047 msgstr "" 2048 2049 #, kde-format 2050 msgctxt "color" 2051 msgid "salmon2" 2052 msgstr "" 2053 2054 #, kde-format 2055 msgctxt "color" 2056 msgid "salmon3" 2057 msgstr "" 2058 2059 #, kde-format 2060 msgctxt "color" 2061 msgid "salmon4" 2062 msgstr "" 2063 2064 #, kde-format 2065 msgctxt "color" 2066 msgid "seashell" 2067 msgstr "" 2068 2069 #, kde-format 2070 msgctxt "color" 2071 msgid "seashell1" 2072 msgstr "" 2073 2074 #, kde-format 2075 msgctxt "color" 2076 msgid "seashell2" 2077 msgstr "" 2078 2079 #, kde-format 2080 msgctxt "color" 2081 msgid "seashell3" 2082 msgstr "" 2083 2084 #, kde-format 2085 msgctxt "color" 2086 msgid "seashell4" 2087 msgstr "" 2088 2089 #, kde-format 2090 msgctxt "color" 2091 msgid "sienna" 2092 msgstr "" 2093 2094 #, kde-format 2095 msgctxt "color" 2096 msgid "sienna1" 2097 msgstr "" 2098 2099 #, kde-format 2100 msgctxt "color" 2101 msgid "sienna2" 2102 msgstr "" 2103 2104 #, kde-format 2105 msgctxt "color" 2106 msgid "sienna3" 2107 msgstr "" 2108 2109 #, kde-format 2110 msgctxt "color" 2111 msgid "sienna4" 2112 msgstr "" 2113 2114 #, kde-format 2115 msgctxt "color" 2116 msgid "snow" 2117 msgstr "" 2118 2119 #, kde-format 2120 msgctxt "color" 2121 msgid "snow1" 2122 msgstr "" 2123 2124 #, kde-format 2125 msgctxt "color" 2126 msgid "snow2" 2127 msgstr "" 2128 2129 #, kde-format 2130 msgctxt "color" 2131 msgid "snow3" 2132 msgstr "" 2133 2134 #, kde-format 2135 msgctxt "color" 2136 msgid "snow4" 2137 msgstr "" 2138 2139 #, fuzzy, kde-format 2140 msgctxt "color" 2141 msgid "tan" 2142 msgstr "jan" 2143 2144 #, kde-format 2145 msgctxt "color" 2146 msgid "tan1" 2147 msgstr "" 2148 2149 #, kde-format 2150 msgctxt "color" 2151 msgid "tan2" 2152 msgstr "" 2153 2154 #, kde-format 2155 msgctxt "color" 2156 msgid "tan3" 2157 msgstr "" 2158 2159 #, kde-format 2160 msgctxt "color" 2161 msgid "tan4" 2162 msgstr "" 2163 2164 #, kde-format 2165 msgctxt "color" 2166 msgid "thistle" 2167 msgstr "" 2168 2169 #, kde-format 2170 msgctxt "color" 2171 msgid "thistle1" 2172 msgstr "" 2173 2174 #, kde-format 2175 msgctxt "color" 2176 msgid "thistle2" 2177 msgstr "" 2178 2179 #, kde-format 2180 msgctxt "color" 2181 msgid "thistle3" 2182 msgstr "" 2183 2184 #, kde-format 2185 msgctxt "color" 2186 msgid "thistle4" 2187 msgstr "" 2188 2189 #, kde-format 2190 msgctxt "color" 2191 msgid "tomato" 2192 msgstr "" 2193 2194 #, kde-format 2195 msgctxt "color" 2196 msgid "tomato1" 2197 msgstr "" 2198 2199 #, kde-format 2200 msgctxt "color" 2201 msgid "tomato2" 2202 msgstr "" 2203 2204 #, kde-format 2205 msgctxt "color" 2206 msgid "tomato3" 2207 msgstr "" 2208 2209 #, kde-format 2210 msgctxt "color" 2211 msgid "tomato4" 2212 msgstr "" 2213 2214 #, kde-format 2215 msgctxt "color" 2216 msgid "turquoise" 2217 msgstr "" 2218 2219 #, kde-format 2220 msgctxt "color" 2221 msgid "turquoise1" 2222 msgstr "" 2223 2224 #, kde-format 2225 msgctxt "color" 2226 msgid "turquoise2" 2227 msgstr "" 2228 2229 #, kde-format 2230 msgctxt "color" 2231 msgid "turquoise3" 2232 msgstr "" 2233 2234 #, kde-format 2235 msgctxt "color" 2236 msgid "turquoise4" 2237 msgstr "" 2238 2239 #, kde-format 2240 msgctxt "color" 2241 msgid "violet" 2242 msgstr "" 2243 2244 #, kde-format 2245 msgctxt "color" 2246 msgid "wheat" 2247 msgstr "" 2248 2249 #, kde-format 2250 msgctxt "color" 2251 msgid "wheat1" 2252 msgstr "" 2253 2254 #, kde-format 2255 msgctxt "color" 2256 msgid "wheat2" 2257 msgstr "" 2258 2259 #, kde-format 2260 msgctxt "color" 2261 msgid "wheat3" 2262 msgstr "" 2263 2264 #, kde-format 2265 msgctxt "color" 2266 msgid "wheat4" 2267 msgstr "" 2268 2269 #, kde-format 2270 msgctxt "color" 2271 msgid "white" 2272 msgstr "" 2273 2274 #, kde-format 2275 msgctxt "color" 2276 msgid "yellow" 2277 msgstr "" 2278 2279 #, kde-format 2280 msgctxt "color" 2281 msgid "yellow1" 2282 msgstr "" 2283 2284 #, kde-format 2285 msgctxt "color" 2286 msgid "yellow2" 2287 msgstr "" 2288 2289 #, kde-format 2290 msgctxt "color" 2291 msgid "yellow3" 2292 msgstr "" 2293 2294 #, kde-format 2295 msgctxt "color" 2296 msgid "yellow4" 2297 msgstr "" 2298 2299 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2300 #, kde-format 2301 msgid "Debug Settings" 2302 msgstr "" 2303 2304 #: kdebugdialog/kdebugdialog.cpp:59 2305 #, kde-format 2306 msgid "File" 2307 msgstr "Dataja" 2308 2309 #: kdebugdialog/kdebugdialog.cpp:60 2310 #, kde-format 2311 msgid "Message Box" 2312 msgstr "" 2313 2314 #: kdebugdialog/kdebugdialog.cpp:61 2315 #, kde-format 2316 msgid "Shell" 2317 msgstr "" 2318 2319 #: kdebugdialog/kdebugdialog.cpp:62 2320 #, kde-format 2321 msgid "Syslog" 2322 msgstr "" 2323 2324 #: kdebugdialog/kdebugdialog.cpp:63 2325 #, kde-format 2326 msgid "None" 2327 msgstr "Žane" 2328 2329 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2330 #: kdebugdialog/kdebugdialog.ui:48 2331 #, kde-format 2332 msgid "Information" 2333 msgstr "informacija" 2334 2335 #. i18n: ectx: property (text), widget (QLabel, label_2) 2336 #. i18n: ectx: property (text), widget (QLabel, label_8) 2337 #. i18n: ectx: property (text), widget (QLabel, label_4) 2338 #. i18n: ectx: property (text), widget (QLabel, label_6) 2339 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2340 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2341 #, kde-format 2342 msgid "Output to:" 2343 msgstr "" 2344 2345 #. i18n: ectx: property (text), widget (QLabel, label_3) 2346 #. i18n: ectx: property (text), widget (QLabel, label_9) 2347 #. i18n: ectx: property (text), widget (QLabel, label_5) 2348 #. i18n: ectx: property (text), widget (QLabel, label_7) 2349 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2350 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2351 #, fuzzy, kde-format 2352 #| msgid "File" 2353 msgid "Filename:" 2354 msgstr "Dataja" 2355 2356 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2357 #: kdebugdialog/kdebugdialog.ui:83 2358 #, kde-format 2359 msgid "Error" 2360 msgstr "Zmylk" 2361 2362 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2363 #: kdebugdialog/kdebugdialog.ui:118 2364 #, kde-format 2365 msgid "Abort on fatal errors" 2366 msgstr "" 2367 2368 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2369 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2370 #, kde-format 2371 msgid "Disable all debug output" 2372 msgstr "" 2373 2374 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2375 #: kdebugdialog/kdebugdialog.ui:145 2376 #, kde-format 2377 msgid "Warning" 2378 msgstr "Kedźbu" 2379 2380 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2381 #: kdebugdialog/kdebugdialog.ui:180 2382 #, fuzzy, kde-format 2383 #| msgid "Error" 2384 msgid "Fatal Error" 2385 msgstr "Zmylk" 2386 2387 #: kdebugdialog/klistdebugdialog.cpp:69 2388 #, kde-format 2389 msgid "&Select All" 2390 msgstr "" 2391 2392 #: kdebugdialog/klistdebugdialog.cpp:70 2393 #, kde-format 2394 msgid "&Deselect All" 2395 msgstr "" 2396 2397 #: kdebugdialog/main.cpp:100 2398 #, kde-format 2399 msgid "KDebugDialog" 2400 msgstr "" 2401 2402 #: kdebugdialog/main.cpp:101 2403 #, kde-format 2404 msgid "A dialog box for setting preferences for debug output" 2405 msgstr "" 2406 2407 #: kdebugdialog/main.cpp:102 2408 #, kde-format 2409 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2410 msgstr "" 2411 2412 #: kdebugdialog/main.cpp:103 2413 #, kde-format 2414 msgid "David Faure" 2415 msgstr "David Faure" 2416 2417 #: kdebugdialog/main.cpp:103 2418 #, fuzzy, kde-format 2419 #| msgid "MainWindow" 2420 msgid "Maintainer" 2421 msgstr "Hłownewokno" 2422 2423 #: kdebugdialog/main.cpp:108 2424 #, kde-format 2425 msgid "Show the fully-fledged dialog instead of the default list dialog" 2426 msgstr "" 2427 2428 #: kdebugdialog/main.cpp:109 2429 #, kde-format 2430 msgid "Turn area on" 2431 msgstr "" 2432 2433 #: kdebugdialog/main.cpp:110 2434 #, kde-format 2435 msgid "Turn area off" 2436 msgstr "" 2437 2438 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2439 #, kde-format 2440 msgid "no error" 2441 msgstr "žadyn zmylk" 2442 2443 #: kdecore/k3resolver.cpp:534 2444 #, kde-format 2445 msgid "requested family not supported for this host name" 2446 msgstr "pominana družina so za tutón server njepodpěruje" 2447 2448 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2449 #, kde-format 2450 msgid "temporary failure in name resolution" 2451 msgstr "Nachwilne zwrěšćenje rozwjazanja mjena" 2452 2453 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2454 #, kde-format 2455 msgid "non-recoverable failure in name resolution" 2456 msgstr "Fatalny zmylk při rozwjazanju mjena." 2457 2458 #: kdecore/k3resolver.cpp:537 2459 #, kde-format 2460 msgid "invalid flags" 2461 msgstr "njekorektne opcije" 2462 2463 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2464 #, kde-format 2465 msgid "memory allocation failure" 2466 msgstr "Zmylk wobstaranja pomjatka" 2467 2468 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2469 #, kde-format 2470 msgid "name or service not known" 2471 msgstr "njeznate mjeno abo service" 2472 2473 #: kdecore/k3resolver.cpp:540 2474 #, kde-format 2475 msgid "requested family not supported" 2476 msgstr "pominana družina njeje podpěrana" 2477 2478 #: kdecore/k3resolver.cpp:541 2479 #, kde-format 2480 msgid "requested service not supported for this socket type" 2481 msgstr "pominana družina njeje podpěrana za tutu družinu socketa" 2482 2483 #: kdecore/k3resolver.cpp:542 2484 #, kde-format 2485 msgid "requested socket type not supported" 2486 msgstr "pominana družina socketa so njepodpěruje" 2487 2488 #: kdecore/k3resolver.cpp:543 2489 #, kde-format 2490 msgid "unknown error" 2491 msgstr "njeznaty zmylk" 2492 2493 #: kdecore/k3resolver.cpp:545 2494 #, kde-format 2495 msgctxt "1: the i18n'ed system error code, from errno" 2496 msgid "system error: %1" 2497 msgstr "systemowy zmylk: %1" 2498 2499 #: kdecore/k3resolver.cpp:556 2500 #, kde-format 2501 msgid "request was canceled" 2502 msgstr "pominanje zběhnjene" 2503 2504 #: kdecore/k3socketaddress.cpp:631 2505 #, kde-format 2506 msgctxt "1: the unknown socket address family number" 2507 msgid "Unknown family %1" 2508 msgstr "Njeznata swójba %1" 2509 2510 #: kdecore/k3socketbase.cpp:215 2511 #, kde-format 2512 msgctxt "Socket error code NoError" 2513 msgid "no error" 2514 msgstr "žadyn zmylk" 2515 2516 #: kdecore/k3socketbase.cpp:220 2517 #, kde-format 2518 msgctxt "Socket error code LookupFailure" 2519 msgid "name lookup has failed" 2520 msgstr "pytanje za mjenom je so zwrěšćiło" 2521 2522 #: kdecore/k3socketbase.cpp:225 2523 #, kde-format 2524 msgctxt "Socket error code AddressInUse" 2525 msgid "address already in use" 2526 msgstr "adresa so hižo wužiwa" 2527 2528 #: kdecore/k3socketbase.cpp:230 2529 #, kde-format 2530 msgctxt "Socket error code AlreadyBound" 2531 msgid "socket is already bound" 2532 msgstr "socket je hižo wjazany" 2533 2534 #: kdecore/k3socketbase.cpp:235 2535 #, kde-format 2536 msgctxt "Socket error code AlreadyCreated" 2537 msgid "socket is already created" 2538 msgstr "socket je so hižo stworił" 2539 2540 #: kdecore/k3socketbase.cpp:240 2541 #, kde-format 2542 msgctxt "Socket error code NotBound" 2543 msgid "socket is not bound" 2544 msgstr "socket njeje wjazany" 2545 2546 #: kdecore/k3socketbase.cpp:245 2547 #, kde-format 2548 msgctxt "Socket error code NotCreated" 2549 msgid "socket has not been created" 2550 msgstr "socket so hišće njeje stworił" 2551 2552 #: kdecore/k3socketbase.cpp:250 2553 #, kde-format 2554 msgctxt "Socket error code WouldBlock" 2555 msgid "operation would block" 2556 msgstr "operacija by blokowała" 2557 2558 #: kdecore/k3socketbase.cpp:255 2559 #, kde-format 2560 msgctxt "Socket error code ConnectionRefused" 2561 msgid "connection actively refused" 2562 msgstr "zwisk je so aktiwnje wotpokazał" 2563 2564 #: kdecore/k3socketbase.cpp:260 2565 #, kde-format 2566 msgctxt "Socket error code ConnectionTimedOut" 2567 msgid "connection timed out" 2568 msgstr "sym předołho na zwisk čakał" 2569 2570 #: kdecore/k3socketbase.cpp:265 2571 #, kde-format 2572 msgctxt "Socket error code InProgress" 2573 msgid "operation is already in progress" 2574 msgstr "operacija so hižo wotměwa" 2575 2576 #: kdecore/k3socketbase.cpp:270 2577 #, kde-format 2578 msgctxt "Socket error code NetFailure" 2579 msgid "network failure occurred" 2580 msgstr "syćowy zmylk je so stał" 2581 2582 #: kdecore/k3socketbase.cpp:275 2583 #, kde-format 2584 msgctxt "Socket error code NotSupported" 2585 msgid "operation is not supported" 2586 msgstr "operacija so njepodpěruje" 2587 2588 #: kdecore/k3socketbase.cpp:280 2589 #, kde-format 2590 msgctxt "Socket error code Timeout" 2591 msgid "timed operation timed out" 2592 msgstr "operacijan z časowym wobmjezowanjom předołho traje" 2593 2594 #: kdecore/k3socketbase.cpp:285 2595 #, kde-format 2596 msgctxt "Socket error code UnknownError" 2597 msgid "an unknown/unexpected error has happened" 2598 msgstr "njeznaty abo njewočakowany zmylk je so stał" 2599 2600 #: kdecore/k3socketbase.cpp:290 2601 #, kde-format 2602 msgctxt "Socket error code RemotelyDisconnected" 2603 msgid "remote host closed connection" 2604 msgstr "dalny serwer je zwisk zakónčił" 2605 2606 #: kdecore/k4aboutdata.cpp:267 2607 #, kde-format 2608 msgid "" 2609 "No licensing terms for this program have been specified.\n" 2610 "Please check the documentation or the source for any\n" 2611 "licensing terms.\n" 2612 msgstr "" 2613 2614 #: kdecore/k4aboutdata.cpp:273 2615 #, kde-format 2616 msgid "This program is distributed under the terms of the %1." 2617 msgstr "" 2618 2619 #: kdecore/k4aboutdata.cpp:297 2620 #, kde-format 2621 msgctxt "@item license (short name)" 2622 msgid "GPL v2" 2623 msgstr "GPL v2" 2624 2625 #: kdecore/k4aboutdata.cpp:298 2626 #, kde-format 2627 msgctxt "@item license" 2628 msgid "GNU General Public License Version 2" 2629 msgstr "GNU General Public License Version 2" 2630 2631 #: kdecore/k4aboutdata.cpp:301 2632 #, kde-format 2633 msgctxt "@item license (short name)" 2634 msgid "LGPL v2" 2635 msgstr "LGPL v2" 2636 2637 #: kdecore/k4aboutdata.cpp:302 2638 #, kde-format 2639 msgctxt "@item license" 2640 msgid "GNU Lesser General Public License Version 2" 2641 msgstr "GNU Lesser General Public License Version 2" 2642 2643 #: kdecore/k4aboutdata.cpp:305 2644 #, kde-format 2645 msgctxt "@item license (short name)" 2646 msgid "BSD License" 2647 msgstr "BSD Licensa" 2648 2649 #: kdecore/k4aboutdata.cpp:306 2650 #, kde-format 2651 msgctxt "@item license" 2652 msgid "BSD License" 2653 msgstr "BSD Licensa" 2654 2655 #: kdecore/k4aboutdata.cpp:309 2656 #, kde-format 2657 msgctxt "@item license (short name)" 2658 msgid "Artistic License" 2659 msgstr "Artistic License" 2660 2661 #: kdecore/k4aboutdata.cpp:310 2662 #, kde-format 2663 msgctxt "@item license" 2664 msgid "Artistic License" 2665 msgstr "Artistic License" 2666 2667 #: kdecore/k4aboutdata.cpp:313 2668 #, kde-format 2669 msgctxt "@item license (short name)" 2670 msgid "QPL v1.0" 2671 msgstr "QPL v1.0" 2672 2673 #: kdecore/k4aboutdata.cpp:314 2674 #, kde-format 2675 msgctxt "@item license" 2676 msgid "Q Public License" 2677 msgstr "Q Public License" 2678 2679 #: kdecore/k4aboutdata.cpp:317 2680 #, kde-format 2681 msgctxt "@item license (short name)" 2682 msgid "GPL v3" 2683 msgstr "GPL v3" 2684 2685 #: kdecore/k4aboutdata.cpp:318 2686 #, kde-format 2687 msgctxt "@item license" 2688 msgid "GNU General Public License Version 3" 2689 msgstr "GNU General Public License Version 3" 2690 2691 #: kdecore/k4aboutdata.cpp:321 2692 #, kde-format 2693 msgctxt "@item license (short name)" 2694 msgid "LGPL v3" 2695 msgstr "LGPL v3" 2696 2697 #: kdecore/k4aboutdata.cpp:322 2698 #, kde-format 2699 msgctxt "@item license" 2700 msgid "GNU Lesser General Public License Version 3" 2701 msgstr "GNU Lesser General Public License Version 3" 2702 2703 #: kdecore/k4aboutdata.cpp:326 2704 #, kde-format 2705 msgctxt "@item license" 2706 msgid "Custom" 2707 msgstr "Konfigurowane" 2708 2709 #: kdecore/k4aboutdata.cpp:329 2710 #, kde-format 2711 msgctxt "@item license" 2712 msgid "Not specified" 2713 msgstr "Njepostajene " 2714 2715 #: kdecore/k4aboutdata.cpp:891 2716 #, kde-format 2717 msgctxt "replace this with information about your translation team" 2718 msgid "" 2719 "<p>KDE is translated into many languages thanks to the work of the " 2720 "translation teams all over the world.</p><p>For more information on KDE " 2721 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2722 "org</a></p>" 2723 msgstr "" 2724 "<p>KDE so dźakowano přełožowanskich skupin po cyłym swěće do wjele rěčow " 2725 "přełožuje. </p><p>Wjace informacije namakaće na <a href=\"http://l10n.kde.org" 2726 "\">http://l10n.kde.org</a></p>" 2727 2728 #: kdecore/kcalendarsystem.cpp:108 2729 #, kde-format 2730 msgctxt "@item Calendar system" 2731 msgid "Gregorian" 2732 msgstr "gregoriansce" 2733 2734 #: kdecore/kcalendarsystem.cpp:110 2735 #, fuzzy, kde-format 2736 msgctxt "@item Calendar system" 2737 msgid "Coptic" 2738 msgstr "Koptišćina" 2739 2740 #: kdecore/kcalendarsystem.cpp:112 2741 #, fuzzy, kde-format 2742 msgctxt "@item Calendar system" 2743 msgid "Ethiopian" 2744 msgstr "Etiopšćina" 2745 2746 #: kdecore/kcalendarsystem.cpp:114 2747 #, kde-format 2748 msgctxt "@item Calendar system" 2749 msgid "Hebrew" 2750 msgstr "hebrejsce" 2751 2752 #: kdecore/kcalendarsystem.cpp:116 2753 #, kde-format 2754 msgctxt "@item Calendar system" 2755 msgid "Islamic / Hijri (Civil)" 2756 msgstr "" 2757 2758 #: kdecore/kcalendarsystem.cpp:118 2759 #, kde-format 2760 msgctxt "@item Calendar system" 2761 msgid "Indian National" 2762 msgstr "" 2763 2764 #: kdecore/kcalendarsystem.cpp:120 2765 #, kde-format 2766 msgctxt "@item Calendar system" 2767 msgid "Jalali" 2768 msgstr "Jalali" 2769 2770 #: kdecore/kcalendarsystem.cpp:122 2771 #, kde-format 2772 msgctxt "@item Calendar system" 2773 msgid "Japanese" 2774 msgstr "" 2775 2776 #: kdecore/kcalendarsystem.cpp:124 2777 #, fuzzy, kde-format 2778 msgctxt "@item Calendar system" 2779 msgid "Julian" 2780 msgstr "jan" 2781 2782 #: kdecore/kcalendarsystem.cpp:126 2783 #, kde-format 2784 msgctxt "@item Calendar system" 2785 msgid "Taiwanese" 2786 msgstr "" 2787 2788 #: kdecore/kcalendarsystem.cpp:128 2789 #, fuzzy, kde-format 2790 #| msgid "R. Thaani" 2791 msgctxt "@item Calendar system" 2792 msgid "Thai" 2793 msgstr "R. Thaani" 2794 2795 #: kdecore/kcalendarsystem.cpp:131 2796 #, kde-format 2797 msgctxt "@item Calendar system" 2798 msgid "Invalid Calendar Type" 2799 msgstr "Njeznata protyka" 2800 2801 #: kdecore/kcalendarsystem.cpp:1495 2802 #, kde-format 2803 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2804 msgid "-" 2805 msgstr "" 2806 2807 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2808 #: kio/kfilemetadataprovider.cpp:199 2809 #, kde-format 2810 msgid "Today" 2811 msgstr "dźensa" 2812 2813 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2814 #: kio/kfilemetadataprovider.cpp:202 2815 #, kde-format 2816 msgid "Yesterday" 2817 msgstr "wčera" 2818 2819 #: kdecore/kcalendarsystemcoptic.cpp:45 2820 #, kde-format 2821 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2822 msgid "Anno Martyrum" 2823 msgstr "" 2824 2825 #: kdecore/kcalendarsystemcoptic.cpp:46 2826 #, kde-format 2827 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2828 msgid "AM" 2829 msgstr "" 2830 2831 #: kdecore/kcalendarsystemcoptic.cpp:47 2832 #, kde-format 2833 msgctxt "" 2834 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2835 msgid "%Ey %EC" 2836 msgstr "" 2837 2838 #: kdecore/kcalendarsystemcoptic.cpp:153 2839 #, kde-format 2840 msgctxt "Coptic month 1 - KLocale::NarrowName" 2841 msgid "T" 2842 msgstr "" 2843 2844 #: kdecore/kcalendarsystemcoptic.cpp:155 2845 #, kde-format 2846 msgctxt "Coptic month 2 - KLocale::NarrowName" 2847 msgid "P" 2848 msgstr "" 2849 2850 #: kdecore/kcalendarsystemcoptic.cpp:157 2851 #, kde-format 2852 msgctxt "Coptic month 3 - KLocale::NarrowName" 2853 msgid "H" 2854 msgstr "" 2855 2856 #: kdecore/kcalendarsystemcoptic.cpp:159 2857 #, kde-format 2858 msgctxt "Coptic month 4 - KLocale::NarrowName" 2859 msgid "K" 2860 msgstr "" 2861 2862 #: kdecore/kcalendarsystemcoptic.cpp:161 2863 #, kde-format 2864 msgctxt "Coptic month 5 - KLocale::NarrowName" 2865 msgid "T" 2866 msgstr "" 2867 2868 #: kdecore/kcalendarsystemcoptic.cpp:163 2869 #, kde-format 2870 msgctxt "Coptic month 6 - KLocale::NarrowName" 2871 msgid "M" 2872 msgstr "" 2873 2874 #: kdecore/kcalendarsystemcoptic.cpp:165 2875 #, kde-format 2876 msgctxt "Coptic month 7 - KLocale::NarrowName" 2877 msgid "P" 2878 msgstr "" 2879 2880 #: kdecore/kcalendarsystemcoptic.cpp:167 2881 #, kde-format 2882 msgctxt "Coptic month 8 - KLocale::NarrowName" 2883 msgid "P" 2884 msgstr "" 2885 2886 #: kdecore/kcalendarsystemcoptic.cpp:169 2887 #, kde-format 2888 msgctxt "Coptic month 9 - KLocale::NarrowName" 2889 msgid "P" 2890 msgstr "" 2891 2892 #: kdecore/kcalendarsystemcoptic.cpp:171 2893 #, kde-format 2894 msgctxt "Coptic month 10 - KLocale::NarrowName" 2895 msgid "P" 2896 msgstr "" 2897 2898 #: kdecore/kcalendarsystemcoptic.cpp:173 2899 #, kde-format 2900 msgctxt "Coptic month 11 - KLocale::NarrowName" 2901 msgid "E" 2902 msgstr "" 2903 2904 #: kdecore/kcalendarsystemcoptic.cpp:175 2905 #, kde-format 2906 msgctxt "Coptic month 12 - KLocale::NarrowName" 2907 msgid "M" 2908 msgstr "" 2909 2910 #: kdecore/kcalendarsystemcoptic.cpp:177 2911 #, kde-format 2912 msgctxt "Coptic month 13 - KLocale::NarrowName" 2913 msgid "K" 2914 msgstr "" 2915 2916 #: kdecore/kcalendarsystemcoptic.cpp:186 2917 #, fuzzy, kde-format 2918 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2919 msgid "of Tho" 2920 msgstr "wot Kho" 2921 2922 #: kdecore/kcalendarsystemcoptic.cpp:188 2923 #, fuzzy, kde-format 2924 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2925 msgid "of Pao" 2926 msgstr "Tamuz" 2927 2928 #: kdecore/kcalendarsystemcoptic.cpp:190 2929 #, fuzzy, kde-format 2930 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2931 msgid "of Hat" 2932 msgstr "Shvat" 2933 2934 #: kdecore/kcalendarsystemcoptic.cpp:192 2935 #, fuzzy, kde-format 2936 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2937 msgid "of Kia" 2938 msgstr "Nisan" 2939 2940 #: kdecore/kcalendarsystemcoptic.cpp:194 2941 #, fuzzy, kde-format 2942 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2943 msgid "of Tob" 2944 msgstr "februara" 2945 2946 #: kdecore/kcalendarsystemcoptic.cpp:196 2947 #, fuzzy, kde-format 2948 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2949 msgid "of Mes" 2950 msgstr "wot Meh" 2951 2952 #: kdecore/kcalendarsystemcoptic.cpp:198 2953 #, fuzzy, kde-format 2954 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2955 msgid "of Par" 2956 msgstr "měrca" 2957 2958 #: kdecore/kcalendarsystemcoptic.cpp:200 2959 #, fuzzy, kde-format 2960 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2961 msgid "of Pam" 2962 msgstr "Tamuz" 2963 2964 #: kdecore/kcalendarsystemcoptic.cpp:202 2965 #, fuzzy, kde-format 2966 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2967 msgid "of Pas" 2968 msgstr "wot Bah" 2969 2970 #: kdecore/kcalendarsystemcoptic.cpp:204 2971 #, fuzzy, kde-format 2972 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2973 msgid "of Pan" 2974 msgstr "januara" 2975 2976 #: kdecore/kcalendarsystemcoptic.cpp:206 2977 #, fuzzy, kde-format 2978 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2979 msgid "of Epe" 2980 msgstr "februara" 2981 2982 #: kdecore/kcalendarsystemcoptic.cpp:208 2983 #, fuzzy, kde-format 2984 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2985 msgid "of Meo" 2986 msgstr "wot Mora" 2987 2988 #: kdecore/kcalendarsystemcoptic.cpp:210 2989 #, fuzzy, kde-format 2990 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 2991 msgid "of Kou" 2992 msgstr "wot Kho" 2993 2994 #: kdecore/kcalendarsystemcoptic.cpp:219 2995 #, fuzzy, kde-format 2996 msgctxt "Coptic month 1 - KLocale::ShortName" 2997 msgid "Tho" 2998 msgstr "Thl" 2999 3000 #: kdecore/kcalendarsystemcoptic.cpp:221 3001 #, fuzzy, kde-format 3002 msgctxt "Coptic month 2 - KLocale::ShortName" 3003 msgid "Pao" 3004 msgstr "Zastajić" 3005 3006 #: kdecore/kcalendarsystemcoptic.cpp:223 3007 #, fuzzy, kde-format 3008 msgctxt "Coptic month 3 - KLocale::ShortName" 3009 msgid "Hat" 3010 msgstr "So" 3011 3012 #: kdecore/kcalendarsystemcoptic.cpp:225 3013 #, fuzzy, kde-format 3014 msgctxt "Coptic month 4 - KLocale::ShortName" 3015 msgid "Kia" 3016 msgstr "Kha" 3017 3018 #: kdecore/kcalendarsystemcoptic.cpp:227 3019 #, fuzzy, kde-format 3020 msgctxt "Coptic month 5 - KLocale::ShortName" 3021 msgid "Tob" 3022 msgstr "Nadawk" 3023 3024 #: kdecore/kcalendarsystemcoptic.cpp:229 3025 #, fuzzy, kde-format 3026 msgctxt "Coptic month 6 - KLocale::ShortName" 3027 msgid "Mes" 3028 msgstr "Haj" 3029 3030 #: kdecore/kcalendarsystemcoptic.cpp:231 3031 #, fuzzy, kde-format 3032 msgctxt "Coptic month 7 - KLocale::ShortName" 3033 msgid "Par" 3034 msgstr "měr" 3035 3036 #: kdecore/kcalendarsystemcoptic.cpp:233 3037 #, fuzzy, kde-format 3038 msgctxt "Coptic month 8 - KLocale::ShortName" 3039 msgid "Pam" 3040 msgstr "rano" 3041 3042 #: kdecore/kcalendarsystemcoptic.cpp:235 3043 #, fuzzy, kde-format 3044 msgctxt "Coptic month 9 - KLocale::ShortName" 3045 msgid "Pas" 3046 msgstr "Strony" 3047 3048 #: kdecore/kcalendarsystemcoptic.cpp:237 3049 #, fuzzy, kde-format 3050 msgctxt "Coptic month 10 - KLocale::ShortName" 3051 msgid "Pan" 3052 msgstr "jan" 3053 3054 #: kdecore/kcalendarsystemcoptic.cpp:239 3055 #, fuzzy, kde-format 3056 msgctxt "Coptic month 11 - KLocale::ShortName" 3057 msgid "Epe" 3058 msgstr "Escape" 3059 3060 #: kdecore/kcalendarsystemcoptic.cpp:241 3061 #, fuzzy, kde-format 3062 msgctxt "Coptic month 12 - KLocale::ShortName" 3063 msgid "Meo" 3064 msgstr "Pó" 3065 3066 #: kdecore/kcalendarsystemcoptic.cpp:243 3067 #, fuzzy, kde-format 3068 msgctxt "Coptic month 12 - KLocale::ShortName" 3069 msgid "Kou" 3070 msgstr "Kho" 3071 3072 #: kdecore/kcalendarsystemcoptic.cpp:252 3073 #, fuzzy, kde-format 3074 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3075 msgid "of Thoout" 3076 msgstr "wot Kho" 3077 3078 #: kdecore/kcalendarsystemcoptic.cpp:254 3079 #, fuzzy, kde-format 3080 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3081 msgid "of Paope" 3082 msgstr "Tamuz" 3083 3084 #: kdecore/kcalendarsystemcoptic.cpp:256 3085 #, fuzzy, kde-format 3086 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3087 msgid "of Hathor" 3088 msgstr "wot Hijjah" 3089 3090 #: kdecore/kcalendarsystemcoptic.cpp:258 3091 #, fuzzy, kde-format 3092 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3093 msgid "of Kiahk" 3094 msgstr "wot Kho" 3095 3096 #: kdecore/kcalendarsystemcoptic.cpp:260 3097 #, fuzzy, kde-format 3098 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3099 msgid "of Tobe" 3100 msgstr "oktobra" 3101 3102 #: kdecore/kcalendarsystemcoptic.cpp:262 3103 #, fuzzy, kde-format 3104 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3105 msgid "of Meshir" 3106 msgstr "wot Mehr" 3107 3108 #: kdecore/kcalendarsystemcoptic.cpp:264 3109 #, fuzzy, kde-format 3110 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3111 msgid "of Paremhotep" 3112 msgstr "Parametry" 3113 3114 #: kdecore/kcalendarsystemcoptic.cpp:266 3115 #, fuzzy, kde-format 3116 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3117 msgid "of Parmoute" 3118 msgstr "Tamuz" 3119 3120 #: kdecore/kcalendarsystemcoptic.cpp:268 3121 #, fuzzy, kde-format 3122 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3123 msgid "of Pashons" 3124 msgstr "wot Bah" 3125 3126 #: kdecore/kcalendarsystemcoptic.cpp:270 3127 #, fuzzy, kde-format 3128 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3129 msgid "of Paone" 3130 msgstr "januara" 3131 3132 #: kdecore/kcalendarsystemcoptic.cpp:272 3133 #, fuzzy, kde-format 3134 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3135 msgid "of Epep" 3136 msgstr "septembra" 3137 3138 #: kdecore/kcalendarsystemcoptic.cpp:274 3139 #, fuzzy, kde-format 3140 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3141 msgid "of Mesore" 3142 msgstr "wot Mora" 3143 3144 #: kdecore/kcalendarsystemcoptic.cpp:276 3145 #, fuzzy, kde-format 3146 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3147 msgid "of Kouji nabot" 3148 msgstr "februara" 3149 3150 #: kdecore/kcalendarsystemcoptic.cpp:285 3151 #, fuzzy, kde-format 3152 msgctxt "Coptic month 1 - KLocale::LongName" 3153 msgid "Thoout" 3154 msgstr "Štw" 3155 3156 #: kdecore/kcalendarsystemcoptic.cpp:287 3157 #, fuzzy, kde-format 3158 msgctxt "Coptic month 2 - KLocale::LongName" 3159 msgid "Paope" 3160 msgstr "Přiznak" 3161 3162 #: kdecore/kcalendarsystemcoptic.cpp:289 3163 #, fuzzy, kde-format 3164 msgctxt "Coptic month 3 - KLocale::LongName" 3165 msgid "Hathor" 3166 msgstr "Awtor" 3167 3168 #: kdecore/kcalendarsystemcoptic.cpp:291 3169 #, fuzzy, kde-format 3170 msgctxt "Coptic month 4 - KLocale::LongName" 3171 msgid "Kiahk" 3172 msgstr "wot Kho" 3173 3174 #: kdecore/kcalendarsystemcoptic.cpp:293 3175 #, fuzzy, kde-format 3176 msgctxt "Coptic month 5 - KLocale::LongName" 3177 msgid "Tobe" 3178 msgstr "Nadawk" 3179 3180 #: kdecore/kcalendarsystemcoptic.cpp:295 3181 #, fuzzy, kde-format 3182 msgctxt "Coptic month 6 - KLocale::LongName" 3183 msgid "Meshir" 3184 msgstr "Mehr" 3185 3186 #: kdecore/kcalendarsystemcoptic.cpp:297 3187 #, fuzzy, kde-format 3188 msgctxt "Coptic month 7 - KLocale::LongName" 3189 msgid "Paremhotep" 3190 msgstr "Parametry" 3191 3192 #: kdecore/kcalendarsystemcoptic.cpp:299 3193 #, fuzzy, kde-format 3194 msgctxt "Coptic month 8 - KLocale::LongName" 3195 msgid "Parmoute" 3196 msgstr "Parametry" 3197 3198 #: kdecore/kcalendarsystemcoptic.cpp:301 3199 #, fuzzy, kde-format 3200 msgctxt "Coptic month 9 - KLocale::LongName" 3201 msgid "Pashons" 3202 msgstr "Zastajić" 3203 3204 #: kdecore/kcalendarsystemcoptic.cpp:303 3205 #, fuzzy, kde-format 3206 msgctxt "Coptic month 10 - KLocale::LongName" 3207 msgid "Paone" 3208 msgstr "Žane" 3209 3210 #: kdecore/kcalendarsystemcoptic.cpp:305 3211 #, fuzzy, kde-format 3212 msgctxt "Coptic month 11 - KLocale::LongName" 3213 msgid "Epep" 3214 msgstr "Escape" 3215 3216 #: kdecore/kcalendarsystemcoptic.cpp:307 3217 #, fuzzy, kde-format 3218 msgctxt "Coptic month 12 - KLocale::LongName" 3219 msgid "Mesore" 3220 msgstr "&Prěnjotny staw" 3221 3222 #: kdecore/kcalendarsystemcoptic.cpp:309 3223 #, fuzzy, kde-format 3224 msgctxt "Coptic month 12 - KLocale::LongName" 3225 msgid "Kouji nabot" 3226 msgstr "februara" 3227 3228 #: kdecore/kcalendarsystemcoptic.cpp:324 3229 #, kde-format 3230 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3231 msgid "P" 3232 msgstr "" 3233 3234 #: kdecore/kcalendarsystemcoptic.cpp:326 3235 #, kde-format 3236 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3237 msgid "P" 3238 msgstr "" 3239 3240 #: kdecore/kcalendarsystemcoptic.cpp:328 3241 #, kde-format 3242 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3243 msgid "P" 3244 msgstr "" 3245 3246 #: kdecore/kcalendarsystemcoptic.cpp:330 3247 #, kde-format 3248 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3249 msgid "P" 3250 msgstr "" 3251 3252 #: kdecore/kcalendarsystemcoptic.cpp:332 3253 #, kde-format 3254 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3255 msgid "P" 3256 msgstr "" 3257 3258 #: kdecore/kcalendarsystemcoptic.cpp:334 3259 #, kde-format 3260 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3261 msgid "P" 3262 msgstr "" 3263 3264 #: kdecore/kcalendarsystemcoptic.cpp:336 3265 #, kde-format 3266 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3267 msgid "T" 3268 msgstr "" 3269 3270 #: kdecore/kcalendarsystemcoptic.cpp:345 3271 #, fuzzy, kde-format 3272 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3273 msgid "Pes" 3274 msgstr "Strony" 3275 3276 #: kdecore/kcalendarsystemcoptic.cpp:347 3277 #, fuzzy, kde-format 3278 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3279 msgid "Psh" 3280 msgstr "Zastajić" 3281 3282 #: kdecore/kcalendarsystemcoptic.cpp:349 3283 #, fuzzy, kde-format 3284 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3285 msgid "Pef" 3286 msgstr "Strony" 3287 3288 #: kdecore/kcalendarsystemcoptic.cpp:351 3289 #, kde-format 3290 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3291 msgid "Pti" 3292 msgstr "" 3293 3294 #: kdecore/kcalendarsystemcoptic.cpp:353 3295 #, fuzzy, kde-format 3296 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3297 msgid "Pso" 3298 msgstr "Zastajić" 3299 3300 #: kdecore/kcalendarsystemcoptic.cpp:355 3301 #, fuzzy, kde-format 3302 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3303 msgid "Psa" 3304 msgstr "Zastajić" 3305 3306 #: kdecore/kcalendarsystemcoptic.cpp:357 3307 #, kde-format 3308 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3309 msgid "Tky" 3310 msgstr "" 3311 3312 #: kdecore/kcalendarsystemcoptic.cpp:365 3313 #, fuzzy, kde-format 3314 msgctxt "Coptic weekday 1 - KLocale::LongName" 3315 msgid "Pesnau" 3316 msgstr "Zastajić" 3317 3318 #: kdecore/kcalendarsystemcoptic.cpp:367 3319 #, fuzzy, kde-format 3320 msgctxt "Coptic weekday 2 - KLocale::LongName" 3321 msgid "Pshoment" 3322 msgstr "Komentar" 3323 3324 #: kdecore/kcalendarsystemcoptic.cpp:369 3325 #, kde-format 3326 msgctxt "Coptic weekday 3 - KLocale::LongName" 3327 msgid "Peftoou" 3328 msgstr "" 3329 3330 #: kdecore/kcalendarsystemcoptic.cpp:371 3331 #, kde-format 3332 msgctxt "Coptic weekday 4 - KLocale::LongName" 3333 msgid "Ptiou" 3334 msgstr "" 3335 3336 #: kdecore/kcalendarsystemcoptic.cpp:373 3337 #, fuzzy, kde-format 3338 msgctxt "Coptic weekday 5 - KLocale::LongName" 3339 msgid "Psoou" 3340 msgstr "Zastajić" 3341 3342 #: kdecore/kcalendarsystemcoptic.cpp:375 3343 #, kde-format 3344 msgctxt "Coptic weekday 6 - KLocale::LongName" 3345 msgid "Psabbaton" 3346 msgstr "" 3347 3348 #: kdecore/kcalendarsystemcoptic.cpp:377 3349 #, kde-format 3350 msgctxt "Coptic weekday 7 - KLocale::LongName" 3351 msgid "Tkyriakē" 3352 msgstr "" 3353 3354 #: kdecore/kcalendarsystemethiopian.cpp:50 3355 #, kde-format 3356 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3357 msgid "Amata Mehrat" 3358 msgstr "" 3359 3360 #: kdecore/kcalendarsystemethiopian.cpp:51 3361 #, kde-format 3362 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3363 msgid "AM" 3364 msgstr "" 3365 3366 #: kdecore/kcalendarsystemethiopian.cpp:52 3367 #, kde-format 3368 msgctxt "" 3369 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3370 msgid "%Ey %EC" 3371 msgstr "" 3372 3373 #: kdecore/kcalendarsystemethiopian.cpp:66 3374 #, kde-format 3375 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3376 msgid "M" 3377 msgstr "" 3378 3379 #: kdecore/kcalendarsystemethiopian.cpp:68 3380 #, kde-format 3381 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3382 msgid "T" 3383 msgstr "" 3384 3385 #: kdecore/kcalendarsystemethiopian.cpp:70 3386 #, kde-format 3387 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3388 msgid "H" 3389 msgstr "" 3390 3391 #: kdecore/kcalendarsystemethiopian.cpp:72 3392 #, kde-format 3393 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3394 msgid "T" 3395 msgstr "" 3396 3397 #: kdecore/kcalendarsystemethiopian.cpp:74 3398 #, kde-format 3399 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3400 msgid "T" 3401 msgstr "" 3402 3403 #: kdecore/kcalendarsystemethiopian.cpp:76 3404 #, kde-format 3405 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3406 msgid "Y" 3407 msgstr "" 3408 3409 #: kdecore/kcalendarsystemethiopian.cpp:78 3410 #, kde-format 3411 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3412 msgid "M" 3413 msgstr "" 3414 3415 #: kdecore/kcalendarsystemethiopian.cpp:80 3416 #, kde-format 3417 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3418 msgid "M" 3419 msgstr "" 3420 3421 #: kdecore/kcalendarsystemethiopian.cpp:82 3422 #, kde-format 3423 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3424 msgid "G" 3425 msgstr "" 3426 3427 #: kdecore/kcalendarsystemethiopian.cpp:84 3428 #, kde-format 3429 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3430 msgid "S" 3431 msgstr "" 3432 3433 #: kdecore/kcalendarsystemethiopian.cpp:86 3434 #, kde-format 3435 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3436 msgid "H" 3437 msgstr "" 3438 3439 #: kdecore/kcalendarsystemethiopian.cpp:88 3440 #, kde-format 3441 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3442 msgid "N" 3443 msgstr "" 3444 3445 #: kdecore/kcalendarsystemethiopian.cpp:90 3446 #, kde-format 3447 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3448 msgid "P" 3449 msgstr "" 3450 3451 #: kdecore/kcalendarsystemethiopian.cpp:99 3452 #, fuzzy, kde-format 3453 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3454 msgid "of Mes" 3455 msgstr "wot Meh" 3456 3457 #: kdecore/kcalendarsystemethiopian.cpp:101 3458 #, fuzzy, kde-format 3459 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3460 msgid "of Teq" 3461 msgstr "Tevet" 3462 3463 #: kdecore/kcalendarsystemethiopian.cpp:103 3464 #, fuzzy, kde-format 3465 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3466 msgid "of Hed" 3467 msgstr "februara" 3468 3469 #: kdecore/kcalendarsystemethiopian.cpp:105 3470 #, fuzzy, kde-format 3471 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3472 msgid "of Tah" 3473 msgstr "wot Bah" 3474 3475 #: kdecore/kcalendarsystemethiopian.cpp:107 3476 #, fuzzy, kde-format 3477 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3478 msgid "of Ter" 3479 msgstr "wot Tira" 3480 3481 #: kdecore/kcalendarsystemethiopian.cpp:109 3482 #, fuzzy, kde-format 3483 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3484 msgid "of Yak" 3485 msgstr "januara" 3486 3487 #: kdecore/kcalendarsystemethiopian.cpp:111 3488 #, fuzzy, kde-format 3489 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3490 msgid "of Mag" 3491 msgstr "měrca" 3492 3493 #: kdecore/kcalendarsystemethiopian.cpp:113 3494 #, fuzzy, kde-format 3495 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3496 msgid "of Miy" 3497 msgstr "meje" 3498 3499 #: kdecore/kcalendarsystemethiopian.cpp:115 3500 #, fuzzy, kde-format 3501 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3502 msgid "of Gen" 3503 msgstr "januara" 3504 3505 #: kdecore/kcalendarsystemethiopian.cpp:117 3506 #, fuzzy, kde-format 3507 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3508 msgid "of Sen" 3509 msgstr "septembra" 3510 3511 #: kdecore/kcalendarsystemethiopian.cpp:119 3512 #, fuzzy, kde-format 3513 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3514 msgid "of Ham" 3515 msgstr "Tamuz" 3516 3517 #: kdecore/kcalendarsystemethiopian.cpp:121 3518 #, fuzzy, kde-format 3519 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3520 msgid "of Neh" 3521 msgstr "wot Meh" 3522 3523 #: kdecore/kcalendarsystemethiopian.cpp:123 3524 #, fuzzy, kde-format 3525 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3526 msgid "of Pag" 3527 msgstr "Tamuz" 3528 3529 #: kdecore/kcalendarsystemethiopian.cpp:132 3530 #, fuzzy, kde-format 3531 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3532 msgid "Mes" 3533 msgstr "Haj" 3534 3535 #: kdecore/kcalendarsystemethiopian.cpp:134 3536 #, fuzzy, kde-format 3537 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3538 msgid "Teq" 3539 msgstr "Wu" 3540 3541 #: kdecore/kcalendarsystemethiopian.cpp:136 3542 #, fuzzy, kde-format 3543 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3544 msgid "Hed" 3545 msgstr "Srj" 3546 3547 #: kdecore/kcalendarsystemethiopian.cpp:138 3548 #, fuzzy, kde-format 3549 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3550 msgid "Tah" 3551 msgstr "Thl" 3552 3553 #: kdecore/kcalendarsystemethiopian.cpp:140 3554 #, fuzzy, kde-format 3555 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3556 msgid "Ter" 3557 msgstr "Wu" 3558 3559 #: kdecore/kcalendarsystemethiopian.cpp:142 3560 #, fuzzy, kde-format 3561 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3562 msgid "Yak" 3563 msgstr "januara" 3564 3565 #: kdecore/kcalendarsystemethiopian.cpp:144 3566 #, fuzzy, kde-format 3567 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3568 msgid "Mag" 3569 msgstr "měr" 3570 3571 #: kdecore/kcalendarsystemethiopian.cpp:146 3572 #, fuzzy, kde-format 3573 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3574 msgid "Miy" 3575 msgstr "mej" 3576 3577 #: kdecore/kcalendarsystemethiopian.cpp:148 3578 #, fuzzy, kde-format 3579 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3580 msgid "Gen" 3581 msgstr "Zeleń:" 3582 3583 #: kdecore/kcalendarsystemethiopian.cpp:150 3584 #, fuzzy, kde-format 3585 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3586 msgid "Sen" 3587 msgstr "&Pósćel" 3588 3589 #: kdecore/kcalendarsystemethiopian.cpp:152 3590 #, fuzzy, kde-format 3591 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3592 msgid "Ham" 3593 msgstr "rano" 3594 3595 #: kdecore/kcalendarsystemethiopian.cpp:154 3596 #, fuzzy, kde-format 3597 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3598 msgid "Neh" 3599 msgstr "Meh" 3600 3601 #: kdecore/kcalendarsystemethiopian.cpp:156 3602 #, fuzzy, kde-format 3603 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3604 msgid "Pag" 3605 msgstr "Strony" 3606 3607 #: kdecore/kcalendarsystemethiopian.cpp:165 3608 #, fuzzy, kde-format 3609 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3610 msgid "of Meskerem" 3611 msgstr "wot Mehr" 3612 3613 #: kdecore/kcalendarsystemethiopian.cpp:167 3614 #, fuzzy, kde-format 3615 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3616 msgid "of Tequemt" 3617 msgstr "Tevet" 3618 3619 #: kdecore/kcalendarsystemethiopian.cpp:169 3620 #, fuzzy, kde-format 3621 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3622 msgid "of Hedar" 3623 msgstr "Adar" 3624 3625 #: kdecore/kcalendarsystemethiopian.cpp:171 3626 #, fuzzy, kde-format 3627 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3628 msgid "of Tahsas" 3629 msgstr "wot Bahman" 3630 3631 #: kdecore/kcalendarsystemethiopian.cpp:173 3632 #, fuzzy, kde-format 3633 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3634 msgid "of Ter" 3635 msgstr "wot Tira" 3636 3637 #: kdecore/kcalendarsystemethiopian.cpp:175 3638 #, fuzzy, kde-format 3639 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3640 msgid "of Yakatit" 3641 msgstr "wot Fara" 3642 3643 #: kdecore/kcalendarsystemethiopian.cpp:177 3644 #, fuzzy, kde-format 3645 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3646 msgid "of Magabit" 3647 msgstr "wot Rajab" 3648 3649 #: kdecore/kcalendarsystemethiopian.cpp:179 3650 #, fuzzy, kde-format 3651 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3652 msgid "of Miyazya" 3653 msgstr "meje" 3654 3655 #: kdecore/kcalendarsystemethiopian.cpp:181 3656 #, fuzzy, kde-format 3657 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3658 msgid "of Genbot" 3659 msgstr "februara" 3660 3661 #: kdecore/kcalendarsystemethiopian.cpp:183 3662 #, fuzzy, kde-format 3663 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3664 msgid "of Sene" 3665 msgstr "septembra" 3666 3667 #: kdecore/kcalendarsystemethiopian.cpp:185 3668 #, fuzzy, kde-format 3669 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3670 msgid "of Hamle" 3671 msgstr "Tamuz" 3672 3673 #: kdecore/kcalendarsystemethiopian.cpp:187 3674 #, fuzzy, kde-format 3675 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3676 msgid "of Nehase" 3677 msgstr "wot Sha" 3678 3679 #: kdecore/kcalendarsystemethiopian.cpp:189 3680 #, fuzzy, kde-format 3681 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3682 msgid "of Pagumen" 3683 msgstr "Tamuz" 3684 3685 #: kdecore/kcalendarsystemethiopian.cpp:198 3686 #, fuzzy, kde-format 3687 msgctxt "Ethiopian month 1 - KLocale::LongName" 3688 msgid "Meskerem" 3689 msgstr "wot Mehr" 3690 3691 #: kdecore/kcalendarsystemethiopian.cpp:200 3692 #, fuzzy, kde-format 3693 msgctxt "Ethiopian month 2 - KLocale::LongName" 3694 msgid "Tequemt" 3695 msgstr "Tevet" 3696 3697 #: kdecore/kcalendarsystemethiopian.cpp:202 3698 #, fuzzy, kde-format 3699 msgctxt "Ethiopian month 3 - KLocale::LongName" 3700 msgid "Hedar" 3701 msgstr "Adar" 3702 3703 #: kdecore/kcalendarsystemethiopian.cpp:204 3704 #, fuzzy, kde-format 3705 msgctxt "Ethiopian month 4 - KLocale::LongName" 3706 msgid "Tahsas" 3707 msgstr "Task" 3708 3709 #: kdecore/kcalendarsystemethiopian.cpp:206 3710 #, fuzzy, kde-format 3711 msgctxt "Ethiopian month 5 - KLocale::LongName" 3712 msgid "Ter" 3713 msgstr "Wu" 3714 3715 #: kdecore/kcalendarsystemethiopian.cpp:208 3716 #, fuzzy, kde-format 3717 msgctxt "Ethiopian month 6 - KLocale::LongName" 3718 msgid "Yakatit" 3719 msgstr "wot Fara" 3720 3721 #: kdecore/kcalendarsystemethiopian.cpp:210 3722 #, fuzzy, kde-format 3723 msgctxt "Ethiopian month 7 - KLocale::LongName" 3724 msgid "Magabit" 3725 msgstr "wot Rajab" 3726 3727 #: kdecore/kcalendarsystemethiopian.cpp:212 3728 #, fuzzy, kde-format 3729 msgctxt "Ethiopian month 8 - KLocale::LongName" 3730 msgid "Miyazya" 3731 msgstr "meje" 3732 3733 #: kdecore/kcalendarsystemethiopian.cpp:214 3734 #, fuzzy, kde-format 3735 msgctxt "Ethiopian month 9 - KLocale::LongName" 3736 msgid "Genbot" 3737 msgstr "februara" 3738 3739 #: kdecore/kcalendarsystemethiopian.cpp:216 3740 #, fuzzy, kde-format 3741 msgctxt "Ethiopian month 10 - KLocale::LongName" 3742 msgid "Sene" 3743 msgstr "&Pósćel" 3744 3745 #: kdecore/kcalendarsystemethiopian.cpp:218 3746 #, fuzzy, kde-format 3747 msgctxt "Ethiopian month 11 - KLocale::LongName" 3748 msgid "Hamle" 3749 msgstr "Mjeno" 3750 3751 #: kdecore/kcalendarsystemethiopian.cpp:220 3752 #, fuzzy, kde-format 3753 msgctxt "Ethiopian month 12 - KLocale::LongName" 3754 msgid "Nehase" 3755 msgstr "Mjeno" 3756 3757 #: kdecore/kcalendarsystemethiopian.cpp:222 3758 #, fuzzy, kde-format 3759 msgctxt "Ethiopian month 13 - KLocale::LongName" 3760 msgid "Pagumen" 3761 msgstr "Strony" 3762 3763 #: kdecore/kcalendarsystemethiopian.cpp:236 3764 #, kde-format 3765 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3766 msgid "S" 3767 msgstr "" 3768 3769 #: kdecore/kcalendarsystemethiopian.cpp:238 3770 #, kde-format 3771 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3772 msgid "M" 3773 msgstr "" 3774 3775 #: kdecore/kcalendarsystemethiopian.cpp:240 3776 #, kde-format 3777 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3778 msgid "R" 3779 msgstr "" 3780 3781 #: kdecore/kcalendarsystemethiopian.cpp:242 3782 #, kde-format 3783 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3784 msgid "H" 3785 msgstr "" 3786 3787 #: kdecore/kcalendarsystemethiopian.cpp:244 3788 #, fuzzy, kde-format 3789 #| msgid "Av" 3790 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3791 msgid "A" 3792 msgstr "Av" 3793 3794 #: kdecore/kcalendarsystemethiopian.cpp:246 3795 #, kde-format 3796 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3797 msgid "Q" 3798 msgstr "" 3799 3800 #: kdecore/kcalendarsystemethiopian.cpp:248 3801 #, kde-format 3802 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3803 msgid "E" 3804 msgstr "" 3805 3806 #: kdecore/kcalendarsystemethiopian.cpp:257 3807 #, fuzzy, kde-format 3808 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3809 msgid "Seg" 3810 msgstr "sep" 3811 3812 #: kdecore/kcalendarsystemethiopian.cpp:259 3813 #, fuzzy, kde-format 3814 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3815 msgid "Mak" 3816 msgstr "měr" 3817 3818 #: kdecore/kcalendarsystemethiopian.cpp:261 3819 #, fuzzy, kde-format 3820 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3821 msgid "Rob" 3822 msgstr "Nadawk" 3823 3824 #: kdecore/kcalendarsystemethiopian.cpp:263 3825 #, fuzzy, kde-format 3826 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3827 msgid "Ham" 3828 msgstr "rano" 3829 3830 #: kdecore/kcalendarsystemethiopian.cpp:265 3831 #, fuzzy, kde-format 3832 #| msgid "Arb" 3833 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3834 msgid "Arb" 3835 msgstr "Arb" 3836 3837 #: kdecore/kcalendarsystemethiopian.cpp:267 3838 #, fuzzy, kde-format 3839 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3840 msgid "Qed" 3841 msgstr "Srj" 3842 3843 #: kdecore/kcalendarsystemethiopian.cpp:269 3844 #, fuzzy, kde-format 3845 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3846 msgid "Ehu" 3847 msgstr "Štw" 3848 3849 #: kdecore/kcalendarsystemethiopian.cpp:276 3850 #, fuzzy, kde-format 3851 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3852 msgid "Segno" 3853 msgstr "&Pósćel" 3854 3855 #: kdecore/kcalendarsystemethiopian.cpp:278 3856 #, fuzzy, kde-format 3857 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3858 msgid "Maksegno" 3859 msgstr "&Pósćel" 3860 3861 #: kdecore/kcalendarsystemethiopian.cpp:280 3862 #, fuzzy, kde-format 3863 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3864 msgid "Rob" 3865 msgstr "Nadawk" 3866 3867 #: kdecore/kcalendarsystemethiopian.cpp:282 3868 #, fuzzy, kde-format 3869 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3870 msgid "Hamus" 3871 msgstr "Zastajić" 3872 3873 #: kdecore/kcalendarsystemethiopian.cpp:284 3874 #, fuzzy, kde-format 3875 #| msgid "Arb" 3876 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3877 msgid "Arb" 3878 msgstr "Arb" 3879 3880 #: kdecore/kcalendarsystemethiopian.cpp:286 3881 #, fuzzy, kde-format 3882 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3883 msgid "Qedame" 3884 msgstr "Mjeno" 3885 3886 #: kdecore/kcalendarsystemethiopian.cpp:288 3887 #, fuzzy, kde-format 3888 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3889 msgid "Ehud" 3890 msgstr "Štw" 3891 3892 #: kdecore/kcalendarsystemgregorian.cpp:53 3893 #, kde-format 3894 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3895 msgid "Before Common Era" 3896 msgstr "" 3897 3898 #: kdecore/kcalendarsystemgregorian.cpp:54 3899 #, kde-format 3900 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3901 msgid "BCE" 3902 msgstr "" 3903 3904 #: kdecore/kcalendarsystemgregorian.cpp:56 3905 #, kde-format 3906 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3907 msgid "Before Christ" 3908 msgstr "" 3909 3910 #: kdecore/kcalendarsystemgregorian.cpp:57 3911 #, kde-format 3912 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3913 msgid "BC" 3914 msgstr "" 3915 3916 #: kdecore/kcalendarsystemgregorian.cpp:59 3917 #, kde-format 3918 msgctxt "" 3919 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3920 msgid "%Ey %EC" 3921 msgstr "" 3922 3923 #: kdecore/kcalendarsystemgregorian.cpp:63 3924 #, kde-format 3925 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3926 msgid "Common Era" 3927 msgstr "" 3928 3929 #: kdecore/kcalendarsystemgregorian.cpp:64 3930 #, kde-format 3931 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3932 msgid "CE" 3933 msgstr "" 3934 3935 #: kdecore/kcalendarsystemgregorian.cpp:66 3936 #: kdecore/kcalendarsystemjapanese.cpp:57 3937 #, kde-format 3938 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3939 msgid "Anno Domini" 3940 msgstr "" 3941 3942 #: kdecore/kcalendarsystemgregorian.cpp:67 3943 #: kdecore/kcalendarsystemjapanese.cpp:58 3944 #, kde-format 3945 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3946 msgid "AD" 3947 msgstr "" 3948 3949 #: kdecore/kcalendarsystemgregorian.cpp:69 3950 #: kdecore/kcalendarsystemjapanese.cpp:59 3951 #, kde-format 3952 msgctxt "" 3953 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3954 msgid "%Ey %EC" 3955 msgstr "" 3956 3957 #: kdecore/kcalendarsystemgregorian.cpp:138 3958 #, kde-format 3959 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3960 msgid "J" 3961 msgstr "" 3962 3963 #: kdecore/kcalendarsystemgregorian.cpp:140 3964 #, kde-format 3965 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3966 msgid "F" 3967 msgstr "" 3968 3969 #: kdecore/kcalendarsystemgregorian.cpp:142 3970 #, kde-format 3971 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3972 msgid "M" 3973 msgstr "" 3974 3975 #: kdecore/kcalendarsystemgregorian.cpp:144 3976 #, fuzzy, kde-format 3977 #| msgid "Av" 3978 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3979 msgid "A" 3980 msgstr "Av" 3981 3982 #: kdecore/kcalendarsystemgregorian.cpp:146 3983 #, kde-format 3984 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3985 msgid "M" 3986 msgstr "" 3987 3988 #: kdecore/kcalendarsystemgregorian.cpp:148 3989 #, kde-format 3990 msgctxt "Gregorian month 6 - KLocale::NarrowName" 3991 msgid "J" 3992 msgstr "" 3993 3994 #: kdecore/kcalendarsystemgregorian.cpp:150 3995 #, kde-format 3996 msgctxt "Gregorian month 7 - KLocale::NarrowName" 3997 msgid "J" 3998 msgstr "" 3999 4000 #: kdecore/kcalendarsystemgregorian.cpp:152 4001 #, fuzzy, kde-format 4002 #| msgid "Av" 4003 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4004 msgid "A" 4005 msgstr "Av" 4006 4007 #: kdecore/kcalendarsystemgregorian.cpp:154 4008 #, kde-format 4009 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4010 msgid "S" 4011 msgstr "" 4012 4013 #: kdecore/kcalendarsystemgregorian.cpp:156 4014 #, kde-format 4015 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4016 msgid "O" 4017 msgstr "" 4018 4019 #: kdecore/kcalendarsystemgregorian.cpp:158 4020 #, kde-format 4021 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4022 msgid "N" 4023 msgstr "" 4024 4025 #: kdecore/kcalendarsystemgregorian.cpp:160 4026 #, kde-format 4027 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4028 msgid "D" 4029 msgstr "" 4030 4031 #: kdecore/kcalendarsystemgregorian.cpp:169 4032 #, fuzzy, kde-format 4033 #| msgctxt "of January" 4034 #| msgid "of Jan" 4035 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4036 msgid "of Jan" 4037 msgstr "januara" 4038 4039 #: kdecore/kcalendarsystemgregorian.cpp:171 4040 #, fuzzy, kde-format 4041 #| msgctxt "of February" 4042 #| msgid "of Feb" 4043 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4044 msgid "of Feb" 4045 msgstr "februara" 4046 4047 #: kdecore/kcalendarsystemgregorian.cpp:173 4048 #, fuzzy, kde-format 4049 #| msgctxt "of March" 4050 #| msgid "of Mar" 4051 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4052 msgid "of Mar" 4053 msgstr "měrca" 4054 4055 #: kdecore/kcalendarsystemgregorian.cpp:175 4056 #, fuzzy, kde-format 4057 #| msgctxt "of April" 4058 #| msgid "of Apr" 4059 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4060 msgid "of Apr" 4061 msgstr "apryla" 4062 4063 #: kdecore/kcalendarsystemgregorian.cpp:177 4064 #, fuzzy, kde-format 4065 #| msgctxt "of May short" 4066 #| msgid "of May" 4067 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4068 msgid "of May" 4069 msgstr "meje" 4070 4071 #: kdecore/kcalendarsystemgregorian.cpp:179 4072 #, fuzzy, kde-format 4073 #| msgctxt "of June" 4074 #| msgid "of Jun" 4075 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4076 msgid "of Jun" 4077 msgstr "junija" 4078 4079 #: kdecore/kcalendarsystemgregorian.cpp:181 4080 #, fuzzy, kde-format 4081 #| msgctxt "of July" 4082 #| msgid "of Jul" 4083 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4084 msgid "of Jul" 4085 msgstr "julija" 4086 4087 #: kdecore/kcalendarsystemgregorian.cpp:183 4088 #, fuzzy, kde-format 4089 #| msgctxt "of August" 4090 #| msgid "of Aug" 4091 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4092 msgid "of Aug" 4093 msgstr "awgusta" 4094 4095 #: kdecore/kcalendarsystemgregorian.cpp:185 4096 #, fuzzy, kde-format 4097 #| msgctxt "of September" 4098 #| msgid "of Sep" 4099 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4100 msgid "of Sep" 4101 msgstr "septembra" 4102 4103 #: kdecore/kcalendarsystemgregorian.cpp:187 4104 #, fuzzy, kde-format 4105 #| msgctxt "of October" 4106 #| msgid "of Oct" 4107 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4108 msgid "of Oct" 4109 msgstr "oktobra" 4110 4111 #: kdecore/kcalendarsystemgregorian.cpp:189 4112 #, fuzzy, kde-format 4113 #| msgctxt "of November" 4114 #| msgid "of Nov" 4115 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4116 msgid "of Nov" 4117 msgstr "nowembra" 4118 4119 #: kdecore/kcalendarsystemgregorian.cpp:191 4120 #, fuzzy, kde-format 4121 #| msgctxt "of December" 4122 #| msgid "of Dec" 4123 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4124 msgid "of Dec" 4125 msgstr "decembra" 4126 4127 #: kdecore/kcalendarsystemgregorian.cpp:200 4128 #, fuzzy, kde-format 4129 #| msgctxt "January" 4130 #| msgid "Jan" 4131 msgctxt "Gregorian month 1 - KLocale::ShortName" 4132 msgid "Jan" 4133 msgstr "jan" 4134 4135 #: kdecore/kcalendarsystemgregorian.cpp:202 4136 #, fuzzy, kde-format 4137 #| msgctxt "February" 4138 #| msgid "Feb" 4139 msgctxt "Gregorian month 2 - KLocale::ShortName" 4140 msgid "Feb" 4141 msgstr "feb" 4142 4143 #: kdecore/kcalendarsystemgregorian.cpp:204 4144 #, fuzzy, kde-format 4145 #| msgctxt "March" 4146 #| msgid "Mar" 4147 msgctxt "Gregorian month 3 - KLocale::ShortName" 4148 msgid "Mar" 4149 msgstr "měr" 4150 4151 #: kdecore/kcalendarsystemgregorian.cpp:206 4152 #, fuzzy, kde-format 4153 #| msgctxt "April" 4154 #| msgid "Apr" 4155 msgctxt "Gregorian month 4 - KLocale::ShortName" 4156 msgid "Apr" 4157 msgstr "apr" 4158 4159 #: kdecore/kcalendarsystemgregorian.cpp:208 4160 #, fuzzy, kde-format 4161 #| msgctxt "May short" 4162 #| msgid "May" 4163 msgctxt "Gregorian month 5 - KLocale::ShortName" 4164 msgid "May" 4165 msgstr "mej" 4166 4167 #: kdecore/kcalendarsystemgregorian.cpp:210 4168 #, fuzzy, kde-format 4169 #| msgctxt "June" 4170 #| msgid "Jun" 4171 msgctxt "Gregorian month 6 - KLocale::ShortName" 4172 msgid "Jun" 4173 msgstr "jun" 4174 4175 #: kdecore/kcalendarsystemgregorian.cpp:212 4176 #, fuzzy, kde-format 4177 #| msgctxt "July" 4178 #| msgid "Jul" 4179 msgctxt "Gregorian month 7 - KLocale::ShortName" 4180 msgid "Jul" 4181 msgstr "jul" 4182 4183 #: kdecore/kcalendarsystemgregorian.cpp:214 4184 #, fuzzy, kde-format 4185 #| msgctxt "August" 4186 #| msgid "Aug" 4187 msgctxt "Gregorian month 8 - KLocale::ShortName" 4188 msgid "Aug" 4189 msgstr "awg" 4190 4191 #: kdecore/kcalendarsystemgregorian.cpp:216 4192 #, fuzzy, kde-format 4193 #| msgctxt "September" 4194 #| msgid "Sep" 4195 msgctxt "Gregorian month 9 - KLocale::ShortName" 4196 msgid "Sep" 4197 msgstr "sep" 4198 4199 #: kdecore/kcalendarsystemgregorian.cpp:218 4200 #, fuzzy, kde-format 4201 #| msgctxt "October" 4202 #| msgid "Oct" 4203 msgctxt "Gregorian month 10 - KLocale::ShortName" 4204 msgid "Oct" 4205 msgstr "okt" 4206 4207 #: kdecore/kcalendarsystemgregorian.cpp:220 4208 #, fuzzy, kde-format 4209 #| msgctxt "November" 4210 #| msgid "Nov" 4211 msgctxt "Gregorian month 11 - KLocale::ShortName" 4212 msgid "Nov" 4213 msgstr "now" 4214 4215 #: kdecore/kcalendarsystemgregorian.cpp:222 4216 #, fuzzy, kde-format 4217 #| msgctxt "December" 4218 #| msgid "Dec" 4219 msgctxt "Gregorian month 12 - KLocale::ShortName" 4220 msgid "Dec" 4221 msgstr "dec" 4222 4223 #: kdecore/kcalendarsystemgregorian.cpp:231 4224 #, fuzzy, kde-format 4225 #| msgid "of January" 4226 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4227 msgid "of January" 4228 msgstr "januara" 4229 4230 #: kdecore/kcalendarsystemgregorian.cpp:233 4231 #, fuzzy, kde-format 4232 #| msgid "of February" 4233 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4234 msgid "of February" 4235 msgstr "februara" 4236 4237 #: kdecore/kcalendarsystemgregorian.cpp:235 4238 #, fuzzy, kde-format 4239 #| msgid "of March" 4240 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4241 msgid "of March" 4242 msgstr "měrca" 4243 4244 #: kdecore/kcalendarsystemgregorian.cpp:237 4245 #, fuzzy, kde-format 4246 #| msgid "of April" 4247 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4248 msgid "of April" 4249 msgstr "apryla" 4250 4251 #: kdecore/kcalendarsystemgregorian.cpp:239 4252 #, fuzzy, kde-format 4253 #| msgctxt "of May short" 4254 #| msgid "of May" 4255 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4256 msgid "of May" 4257 msgstr "meje" 4258 4259 #: kdecore/kcalendarsystemgregorian.cpp:241 4260 #, fuzzy, kde-format 4261 #| msgid "of June" 4262 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4263 msgid "of June" 4264 msgstr "junija" 4265 4266 #: kdecore/kcalendarsystemgregorian.cpp:243 4267 #, fuzzy, kde-format 4268 #| msgid "of July" 4269 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4270 msgid "of July" 4271 msgstr "julija" 4272 4273 #: kdecore/kcalendarsystemgregorian.cpp:245 4274 #, fuzzy, kde-format 4275 #| msgid "of August" 4276 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4277 msgid "of August" 4278 msgstr "awgusta" 4279 4280 #: kdecore/kcalendarsystemgregorian.cpp:247 4281 #, fuzzy, kde-format 4282 #| msgid "of September" 4283 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4284 msgid "of September" 4285 msgstr "septembra" 4286 4287 #: kdecore/kcalendarsystemgregorian.cpp:249 4288 #, fuzzy, kde-format 4289 #| msgid "of October" 4290 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4291 msgid "of October" 4292 msgstr "oktobra" 4293 4294 #: kdecore/kcalendarsystemgregorian.cpp:251 4295 #, fuzzy, kde-format 4296 #| msgid "of November" 4297 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4298 msgid "of November" 4299 msgstr "nowembra" 4300 4301 #: kdecore/kcalendarsystemgregorian.cpp:253 4302 #, fuzzy, kde-format 4303 #| msgid "of December" 4304 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4305 msgid "of December" 4306 msgstr "decembra" 4307 4308 #: kdecore/kcalendarsystemgregorian.cpp:262 4309 #, fuzzy, kde-format 4310 #| msgid "January" 4311 msgctxt "Gregorian month 1 - KLocale::LongName" 4312 msgid "January" 4313 msgstr "januar" 4314 4315 #: kdecore/kcalendarsystemgregorian.cpp:264 4316 #, fuzzy, kde-format 4317 #| msgid "February" 4318 msgctxt "Gregorian month 2 - KLocale::LongName" 4319 msgid "February" 4320 msgstr "februar" 4321 4322 #: kdecore/kcalendarsystemgregorian.cpp:266 4323 #, fuzzy, kde-format 4324 #| msgctxt "March long" 4325 #| msgid "March" 4326 msgctxt "Gregorian month 3 - KLocale::LongName" 4327 msgid "March" 4328 msgstr "měrc" 4329 4330 #: kdecore/kcalendarsystemgregorian.cpp:268 4331 #, fuzzy, kde-format 4332 #| msgid "April" 4333 msgctxt "Gregorian month 4 - KLocale::LongName" 4334 msgid "April" 4335 msgstr "apryl" 4336 4337 #: kdecore/kcalendarsystemgregorian.cpp:270 4338 #, fuzzy, kde-format 4339 #| msgctxt "May short" 4340 #| msgid "May" 4341 msgctxt "Gregorian month 5 - KLocale::LongName" 4342 msgid "May" 4343 msgstr "mej" 4344 4345 #: kdecore/kcalendarsystemgregorian.cpp:272 4346 #, fuzzy, kde-format 4347 #| msgid "June" 4348 msgctxt "Gregorian month 6 - KLocale::LongName" 4349 msgid "June" 4350 msgstr "junij" 4351 4352 #: kdecore/kcalendarsystemgregorian.cpp:274 4353 #, fuzzy, kde-format 4354 #| msgid "July" 4355 msgctxt "Gregorian month 7 - KLocale::LongName" 4356 msgid "July" 4357 msgstr "julij" 4358 4359 #: kdecore/kcalendarsystemgregorian.cpp:276 4360 #, fuzzy, kde-format 4361 #| msgctxt "August long" 4362 #| msgid "August" 4363 msgctxt "Gregorian month 8 - KLocale::LongName" 4364 msgid "August" 4365 msgstr "awgust" 4366 4367 #: kdecore/kcalendarsystemgregorian.cpp:278 4368 #, fuzzy, kde-format 4369 #| msgid "September" 4370 msgctxt "Gregorian month 9 - KLocale::LongName" 4371 msgid "September" 4372 msgstr "september" 4373 4374 #: kdecore/kcalendarsystemgregorian.cpp:280 4375 #, fuzzy, kde-format 4376 #| msgid "October" 4377 msgctxt "Gregorian month 10 - KLocale::LongName" 4378 msgid "October" 4379 msgstr "oktober" 4380 4381 #: kdecore/kcalendarsystemgregorian.cpp:282 4382 #, fuzzy, kde-format 4383 #| msgid "November" 4384 msgctxt "Gregorian month 11 - KLocale::LongName" 4385 msgid "November" 4386 msgstr "nowember" 4387 4388 #: kdecore/kcalendarsystemgregorian.cpp:284 4389 #, fuzzy, kde-format 4390 #| msgid "December" 4391 msgctxt "Gregorian month 12 - KLocale::LongName" 4392 msgid "December" 4393 msgstr "december" 4394 4395 #: kdecore/kcalendarsystemgregorian.cpp:297 4396 #: kdecore/kcalendarsystemhebrew.cpp:807 4397 #, kde-format 4398 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4399 msgid "M" 4400 msgstr "" 4401 4402 #: kdecore/kcalendarsystemgregorian.cpp:299 4403 #: kdecore/kcalendarsystemhebrew.cpp:809 4404 #, kde-format 4405 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4406 msgid "T" 4407 msgstr "" 4408 4409 #: kdecore/kcalendarsystemgregorian.cpp:301 4410 #: kdecore/kcalendarsystemhebrew.cpp:811 4411 #, kde-format 4412 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4413 msgid "W" 4414 msgstr "" 4415 4416 #: kdecore/kcalendarsystemgregorian.cpp:303 4417 #: kdecore/kcalendarsystemhebrew.cpp:813 4418 #, kde-format 4419 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4420 msgid "T" 4421 msgstr "" 4422 4423 #: kdecore/kcalendarsystemgregorian.cpp:305 4424 #: kdecore/kcalendarsystemhebrew.cpp:815 4425 #, kde-format 4426 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4427 msgid "F" 4428 msgstr "" 4429 4430 #: kdecore/kcalendarsystemgregorian.cpp:307 4431 #: kdecore/kcalendarsystemhebrew.cpp:817 4432 #, kde-format 4433 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4434 msgid "S" 4435 msgstr "" 4436 4437 #: kdecore/kcalendarsystemgregorian.cpp:309 4438 #: kdecore/kcalendarsystemhebrew.cpp:819 4439 #, kde-format 4440 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4441 msgid "S" 4442 msgstr "" 4443 4444 #: kdecore/kcalendarsystemgregorian.cpp:318 4445 #: kdecore/kcalendarsystemhebrew.cpp:828 4446 #, fuzzy, kde-format 4447 #| msgctxt "Monday" 4448 #| msgid "Mon" 4449 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4450 msgid "Mon" 4451 msgstr "Pó" 4452 4453 #: kdecore/kcalendarsystemgregorian.cpp:320 4454 #: kdecore/kcalendarsystemhebrew.cpp:830 4455 #, fuzzy, kde-format 4456 #| msgctxt "Tuesday" 4457 #| msgid "Tue" 4458 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4459 msgid "Tue" 4460 msgstr "Wu" 4461 4462 #: kdecore/kcalendarsystemgregorian.cpp:322 4463 #: kdecore/kcalendarsystemhebrew.cpp:832 4464 #, fuzzy, kde-format 4465 #| msgctxt "Wednesday" 4466 #| msgid "Wed" 4467 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4468 msgid "Wed" 4469 msgstr "Srj" 4470 4471 #: kdecore/kcalendarsystemgregorian.cpp:324 4472 #: kdecore/kcalendarsystemhebrew.cpp:834 4473 #, fuzzy, kde-format 4474 #| msgctxt "Thursday" 4475 #| msgid "Thu" 4476 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4477 msgid "Thu" 4478 msgstr "Štw" 4479 4480 #: kdecore/kcalendarsystemgregorian.cpp:326 4481 #: kdecore/kcalendarsystemhebrew.cpp:836 4482 #, fuzzy, kde-format 4483 #| msgctxt "Friday" 4484 #| msgid "Fri" 4485 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4486 msgid "Fri" 4487 msgstr "Pj" 4488 4489 #: kdecore/kcalendarsystemgregorian.cpp:328 4490 #: kdecore/kcalendarsystemhebrew.cpp:838 4491 #, fuzzy, kde-format 4492 #| msgctxt "Saturday" 4493 #| msgid "Sat" 4494 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4495 msgid "Sat" 4496 msgstr "So" 4497 4498 #: kdecore/kcalendarsystemgregorian.cpp:330 4499 #: kdecore/kcalendarsystemhebrew.cpp:840 4500 #, fuzzy, kde-format 4501 #| msgctxt "Sunday" 4502 #| msgid "Sun" 4503 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4504 msgid "Sun" 4505 msgstr "Nje" 4506 4507 #: kdecore/kcalendarsystemgregorian.cpp:337 4508 #: kdecore/kcalendarsystemhebrew.cpp:847 4509 #, fuzzy, kde-format 4510 #| msgid "Monday" 4511 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4512 msgid "Monday" 4513 msgstr "Póndźela" 4514 4515 #: kdecore/kcalendarsystemgregorian.cpp:339 4516 #: kdecore/kcalendarsystemhebrew.cpp:849 4517 #, fuzzy, kde-format 4518 #| msgid "Tuesday" 4519 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4520 msgid "Tuesday" 4521 msgstr "Wutora" 4522 4523 #: kdecore/kcalendarsystemgregorian.cpp:341 4524 #: kdecore/kcalendarsystemhebrew.cpp:851 4525 #, fuzzy, kde-format 4526 #| msgid "Wednesday" 4527 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4528 msgid "Wednesday" 4529 msgstr "Srjeda" 4530 4531 #: kdecore/kcalendarsystemgregorian.cpp:343 4532 #: kdecore/kcalendarsystemhebrew.cpp:853 4533 #, fuzzy, kde-format 4534 #| msgid "Thursday" 4535 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4536 msgid "Thursday" 4537 msgstr "Štwórtk" 4538 4539 #: kdecore/kcalendarsystemgregorian.cpp:345 4540 #: kdecore/kcalendarsystemhebrew.cpp:855 4541 #, fuzzy, kde-format 4542 #| msgid "Friday" 4543 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4544 msgid "Friday" 4545 msgstr "Pjatk" 4546 4547 #: kdecore/kcalendarsystemgregorian.cpp:347 4548 #: kdecore/kcalendarsystemhebrew.cpp:857 4549 #, fuzzy, kde-format 4550 #| msgid "Saturday" 4551 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4552 msgid "Saturday" 4553 msgstr "Sobota" 4554 4555 #: kdecore/kcalendarsystemgregorian.cpp:349 4556 #: kdecore/kcalendarsystemhebrew.cpp:859 4557 #, fuzzy, kde-format 4558 #| msgid "Sunday" 4559 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4560 msgid "Sunday" 4561 msgstr "Njedźela" 4562 4563 #: kdecore/kcalendarsystemhebrew.cpp:281 4564 #, kde-format 4565 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4566 msgid "Anno Mundi" 4567 msgstr "" 4568 4569 #: kdecore/kcalendarsystemhebrew.cpp:282 4570 #, kde-format 4571 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4572 msgid "AM" 4573 msgstr "" 4574 4575 #: kdecore/kcalendarsystemhebrew.cpp:283 4576 #, kde-format 4577 msgctxt "" 4578 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4579 msgid "%Ey %EC" 4580 msgstr "" 4581 4582 #: kdecore/kcalendarsystemhebrew.cpp:625 4583 #, kde-format 4584 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4585 msgid "T" 4586 msgstr "" 4587 4588 #: kdecore/kcalendarsystemhebrew.cpp:627 4589 #, kde-format 4590 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4591 msgid "H" 4592 msgstr "" 4593 4594 #: kdecore/kcalendarsystemhebrew.cpp:629 4595 #, kde-format 4596 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4597 msgid "K" 4598 msgstr "" 4599 4600 #: kdecore/kcalendarsystemhebrew.cpp:631 4601 #, kde-format 4602 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4603 msgid "T" 4604 msgstr "" 4605 4606 #: kdecore/kcalendarsystemhebrew.cpp:633 4607 #, kde-format 4608 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4609 msgid "S" 4610 msgstr "" 4611 4612 #: kdecore/kcalendarsystemhebrew.cpp:635 4613 #, fuzzy, kde-format 4614 #| msgid "Av" 4615 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4616 msgid "A" 4617 msgstr "Av" 4618 4619 #: kdecore/kcalendarsystemhebrew.cpp:637 4620 #, kde-format 4621 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4622 msgid "N" 4623 msgstr "" 4624 4625 #: kdecore/kcalendarsystemhebrew.cpp:639 4626 #, kde-format 4627 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4628 msgid "I" 4629 msgstr "" 4630 4631 #: kdecore/kcalendarsystemhebrew.cpp:641 4632 #, kde-format 4633 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4634 msgid "S" 4635 msgstr "" 4636 4637 #: kdecore/kcalendarsystemhebrew.cpp:643 4638 #, kde-format 4639 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4640 msgid "T" 4641 msgstr "" 4642 4643 #: kdecore/kcalendarsystemhebrew.cpp:645 4644 #, fuzzy, kde-format 4645 #| msgid "Av" 4646 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4647 msgid "A" 4648 msgstr "Av" 4649 4650 #: kdecore/kcalendarsystemhebrew.cpp:647 4651 #, kde-format 4652 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4653 msgid "E" 4654 msgstr "" 4655 4656 #: kdecore/kcalendarsystemhebrew.cpp:649 4657 #, fuzzy, kde-format 4658 #| msgid "Av" 4659 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4660 msgid "A" 4661 msgstr "Av" 4662 4663 #: kdecore/kcalendarsystemhebrew.cpp:651 4664 #, fuzzy, kde-format 4665 #| msgid "Av" 4666 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4667 msgid "A" 4668 msgstr "Av" 4669 4670 #: kdecore/kcalendarsystemhebrew.cpp:660 4671 #, fuzzy, kde-format 4672 #| msgctxt "of Tir short" 4673 #| msgid "of Tir" 4674 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4675 msgid "of Tis" 4676 msgstr "wot Tira" 4677 4678 #: kdecore/kcalendarsystemhebrew.cpp:662 4679 #, fuzzy, kde-format 4680 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4681 msgid "of Hes" 4682 msgstr "wot Meh" 4683 4684 #: kdecore/kcalendarsystemhebrew.cpp:664 4685 #, fuzzy, kde-format 4686 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4687 msgid "of Kis" 4688 msgstr "Nisan" 4689 4690 #: kdecore/kcalendarsystemhebrew.cpp:666 4691 #, fuzzy, kde-format 4692 #| msgid "of Tevet" 4693 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4694 msgid "of Tev" 4695 msgstr "Tevet" 4696 4697 #: kdecore/kcalendarsystemhebrew.cpp:668 4698 #, fuzzy, kde-format 4699 #| msgid "of Shvat" 4700 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4701 msgid "of Shv" 4702 msgstr "Shvat" 4703 4704 #: kdecore/kcalendarsystemhebrew.cpp:670 4705 #, fuzzy, kde-format 4706 #| msgid "of Adar" 4707 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4708 msgid "of Ada" 4709 msgstr "Adar" 4710 4711 #: kdecore/kcalendarsystemhebrew.cpp:672 4712 #, fuzzy, kde-format 4713 #| msgid "of Nisan" 4714 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4715 msgid "of Nis" 4716 msgstr "Nisan" 4717 4718 #: kdecore/kcalendarsystemhebrew.cpp:674 4719 #, fuzzy, kde-format 4720 #| msgid "of Iyar" 4721 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4722 msgid "of Iya" 4723 msgstr "Iyar" 4724 4725 #: kdecore/kcalendarsystemhebrew.cpp:676 4726 #, fuzzy, kde-format 4727 #| msgid "of Sivan" 4728 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4729 msgid "of Siv" 4730 msgstr "Sivan" 4731 4732 #: kdecore/kcalendarsystemhebrew.cpp:678 4733 #, fuzzy, kde-format 4734 #| msgid "of Tamuz" 4735 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4736 msgid "of Tam" 4737 msgstr "Tamuz" 4738 4739 #: kdecore/kcalendarsystemhebrew.cpp:680 4740 #, fuzzy, kde-format 4741 #| msgid "of Av" 4742 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4743 msgid "of Av" 4744 msgstr "Av" 4745 4746 #: kdecore/kcalendarsystemhebrew.cpp:682 4747 #, fuzzy, kde-format 4748 #| msgid "of Elul" 4749 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4750 msgid "of Elu" 4751 msgstr "Elul" 4752 4753 #: kdecore/kcalendarsystemhebrew.cpp:684 4754 #, fuzzy, kde-format 4755 #| msgid "of Adar" 4756 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4757 msgid "of Ad1" 4758 msgstr "Adar" 4759 4760 #: kdecore/kcalendarsystemhebrew.cpp:686 4761 #, fuzzy, kde-format 4762 #| msgid "of Adar" 4763 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4764 msgid "of Ad2" 4765 msgstr "Adar" 4766 4767 #: kdecore/kcalendarsystemhebrew.cpp:695 4768 #, fuzzy, kde-format 4769 #| msgctxt "Tir short" 4770 #| msgid "Tir" 4771 msgctxt "Hebrew month 1 - KLocale::ShortName" 4772 msgid "Tis" 4773 msgstr "Tir" 4774 4775 #: kdecore/kcalendarsystemhebrew.cpp:697 4776 #, fuzzy, kde-format 4777 msgctxt "Hebrew month 2 - KLocale::ShortName" 4778 msgid "Hes" 4779 msgstr "Haj" 4780 4781 #: kdecore/kcalendarsystemhebrew.cpp:699 4782 #, fuzzy, kde-format 4783 #| msgid "Kislev" 4784 msgctxt "Hebrew month 3 - KLocale::ShortName" 4785 msgid "Kis" 4786 msgstr "Kislev" 4787 4788 #: kdecore/kcalendarsystemhebrew.cpp:701 4789 #, fuzzy, kde-format 4790 #| msgid "Tevet" 4791 msgctxt "Hebrew month 4 - KLocale::ShortName" 4792 msgid "Tev" 4793 msgstr "Tevet" 4794 4795 #: kdecore/kcalendarsystemhebrew.cpp:703 4796 #, fuzzy, kde-format 4797 #| msgid "Shvat" 4798 msgctxt "Hebrew month 5 - KLocale::ShortName" 4799 msgid "Shv" 4800 msgstr "Shvat" 4801 4802 #: kdecore/kcalendarsystemhebrew.cpp:705 4803 #, fuzzy, kde-format 4804 #| msgid "Adar" 4805 msgctxt "Hebrew month 6 - KLocale::ShortName" 4806 msgid "Ada" 4807 msgstr "Adar" 4808 4809 #: kdecore/kcalendarsystemhebrew.cpp:707 4810 #, fuzzy, kde-format 4811 #| msgid "Nisan" 4812 msgctxt "Hebrew month 7 - KLocale::ShortName" 4813 msgid "Nis" 4814 msgstr "Nisan" 4815 4816 #: kdecore/kcalendarsystemhebrew.cpp:709 4817 #, fuzzy, kde-format 4818 #| msgid "Iyar" 4819 msgctxt "Hebrew month 8 - KLocale::ShortName" 4820 msgid "Iya" 4821 msgstr "Iyar" 4822 4823 #: kdecore/kcalendarsystemhebrew.cpp:711 4824 #, fuzzy, kde-format 4825 #| msgid "Sivan" 4826 msgctxt "Hebrew month 9 - KLocale::ShortName" 4827 msgid "Siv" 4828 msgstr "Sivan" 4829 4830 #: kdecore/kcalendarsystemhebrew.cpp:713 4831 #, fuzzy, kde-format 4832 #| msgid "Tamuz" 4833 msgctxt "Hebrew month 10 - KLocale::ShortName" 4834 msgid "Tam" 4835 msgstr "Tamuz" 4836 4837 #: kdecore/kcalendarsystemhebrew.cpp:715 4838 #, fuzzy, kde-format 4839 #| msgid "Av" 4840 msgctxt "Hebrew month 11 - KLocale::ShortName" 4841 msgid "Av" 4842 msgstr "Av" 4843 4844 #: kdecore/kcalendarsystemhebrew.cpp:717 4845 #, fuzzy, kde-format 4846 #| msgid "Elul" 4847 msgctxt "Hebrew month 12 - KLocale::ShortName" 4848 msgid "Elu" 4849 msgstr "Elul" 4850 4851 #: kdecore/kcalendarsystemhebrew.cpp:719 4852 #, fuzzy, kde-format 4853 #| msgid "Ahd" 4854 msgctxt "Hebrew month 13 - KLocale::ShortName" 4855 msgid "Ad1" 4856 msgstr "Ahd" 4857 4858 #: kdecore/kcalendarsystemhebrew.cpp:721 4859 #, fuzzy, kde-format 4860 #| msgid "Ahd" 4861 msgctxt "Hebrew month 14 - KLocale::ShortName" 4862 msgid "Ad2" 4863 msgstr "Ahd" 4864 4865 #: kdecore/kcalendarsystemhebrew.cpp:730 4866 #, fuzzy, kde-format 4867 #| msgid "of Tishrey" 4868 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4869 msgid "of Tishrey" 4870 msgstr "Tishrey" 4871 4872 #: kdecore/kcalendarsystemhebrew.cpp:732 4873 #, fuzzy, kde-format 4874 #| msgid "of Heshvan" 4875 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4876 msgid "of Heshvan" 4877 msgstr "Heshvan" 4878 4879 #: kdecore/kcalendarsystemhebrew.cpp:734 4880 #, fuzzy, kde-format 4881 #| msgid "of Kislev" 4882 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4883 msgid "of Kislev" 4884 msgstr "Kislev" 4885 4886 #: kdecore/kcalendarsystemhebrew.cpp:736 4887 #, fuzzy, kde-format 4888 #| msgid "of Tevet" 4889 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4890 msgid "of Tevet" 4891 msgstr "Tevet" 4892 4893 #: kdecore/kcalendarsystemhebrew.cpp:738 4894 #, fuzzy, kde-format 4895 #| msgid "of Shvat" 4896 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4897 msgid "of Shvat" 4898 msgstr "Shvat" 4899 4900 #: kdecore/kcalendarsystemhebrew.cpp:740 4901 #, fuzzy, kde-format 4902 #| msgid "of Adar" 4903 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4904 msgid "of Adar" 4905 msgstr "Adar" 4906 4907 #: kdecore/kcalendarsystemhebrew.cpp:742 4908 #, fuzzy, kde-format 4909 #| msgid "of Nisan" 4910 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4911 msgid "of Nisan" 4912 msgstr "Nisan" 4913 4914 #: kdecore/kcalendarsystemhebrew.cpp:744 4915 #, fuzzy, kde-format 4916 #| msgid "of Iyar" 4917 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4918 msgid "of Iyar" 4919 msgstr "Iyar" 4920 4921 #: kdecore/kcalendarsystemhebrew.cpp:746 4922 #, fuzzy, kde-format 4923 #| msgid "of Sivan" 4924 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4925 msgid "of Sivan" 4926 msgstr "Sivan" 4927 4928 #: kdecore/kcalendarsystemhebrew.cpp:748 4929 #, fuzzy, kde-format 4930 #| msgid "of Tamuz" 4931 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4932 msgid "of Tamuz" 4933 msgstr "Tamuz" 4934 4935 #: kdecore/kcalendarsystemhebrew.cpp:750 4936 #, fuzzy, kde-format 4937 #| msgid "of Av" 4938 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4939 msgid "of Av" 4940 msgstr "Av" 4941 4942 #: kdecore/kcalendarsystemhebrew.cpp:752 4943 #, fuzzy, kde-format 4944 #| msgid "of Elul" 4945 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4946 msgid "of Elul" 4947 msgstr "Elul" 4948 4949 #: kdecore/kcalendarsystemhebrew.cpp:754 4950 #, fuzzy, kde-format 4951 #| msgid "of Adar I" 4952 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4953 msgid "of Adar I" 4954 msgstr "Adar I" 4955 4956 #: kdecore/kcalendarsystemhebrew.cpp:756 4957 #, fuzzy, kde-format 4958 #| msgid "of Adar II" 4959 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4960 msgid "of Adar II" 4961 msgstr "Adar II" 4962 4963 #: kdecore/kcalendarsystemhebrew.cpp:765 4964 #, fuzzy, kde-format 4965 #| msgid "Tishrey" 4966 msgctxt "Hebrew month 1 - KLocale::LongName" 4967 msgid "Tishrey" 4968 msgstr "Tishrey" 4969 4970 #: kdecore/kcalendarsystemhebrew.cpp:767 4971 #, fuzzy, kde-format 4972 #| msgid "Heshvan" 4973 msgctxt "Hebrew month 2 - KLocale::LongName" 4974 msgid "Heshvan" 4975 msgstr "Heshvan" 4976 4977 #: kdecore/kcalendarsystemhebrew.cpp:769 4978 #, fuzzy, kde-format 4979 #| msgid "Kislev" 4980 msgctxt "Hebrew month 3 - KLocale::LongName" 4981 msgid "Kislev" 4982 msgstr "Kislev" 4983 4984 #: kdecore/kcalendarsystemhebrew.cpp:771 4985 #, fuzzy, kde-format 4986 #| msgid "Tevet" 4987 msgctxt "Hebrew month 4 - KLocale::LongName" 4988 msgid "Tevet" 4989 msgstr "Tevet" 4990 4991 #: kdecore/kcalendarsystemhebrew.cpp:773 4992 #, fuzzy, kde-format 4993 #| msgid "Shvat" 4994 msgctxt "Hebrew month 5 - KLocale::LongName" 4995 msgid "Shvat" 4996 msgstr "Shvat" 4997 4998 #: kdecore/kcalendarsystemhebrew.cpp:775 4999 #, fuzzy, kde-format 5000 #| msgid "Adar" 5001 msgctxt "Hebrew month 6 - KLocale::LongName" 5002 msgid "Adar" 5003 msgstr "Adar" 5004 5005 #: kdecore/kcalendarsystemhebrew.cpp:777 5006 #, fuzzy, kde-format 5007 #| msgid "Nisan" 5008 msgctxt "Hebrew month 7 - KLocale::LongName" 5009 msgid "Nisan" 5010 msgstr "Nisan" 5011 5012 #: kdecore/kcalendarsystemhebrew.cpp:779 5013 #, fuzzy, kde-format 5014 #| msgid "Iyar" 5015 msgctxt "Hebrew month 8 - KLocale::LongName" 5016 msgid "Iyar" 5017 msgstr "Iyar" 5018 5019 #: kdecore/kcalendarsystemhebrew.cpp:781 5020 #, fuzzy, kde-format 5021 #| msgid "Sivan" 5022 msgctxt "Hebrew month 9 - KLocale::LongName" 5023 msgid "Sivan" 5024 msgstr "Sivan" 5025 5026 #: kdecore/kcalendarsystemhebrew.cpp:783 5027 #, fuzzy, kde-format 5028 #| msgid "Tamuz" 5029 msgctxt "Hebrew month 10 - KLocale::LongName" 5030 msgid "Tamuz" 5031 msgstr "Tamuz" 5032 5033 #: kdecore/kcalendarsystemhebrew.cpp:785 5034 #, fuzzy, kde-format 5035 #| msgid "Av" 5036 msgctxt "Hebrew month 11 - KLocale::LongName" 5037 msgid "Av" 5038 msgstr "Av" 5039 5040 #: kdecore/kcalendarsystemhebrew.cpp:787 5041 #, fuzzy, kde-format 5042 #| msgid "Elul" 5043 msgctxt "Hebrew month 12 - KLocale::LongName" 5044 msgid "Elul" 5045 msgstr "Elul" 5046 5047 #: kdecore/kcalendarsystemhebrew.cpp:789 5048 #, fuzzy, kde-format 5049 #| msgid "Adar I" 5050 msgctxt "Hebrew month 13 - KLocale::LongName" 5051 msgid "Adar I" 5052 msgstr "Adar I" 5053 5054 #: kdecore/kcalendarsystemhebrew.cpp:791 5055 #, fuzzy, kde-format 5056 #| msgid "Adar II" 5057 msgctxt "Hebrew month 14 - KLocale::LongName" 5058 msgid "Adar II" 5059 msgstr "Adar II" 5060 5061 #: kdecore/kcalendarsystemindiannational.cpp:66 5062 #, fuzzy, kde-format 5063 #| msgid "Safar" 5064 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5065 msgid "Saka Era" 5066 msgstr "Safar" 5067 5068 #: kdecore/kcalendarsystemindiannational.cpp:67 5069 #, kde-format 5070 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5071 msgid "SE" 5072 msgstr "" 5073 5074 #: kdecore/kcalendarsystemindiannational.cpp:68 5075 #, kde-format 5076 msgctxt "" 5077 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5078 "2000 SE" 5079 msgid "%Ey %EC" 5080 msgstr "" 5081 5082 #: kdecore/kcalendarsystemindiannational.cpp:158 5083 #, kde-format 5084 msgctxt "Indian National month 1 - KLocale::NarrowName" 5085 msgid "C" 5086 msgstr "" 5087 5088 #: kdecore/kcalendarsystemindiannational.cpp:160 5089 #, kde-format 5090 msgctxt "Indian National month 2 - KLocale::NarrowName" 5091 msgid "V" 5092 msgstr "" 5093 5094 #: kdecore/kcalendarsystemindiannational.cpp:162 5095 #, kde-format 5096 msgctxt "Indian National month 3 - KLocale::NarrowName" 5097 msgid "J" 5098 msgstr "" 5099 5100 #: kdecore/kcalendarsystemindiannational.cpp:164 5101 #, fuzzy, kde-format 5102 msgctxt "Indian National month 4 - KLocale::NarrowName" 5103 msgid "Ā" 5104 msgstr "wot Kho" 5105 5106 #: kdecore/kcalendarsystemindiannational.cpp:166 5107 #, kde-format 5108 msgctxt "Indian National month 5 - KLocale::NarrowName" 5109 msgid "S" 5110 msgstr "" 5111 5112 #: kdecore/kcalendarsystemindiannational.cpp:168 5113 #, kde-format 5114 msgctxt "Indian National month 6 - KLocale::NarrowName" 5115 msgid "B" 5116 msgstr "" 5117 5118 #: kdecore/kcalendarsystemindiannational.cpp:170 5119 #, fuzzy, kde-format 5120 msgctxt "Indian National month 7 - KLocale::NarrowName" 5121 msgid "Ā" 5122 msgstr "wot Kho" 5123 5124 #: kdecore/kcalendarsystemindiannational.cpp:172 5125 #, kde-format 5126 msgctxt "Indian National month 8 - KLocale::NarrowName" 5127 msgid "K" 5128 msgstr "" 5129 5130 #: kdecore/kcalendarsystemindiannational.cpp:174 5131 #, fuzzy, kde-format 5132 #| msgid "Av" 5133 msgctxt "Indian National month 9 - KLocale::NarrowName" 5134 msgid "A" 5135 msgstr "Av" 5136 5137 #: kdecore/kcalendarsystemindiannational.cpp:176 5138 #, kde-format 5139 msgctxt "Indian National month 10 - KLocale::NarrowName" 5140 msgid "P" 5141 msgstr "" 5142 5143 #: kdecore/kcalendarsystemindiannational.cpp:178 5144 #, kde-format 5145 msgctxt "Indian National month 11 - KLocale::NarrowName" 5146 msgid "M" 5147 msgstr "" 5148 5149 #: kdecore/kcalendarsystemindiannational.cpp:180 5150 #, kde-format 5151 msgctxt "Indian National month 12 - KLocale::NarrowName" 5152 msgid "P" 5153 msgstr "" 5154 5155 #: kdecore/kcalendarsystemindiannational.cpp:189 5156 #, fuzzy, kde-format 5157 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5158 msgid "of Cha" 5159 msgstr "wot Sha" 5160 5161 #: kdecore/kcalendarsystemindiannational.cpp:191 5162 #, fuzzy, kde-format 5163 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5164 msgid "of Vai" 5165 msgstr "wot Fara" 5166 5167 #: kdecore/kcalendarsystemindiannational.cpp:193 5168 #, fuzzy, kde-format 5169 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5170 msgid "of Jya" 5171 msgstr "januara" 5172 5173 #: kdecore/kcalendarsystemindiannational.cpp:195 5174 #, fuzzy, kde-format 5175 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5176 msgid "of Āsh" 5177 msgstr "wot Kho" 5178 5179 #: kdecore/kcalendarsystemindiannational.cpp:197 5180 #, fuzzy, kde-format 5181 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5182 msgid "of Shr" 5183 msgstr "wot Sha" 5184 5185 #: kdecore/kcalendarsystemindiannational.cpp:199 5186 #, fuzzy, kde-format 5187 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5188 msgid "of Bhā" 5189 msgstr "wot Bah" 5190 5191 #: kdecore/kcalendarsystemindiannational.cpp:201 5192 #, fuzzy, kde-format 5193 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5194 msgid "of Āsw" 5195 msgstr "wot Esf" 5196 5197 #: kdecore/kcalendarsystemindiannational.cpp:203 5198 #, fuzzy, kde-format 5199 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5200 msgid "of Kār" 5201 msgstr "wot Fara" 5202 5203 #: kdecore/kcalendarsystemindiannational.cpp:205 5204 #, fuzzy, kde-format 5205 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5206 msgid "of Agr" 5207 msgstr "apryla" 5208 5209 #: kdecore/kcalendarsystemindiannational.cpp:207 5210 #, fuzzy, kde-format 5211 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5212 msgid "of Pau" 5213 msgstr "Tamuz" 5214 5215 #: kdecore/kcalendarsystemindiannational.cpp:209 5216 #, fuzzy, kde-format 5217 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5218 msgid "of Māg" 5219 msgstr "wot Mora" 5220 5221 #: kdecore/kcalendarsystemindiannational.cpp:211 5222 #, fuzzy, kde-format 5223 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5224 msgid "of Phā" 5225 msgstr "wot Kho" 5226 5227 #: kdecore/kcalendarsystemindiannational.cpp:220 5228 #, fuzzy, kde-format 5229 msgctxt "Indian National month 1 - KLocale::ShortName" 5230 msgid "Cha" 5231 msgstr "Kha" 5232 5233 #: kdecore/kcalendarsystemindiannational.cpp:222 5234 #, fuzzy, kde-format 5235 msgctxt "Indian National month 2 - KLocale::ShortName" 5236 msgid "Vai" 5237 msgstr "wot Fara" 5238 5239 #: kdecore/kcalendarsystemindiannational.cpp:224 5240 #, fuzzy, kde-format 5241 msgctxt "Indian National month 3 - KLocale::ShortName" 5242 msgid "Jya" 5243 msgstr "jan" 5244 5245 #: kdecore/kcalendarsystemindiannational.cpp:226 5246 #, fuzzy, kde-format 5247 msgctxt "Indian National month 4 - KLocale::ShortName" 5248 msgid "Āsh" 5249 msgstr "wot Kho" 5250 5251 #: kdecore/kcalendarsystemindiannational.cpp:228 5252 #, fuzzy, kde-format 5253 msgctxt "Indian National month 5 - KLocale::ShortName" 5254 msgid "Shr" 5255 msgstr "Sha" 5256 5257 #: kdecore/kcalendarsystemindiannational.cpp:230 5258 #, fuzzy, kde-format 5259 msgctxt "Indian National month 6 - KLocale::ShortName" 5260 msgid "Bhā" 5261 msgstr "wot Bah" 5262 5263 #: kdecore/kcalendarsystemindiannational.cpp:232 5264 #, fuzzy, kde-format 5265 msgctxt "Indian National month 7 - KLocale::ShortName" 5266 msgid "Āsw" 5267 msgstr "wot Esf" 5268 5269 #: kdecore/kcalendarsystemindiannational.cpp:234 5270 #, fuzzy, kde-format 5271 msgctxt "Indian National month 8 - KLocale::ShortName" 5272 msgid "Kār" 5273 msgstr "wot Fara" 5274 5275 #: kdecore/kcalendarsystemindiannational.cpp:236 5276 #, fuzzy, kde-format 5277 msgctxt "Indian National month 9 - KLocale::ShortName" 5278 msgid "Agr" 5279 msgstr "Arb" 5280 5281 #: kdecore/kcalendarsystemindiannational.cpp:238 5282 #, fuzzy, kde-format 5283 msgctxt "Indian National month 10 - KLocale::ShortName" 5284 msgid "Pau" 5285 msgstr "Zastajić" 5286 5287 #: kdecore/kcalendarsystemindiannational.cpp:240 5288 #, fuzzy, kde-format 5289 msgctxt "Indian National month 11 - KLocale::ShortName" 5290 msgid "Māg" 5291 msgstr "wot Mora" 5292 5293 #: kdecore/kcalendarsystemindiannational.cpp:242 5294 #, fuzzy, kde-format 5295 msgctxt "Indian National month 12 - KLocale::ShortName" 5296 msgid "Phā" 5297 msgstr "wot Kho" 5298 5299 #: kdecore/kcalendarsystemindiannational.cpp:251 5300 #, fuzzy, kde-format 5301 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5302 msgid "of Chaitra" 5303 msgstr "wot Muharram" 5304 5305 #: kdecore/kcalendarsystemindiannational.cpp:253 5306 #, fuzzy, kde-format 5307 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5308 msgid "of Vaishākh" 5309 msgstr "wot Fara" 5310 5311 #: kdecore/kcalendarsystemindiannational.cpp:255 5312 #, fuzzy, kde-format 5313 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5314 msgid "of Jyaishtha" 5315 msgstr "Nisan" 5316 5317 #: kdecore/kcalendarsystemindiannational.cpp:257 5318 #, fuzzy, kde-format 5319 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5320 msgid "of Āshādha" 5321 msgstr "wot Kho" 5322 5323 #: kdecore/kcalendarsystemindiannational.cpp:259 5324 #, fuzzy, kde-format 5325 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5326 msgid "of Shrāvana" 5327 msgstr "Shvat" 5328 5329 #: kdecore/kcalendarsystemindiannational.cpp:261 5330 #, fuzzy, kde-format 5331 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5332 msgid "of Bhādrapad" 5333 msgstr "wot Khordad" 5334 5335 #: kdecore/kcalendarsystemindiannational.cpp:263 5336 #, fuzzy, kde-format 5337 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5338 msgid "of Āshwin" 5339 msgstr "Heshvan" 5340 5341 #: kdecore/kcalendarsystemindiannational.cpp:265 5342 #, fuzzy, kde-format 5343 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5344 msgid "of Kārtik" 5345 msgstr "wot Fara" 5346 5347 #: kdecore/kcalendarsystemindiannational.cpp:267 5348 #, fuzzy, kde-format 5349 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5350 msgid "of Agrahayana" 5351 msgstr "wot Bahman" 5352 5353 #: kdecore/kcalendarsystemindiannational.cpp:269 5354 #, fuzzy, kde-format 5355 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5356 msgid "of Paush" 5357 msgstr "wot Bah" 5358 5359 #: kdecore/kcalendarsystemindiannational.cpp:271 5360 #, fuzzy, kde-format 5361 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5362 msgid "of Māgh" 5363 msgstr "wot Meh" 5364 5365 #: kdecore/kcalendarsystemindiannational.cpp:273 5366 #, fuzzy, kde-format 5367 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5368 msgid "of Phālgun" 5369 msgstr "wot Kho" 5370 5371 #: kdecore/kcalendarsystemindiannational.cpp:282 5372 #, fuzzy, kde-format 5373 msgctxt "Indian National month 1 - KLocale::LongName" 5374 msgid "Chaitra" 5375 msgstr "wot Muharram" 5376 5377 #: kdecore/kcalendarsystemindiannational.cpp:284 5378 #, fuzzy, kde-format 5379 msgctxt "Indian National month 2 - KLocale::LongName" 5380 msgid "Vaishākh" 5381 msgstr "wot Fara" 5382 5383 #: kdecore/kcalendarsystemindiannational.cpp:286 5384 #, fuzzy, kde-format 5385 msgctxt "Indian National month 3 - KLocale::LongName" 5386 msgid "Jyaishtha" 5387 msgstr "Nisan" 5388 5389 #: kdecore/kcalendarsystemindiannational.cpp:288 5390 #, fuzzy, kde-format 5391 msgctxt "Indian National month 4 - KLocale::LongName" 5392 msgid "Āshādha" 5393 msgstr "wot Kho" 5394 5395 #: kdecore/kcalendarsystemindiannational.cpp:290 5396 #, fuzzy, kde-format 5397 msgctxt "Indian National month 5 - KLocale::LongName" 5398 msgid "Shrāvana" 5399 msgstr "Shvat" 5400 5401 #: kdecore/kcalendarsystemindiannational.cpp:292 5402 #, fuzzy, kde-format 5403 msgctxt "Indian National month 6 - KLocale::LongName" 5404 msgid "Bhādrapad" 5405 msgstr "wot Khordad" 5406 5407 #: kdecore/kcalendarsystemindiannational.cpp:294 5408 #, fuzzy, kde-format 5409 msgctxt "Indian National month 7 - KLocale::LongName" 5410 msgid "Āshwin" 5411 msgstr "Heshvan" 5412 5413 #: kdecore/kcalendarsystemindiannational.cpp:296 5414 #, fuzzy, kde-format 5415 msgctxt "Indian National month 8 - KLocale::LongName" 5416 msgid "Kārtik" 5417 msgstr "wot Fara" 5418 5419 #: kdecore/kcalendarsystemindiannational.cpp:298 5420 #, fuzzy, kde-format 5421 msgctxt "Indian National month 9 - KLocale::LongName" 5422 msgid "Agrahayana" 5423 msgstr "Thaana" 5424 5425 #: kdecore/kcalendarsystemindiannational.cpp:300 5426 #, fuzzy, kde-format 5427 msgctxt "Indian National month 10 - KLocale::LongName" 5428 msgid "Paush" 5429 msgstr "Zastajić" 5430 5431 #: kdecore/kcalendarsystemindiannational.cpp:302 5432 #, fuzzy, kde-format 5433 msgctxt "Indian National month 11 - KLocale::LongName" 5434 msgid "Māgh" 5435 msgstr "wot Meh" 5436 5437 #: kdecore/kcalendarsystemindiannational.cpp:304 5438 #, fuzzy, kde-format 5439 msgctxt "Indian National month 12 - KLocale::LongName" 5440 msgid "Phālgun" 5441 msgstr "wot Kho" 5442 5443 #: kdecore/kcalendarsystemindiannational.cpp:317 5444 #, kde-format 5445 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5446 msgid "S" 5447 msgstr "" 5448 5449 #: kdecore/kcalendarsystemindiannational.cpp:319 5450 #, kde-format 5451 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5452 msgid "M" 5453 msgstr "" 5454 5455 #: kdecore/kcalendarsystemindiannational.cpp:321 5456 #, kde-format 5457 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5458 msgid "B" 5459 msgstr "" 5460 5461 #: kdecore/kcalendarsystemindiannational.cpp:323 5462 #, kde-format 5463 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5464 msgid "G" 5465 msgstr "" 5466 5467 #: kdecore/kcalendarsystemindiannational.cpp:325 5468 #, kde-format 5469 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5470 msgid "S" 5471 msgstr "" 5472 5473 #: kdecore/kcalendarsystemindiannational.cpp:327 5474 #, kde-format 5475 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5476 msgid "S" 5477 msgstr "" 5478 5479 #: kdecore/kcalendarsystemindiannational.cpp:329 5480 #, kde-format 5481 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5482 msgid "R" 5483 msgstr "" 5484 5485 #: kdecore/kcalendarsystemindiannational.cpp:338 5486 #, fuzzy, kde-format 5487 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5488 msgid "Som" 5489 msgstr "Jom" 5490 5491 #: kdecore/kcalendarsystemindiannational.cpp:340 5492 #, kde-format 5493 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5494 msgid "Mañ" 5495 msgstr "" 5496 5497 #: kdecore/kcalendarsystemindiannational.cpp:342 5498 #, fuzzy, kde-format 5499 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5500 msgid "Bud" 5501 msgstr "Buhid" 5502 5503 #: kdecore/kcalendarsystemindiannational.cpp:344 5504 #, kde-format 5505 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5506 msgid "Gur" 5507 msgstr "" 5508 5509 #: kdecore/kcalendarsystemindiannational.cpp:346 5510 #, fuzzy, kde-format 5511 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5512 msgid "Suk" 5513 msgstr "Nje" 5514 5515 #: kdecore/kcalendarsystemindiannational.cpp:348 5516 #, fuzzy, kde-format 5517 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5518 msgid "San" 5519 msgstr "Sivan" 5520 5521 #: kdecore/kcalendarsystemindiannational.cpp:350 5522 #, kde-format 5523 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5524 msgid "Rav" 5525 msgstr "" 5526 5527 #: kdecore/kcalendarsystemindiannational.cpp:357 5528 #, kde-format 5529 msgctxt "Indian National weekday 1 - KLocale::LongName" 5530 msgid "Somavãra" 5531 msgstr "" 5532 5533 #: kdecore/kcalendarsystemindiannational.cpp:359 5534 #, kde-format 5535 msgctxt "Indian National weekday 2 - KLocale::LongName" 5536 msgid "Mañgalvã" 5537 msgstr "" 5538 5539 #: kdecore/kcalendarsystemindiannational.cpp:361 5540 #, kde-format 5541 msgctxt "Indian National weekday 3 - KLocale::LongName" 5542 msgid "Budhavãra" 5543 msgstr "" 5544 5545 #: kdecore/kcalendarsystemindiannational.cpp:363 5546 #, kde-format 5547 msgctxt "Indian National weekday 4 - KLocale::LongName" 5548 msgid "Guruvãra" 5549 msgstr "" 5550 5551 #: kdecore/kcalendarsystemindiannational.cpp:365 5552 #, kde-format 5553 msgctxt "Indian National weekday 5 - KLocale::LongName" 5554 msgid "Sukravãra" 5555 msgstr "" 5556 5557 #: kdecore/kcalendarsystemindiannational.cpp:367 5558 #, kde-format 5559 msgctxt "Indian National weekday 6 - KLocale::LongName" 5560 msgid "Sanivãra" 5561 msgstr "" 5562 5563 #: kdecore/kcalendarsystemindiannational.cpp:369 5564 #, kde-format 5565 msgctxt "Indian National weekday 7 - KLocale::LongName" 5566 msgid "Raviãra" 5567 msgstr "" 5568 5569 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5570 #, kde-format 5571 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5572 msgid "Anno Hegirae" 5573 msgstr "" 5574 5575 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5576 #, kde-format 5577 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5578 msgid "AH" 5579 msgstr "" 5580 5581 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5582 #, kde-format 5583 msgctxt "" 5584 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5585 msgid "%Ey %EC" 5586 msgstr "" 5587 5588 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5589 #, kde-format 5590 msgctxt "Hijri month 1 - KLocale::NarrowName" 5591 msgid "M" 5592 msgstr "" 5593 5594 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5595 #, kde-format 5596 msgctxt "Hijri month 2 - KLocale::NarrowName" 5597 msgid "S" 5598 msgstr "" 5599 5600 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5601 #, fuzzy, kde-format 5602 #| msgid "Av" 5603 msgctxt "Hijri month 3 - KLocale::NarrowName" 5604 msgid "A" 5605 msgstr "Av" 5606 5607 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5608 #, kde-format 5609 msgctxt "Hijri month 4 - KLocale::NarrowName" 5610 msgid "T" 5611 msgstr "" 5612 5613 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5614 #, fuzzy, kde-format 5615 #| msgid "Av" 5616 msgctxt "Hijri month 5 - KLocale::NarrowName" 5617 msgid "A" 5618 msgstr "Av" 5619 5620 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5621 #, kde-format 5622 msgctxt "Hijri month 6 - KLocale::NarrowName" 5623 msgid "T" 5624 msgstr "" 5625 5626 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5627 #, kde-format 5628 msgctxt "Hijri month 7 - KLocale::NarrowName" 5629 msgid "R" 5630 msgstr "" 5631 5632 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5633 #, kde-format 5634 msgctxt "Hijri month 8 - KLocale::NarrowName" 5635 msgid "S" 5636 msgstr "" 5637 5638 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5639 #, kde-format 5640 msgctxt "Hijri month 9 - KLocale::NarrowName" 5641 msgid "R" 5642 msgstr "" 5643 5644 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5645 #, kde-format 5646 msgctxt "Hijri month 10 - KLocale::NarrowName" 5647 msgid "S" 5648 msgstr "" 5649 5650 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5651 #, kde-format 5652 msgctxt "Hijri month 11 - KLocale::NarrowName" 5653 msgid "Q" 5654 msgstr "" 5655 5656 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5657 #, kde-format 5658 msgctxt "Hijri month 12 - KLocale::NarrowName" 5659 msgid "H" 5660 msgstr "" 5661 5662 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5663 #, fuzzy, kde-format 5664 #| msgctxt "of Mehr short" 5665 #| msgid "of Meh" 5666 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5667 msgid "of Muh" 5668 msgstr "wot Meh" 5669 5670 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5671 #, fuzzy, kde-format 5672 #| msgid "of Safar" 5673 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5674 msgid "of Saf" 5675 msgstr "wot Safar" 5676 5677 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5678 #, fuzzy, kde-format 5679 #| msgid "of R. Awal" 5680 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5681 msgid "of R.A" 5682 msgstr "wot R. Awal" 5683 5684 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5685 #, fuzzy, kde-format 5686 #| msgid "of R. Thaani" 5687 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5688 msgid "of R.T" 5689 msgstr "wot R. Thaani" 5690 5691 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5692 #, fuzzy, kde-format 5693 #| msgid "of J. Awal" 5694 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5695 msgid "of J.A" 5696 msgstr "wot J. Awal" 5697 5698 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5699 #, fuzzy, kde-format 5700 #| msgid "of J. Thaani" 5701 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5702 msgid "of J.T" 5703 msgstr "wot J. Thaani" 5704 5705 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5706 #, fuzzy, kde-format 5707 #| msgid "of Rajab" 5708 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5709 msgid "of Raj" 5710 msgstr "wot Rajab" 5711 5712 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5713 #, fuzzy, kde-format 5714 #| msgctxt "of Shahrivar short" 5715 #| msgid "of Sha" 5716 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5717 msgid "of Sha" 5718 msgstr "wot Sha" 5719 5720 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5721 #, fuzzy, kde-format 5722 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5723 msgid "of Ram" 5724 msgstr "Tamuz" 5725 5726 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5727 #, fuzzy, kde-format 5728 #| msgctxt "of Shahrivar short" 5729 #| msgid "of Sha" 5730 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5731 msgid "of Shw" 5732 msgstr "wot Sha" 5733 5734 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5735 #, fuzzy, kde-format 5736 #| msgid "of Qi`dah" 5737 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5738 msgid "of Qid" 5739 msgstr "wot Qi`dah" 5740 5741 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5742 #, fuzzy, kde-format 5743 #| msgid "of Hijjah" 5744 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5745 msgid "of Hij" 5746 msgstr "wot Hijjah" 5747 5748 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5749 #, fuzzy, kde-format 5750 #| msgctxt "Mehr short" 5751 #| msgid "Meh" 5752 msgctxt "Hijri month 1 - KLocale::ShortName" 5753 msgid "Muh" 5754 msgstr "Meh" 5755 5756 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5757 #, fuzzy, kde-format 5758 #| msgid "Safar" 5759 msgctxt "Hijri month 2 - KLocale::ShortName" 5760 msgid "Saf" 5761 msgstr "Safar" 5762 5763 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5764 #, fuzzy, kde-format 5765 #| msgid "R. Awal" 5766 msgctxt "Hijri month 3 - KLocale::ShortName" 5767 msgid "R.A" 5768 msgstr "R. Awal" 5769 5770 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5771 #, kde-format 5772 msgctxt "Hijri month 4 - KLocale::ShortName" 5773 msgid "R.T" 5774 msgstr "" 5775 5776 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5777 #, fuzzy, kde-format 5778 #| msgid "J. Awal" 5779 msgctxt "Hijri month 5 - KLocale::ShortName" 5780 msgid "J.A" 5781 msgstr "J. Awal" 5782 5783 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5784 #, kde-format 5785 msgctxt "Hijri month 6 - KLocale::ShortName" 5786 msgid "J.T" 5787 msgstr "" 5788 5789 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5790 #, fuzzy, kde-format 5791 #| msgid "Rajab" 5792 msgctxt "Hijri month 7 - KLocale::ShortName" 5793 msgid "Raj" 5794 msgstr "Rajab" 5795 5796 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5797 #, fuzzy, kde-format 5798 #| msgctxt "Shahrivar short" 5799 #| msgid "Sha" 5800 msgctxt "Hijri month 8 - KLocale::ShortName" 5801 msgid "Sha" 5802 msgstr "Sha" 5803 5804 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5805 #, fuzzy, kde-format 5806 msgctxt "Hijri month 9 - KLocale::ShortName" 5807 msgid "Ram" 5808 msgstr "rano" 5809 5810 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5811 #, fuzzy, kde-format 5812 #| msgctxt "Shahrivar short" 5813 #| msgid "Sha" 5814 msgctxt "Hijri month 10 - KLocale::ShortName" 5815 msgid "Shw" 5816 msgstr "Sha" 5817 5818 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5819 #, fuzzy, kde-format 5820 #| msgid "Qi`dah" 5821 msgctxt "Hijri month 11 - KLocale::ShortName" 5822 msgid "Qid" 5823 msgstr "Qi`dah" 5824 5825 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5826 #, fuzzy, kde-format 5827 #| msgctxt "@item Calendar system" 5828 #| msgid "Hijri" 5829 msgctxt "Hijri month 12 - KLocale::ShortName" 5830 msgid "Hij" 5831 msgstr "Hijri" 5832 5833 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5834 #, fuzzy, kde-format 5835 #| msgid "of Muharram" 5836 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5837 msgid "of Muharram" 5838 msgstr "wot Muharram" 5839 5840 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5841 #, fuzzy, kde-format 5842 #| msgid "of Safar" 5843 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5844 msgid "of Safar" 5845 msgstr "wot Safar" 5846 5847 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5848 #, fuzzy, kde-format 5849 #| msgid "of Rabi` al-Awal" 5850 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5851 msgid "of Rabi` al-Awal" 5852 msgstr "wot Rabi` al-Awal" 5853 5854 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5855 #, fuzzy, kde-format 5856 #| msgid "of Rabi` al-Thaani" 5857 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5858 msgid "of Rabi` al-Thaani" 5859 msgstr "wot Rabi` al-Thaani" 5860 5861 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5862 #, fuzzy, kde-format 5863 #| msgid "of Jumaada al-Awal" 5864 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5865 msgid "of Jumaada al-Awal" 5866 msgstr "wot Jumaada al-Awal" 5867 5868 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5869 #, fuzzy, kde-format 5870 #| msgid "of Jumaada al-Thaani" 5871 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5872 msgid "of Jumaada al-Thaani" 5873 msgstr "wot Jumaada al-Thaani" 5874 5875 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5876 #, fuzzy, kde-format 5877 #| msgid "of Rajab" 5878 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5879 msgid "of Rajab" 5880 msgstr "wot Rajab" 5881 5882 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5883 #, fuzzy, kde-format 5884 #| msgid "of Sha`ban" 5885 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5886 msgid "of Sha`ban" 5887 msgstr "wot Sha`ban" 5888 5889 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5890 #, fuzzy, kde-format 5891 #| msgid "of Ramadan" 5892 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5893 msgid "of Ramadan" 5894 msgstr "wot Ramadan" 5895 5896 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5897 #, fuzzy, kde-format 5898 #| msgid "of Shawwal" 5899 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5900 msgid "of Shawwal" 5901 msgstr "wot Shawwal" 5902 5903 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5904 #, fuzzy, kde-format 5905 #| msgid "of Thu al-Qi`dah" 5906 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5907 msgid "of Thu al-Qi`dah" 5908 msgstr "wot Thu al-Qi`dah" 5909 5910 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5911 #, fuzzy, kde-format 5912 #| msgid "of Thu al-Hijjah" 5913 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5914 msgid "of Thu al-Hijjah" 5915 msgstr "wot Thu al-Hijjah" 5916 5917 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5918 #, fuzzy, kde-format 5919 #| msgid "Muharram" 5920 msgctxt "Hijri month 1 - KLocale::LongName" 5921 msgid "Muharram" 5922 msgstr "Muharram" 5923 5924 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5925 #, fuzzy, kde-format 5926 #| msgid "Safar" 5927 msgctxt "Hijri month 2 - KLocale::LongName" 5928 msgid "Safar" 5929 msgstr "Safar" 5930 5931 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5932 #, fuzzy, kde-format 5933 #| msgid "Rabi` al-Awal" 5934 msgctxt "Hijri month 3 - KLocale::LongName" 5935 msgid "Rabi` al-Awal" 5936 msgstr "Rabi` al-Awal" 5937 5938 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5939 #, fuzzy, kde-format 5940 #| msgid "Rabi` al-Thaani" 5941 msgctxt "Hijri month 4 - KLocale::LongName" 5942 msgid "Rabi` al-Thaani" 5943 msgstr "Rabi` al-Thaani" 5944 5945 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5946 #, fuzzy, kde-format 5947 #| msgid "Jumaada al-Awal" 5948 msgctxt "Hijri month 5 - KLocale::LongName" 5949 msgid "Jumaada al-Awal" 5950 msgstr "Jumaada al-Awal" 5951 5952 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5953 #, fuzzy, kde-format 5954 #| msgid "Jumaada al-Thaani" 5955 msgctxt "Hijri month 6 - KLocale::LongName" 5956 msgid "Jumaada al-Thaani" 5957 msgstr "Jumaada al-Thaani" 5958 5959 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5960 #, fuzzy, kde-format 5961 #| msgid "Rajab" 5962 msgctxt "Hijri month 7 - KLocale::LongName" 5963 msgid "Rajab" 5964 msgstr "Rajab" 5965 5966 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5967 #, fuzzy, kde-format 5968 #| msgid "Sha`ban" 5969 msgctxt "Hijri month 8 - KLocale::LongName" 5970 msgid "Sha`ban" 5971 msgstr "Sha`ban" 5972 5973 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5974 #, fuzzy, kde-format 5975 #| msgid "Ramadan" 5976 msgctxt "Hijri month 9 - KLocale::LongName" 5977 msgid "Ramadan" 5978 msgstr "Ramadan" 5979 5980 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5981 #, fuzzy, kde-format 5982 #| msgid "Shawwal" 5983 msgctxt "Hijri month 10 - KLocale::LongName" 5984 msgid "Shawwal" 5985 msgstr "Shawwal" 5986 5987 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5988 #, fuzzy, kde-format 5989 #| msgid "Thu al-Qi`dah" 5990 msgctxt "Hijri month 11 - KLocale::LongName" 5991 msgid "Thu al-Qi`dah" 5992 msgstr "Thu al-Qi`dah" 5993 5994 #: kdecore/kcalendarsystemislamiccivil.cpp:312 5995 #, fuzzy, kde-format 5996 #| msgid "Thu al-Hijjah" 5997 msgctxt "Hijri month 12 - KLocale::LongName" 5998 msgid "Thu al-Hijjah" 5999 msgstr "Thu al-Hijjah" 6000 6001 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6002 #, kde-format 6003 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6004 msgid "I" 6005 msgstr "" 6006 6007 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6008 #, kde-format 6009 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6010 msgid "T" 6011 msgstr "" 6012 6013 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6014 #, fuzzy, kde-format 6015 #| msgid "Av" 6016 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6017 msgid "A" 6018 msgstr "Av" 6019 6020 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6021 #, kde-format 6022 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6023 msgid "K" 6024 msgstr "" 6025 6026 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6027 #, kde-format 6028 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6029 msgid "J" 6030 msgstr "" 6031 6032 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6033 #, kde-format 6034 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6035 msgid "S" 6036 msgstr "" 6037 6038 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6039 #, fuzzy, kde-format 6040 #| msgid "Av" 6041 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6042 msgid "A" 6043 msgstr "Av" 6044 6045 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6046 #, fuzzy, kde-format 6047 #| msgid "Ith" 6048 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6049 msgid "Ith" 6050 msgstr "I-ty" 6051 6052 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6053 #, fuzzy, kde-format 6054 #| msgid "Thl" 6055 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6056 msgid "Thl" 6057 msgstr "Thl" 6058 6059 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6060 #, fuzzy, kde-format 6061 #| msgid "Arb" 6062 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6063 msgid "Arb" 6064 msgstr "Arb" 6065 6066 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6067 #, fuzzy, kde-format 6068 #| msgid "Kha" 6069 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6070 msgid "Kha" 6071 msgstr "Kha" 6072 6073 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6074 #, fuzzy, kde-format 6075 #| msgid "Jum" 6076 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6077 msgid "Jum" 6078 msgstr "Jum" 6079 6080 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6081 #, fuzzy, kde-format 6082 #| msgid "Sab" 6083 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6084 msgid "Sab" 6085 msgstr "Sab" 6086 6087 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6088 #, fuzzy, kde-format 6089 #| msgid "Ahd" 6090 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6091 msgid "Ahd" 6092 msgstr "Ahd" 6093 6094 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6095 #, fuzzy, kde-format 6096 #| msgid "Yaum al-Ithnain" 6097 msgctxt "Hijri weekday 1 - KLocale::LongName" 6098 msgid "Yaum al-Ithnain" 6099 msgstr "Yaum al-Ithnain" 6100 6101 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6102 #, fuzzy, kde-format 6103 #| msgid "Yau al-Thulatha" 6104 msgctxt "Hijri weekday 2 - KLocale::LongName" 6105 msgid "Yau al-Thulatha" 6106 msgstr "Yau al-Thulatha" 6107 6108 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6109 #, fuzzy, kde-format 6110 #| msgid "Yaum al-Arbi'a" 6111 msgctxt "Hijri weekday 3 - KLocale::LongName" 6112 msgid "Yaum al-Arbi'a" 6113 msgstr "Yaum al-Arbi'a" 6114 6115 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6116 #, fuzzy, kde-format 6117 #| msgid "Yaum al-Khamees" 6118 msgctxt "Hijri weekday 4 - KLocale::LongName" 6119 msgid "Yaum al-Khamees" 6120 msgstr "Yaum al-Khamees" 6121 6122 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6123 #, fuzzy, kde-format 6124 #| msgid "Yaum al-Jumma" 6125 msgctxt "Hijri weekday 5 - KLocale::LongName" 6126 msgid "Yaum al-Jumma" 6127 msgstr "Yaum al-Jumma" 6128 6129 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6130 #, fuzzy, kde-format 6131 #| msgid "Yaum al-Sabt" 6132 msgctxt "Hijri weekday 6 - KLocale::LongName" 6133 msgid "Yaum al-Sabt" 6134 msgstr "Yaum al-Sabt" 6135 6136 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6137 #, fuzzy, kde-format 6138 #| msgid "Yaum al-Ahad" 6139 msgctxt "Hijri weekday 7 - KLocale::LongName" 6140 msgid "Yaum al-Ahad" 6141 msgstr "Yaum al-Ahad" 6142 6143 #: kdecore/kcalendarsystemjalali.cpp:74 6144 #, kde-format 6145 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6146 msgid "Anno Persico" 6147 msgstr "" 6148 6149 #: kdecore/kcalendarsystemjalali.cpp:75 6150 #, kde-format 6151 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6152 msgid "AP" 6153 msgstr "" 6154 6155 #: kdecore/kcalendarsystemjalali.cpp:76 6156 #, kde-format 6157 msgctxt "" 6158 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6159 msgid "%Ey %EC" 6160 msgstr "" 6161 6162 #: kdecore/kcalendarsystemjalali.cpp:172 6163 #, kde-format 6164 msgctxt "Jalali month 1 - KLocale::NarrowName" 6165 msgid "F" 6166 msgstr "" 6167 6168 #: kdecore/kcalendarsystemjalali.cpp:174 6169 #, kde-format 6170 msgctxt "Jalali month 2 - KLocale::NarrowName" 6171 msgid "O" 6172 msgstr "" 6173 6174 #: kdecore/kcalendarsystemjalali.cpp:176 6175 #, kde-format 6176 msgctxt "Jalali month 3 - KLocale::NarrowName" 6177 msgid "K" 6178 msgstr "" 6179 6180 #: kdecore/kcalendarsystemjalali.cpp:178 6181 #, kde-format 6182 msgctxt "Jalali month 4 - KLocale::NarrowName" 6183 msgid "T" 6184 msgstr "" 6185 6186 #: kdecore/kcalendarsystemjalali.cpp:180 6187 #, kde-format 6188 msgctxt "Jalali month 5 - KLocale::NarrowName" 6189 msgid "M" 6190 msgstr "" 6191 6192 #: kdecore/kcalendarsystemjalali.cpp:182 6193 #, kde-format 6194 msgctxt "Jalali month 6 - KLocale::NarrowName" 6195 msgid "S" 6196 msgstr "" 6197 6198 #: kdecore/kcalendarsystemjalali.cpp:184 6199 #, kde-format 6200 msgctxt "Jalali month 7 - KLocale::NarrowName" 6201 msgid "M" 6202 msgstr "" 6203 6204 #: kdecore/kcalendarsystemjalali.cpp:186 6205 #, fuzzy, kde-format 6206 #| msgid "Av" 6207 msgctxt "Jalali month 8 - KLocale::NarrowName" 6208 msgid "A" 6209 msgstr "Av" 6210 6211 #: kdecore/kcalendarsystemjalali.cpp:188 6212 #, fuzzy, kde-format 6213 #| msgid "Av" 6214 msgctxt "Jalali month 9 - KLocale::NarrowName" 6215 msgid "A" 6216 msgstr "Av" 6217 6218 #: kdecore/kcalendarsystemjalali.cpp:190 6219 #, kde-format 6220 msgctxt "Jalali month 10 - KLocale::NarrowName" 6221 msgid "D" 6222 msgstr "" 6223 6224 #: kdecore/kcalendarsystemjalali.cpp:192 6225 #, kde-format 6226 msgctxt "Jalali month 11 - KLocale::NarrowName" 6227 msgid "B" 6228 msgstr "" 6229 6230 #: kdecore/kcalendarsystemjalali.cpp:194 6231 #, kde-format 6232 msgctxt "Jalali month 12 - KLocale::NarrowName" 6233 msgid "E" 6234 msgstr "" 6235 6236 #: kdecore/kcalendarsystemjalali.cpp:203 6237 #, fuzzy, kde-format 6238 #| msgctxt "of Farvardin short" 6239 #| msgid "of Far" 6240 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6241 msgid "of Far" 6242 msgstr "wot Fara" 6243 6244 #: kdecore/kcalendarsystemjalali.cpp:205 6245 #, fuzzy, kde-format 6246 #| msgctxt "of Ordibehesht short" 6247 #| msgid "of Ord" 6248 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6249 msgid "of Ord" 6250 msgstr "wot Orda" 6251 6252 #: kdecore/kcalendarsystemjalali.cpp:207 6253 #, fuzzy, kde-format 6254 #| msgctxt "of Khordad short" 6255 #| msgid "of Kho" 6256 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6257 msgid "of Kho" 6258 msgstr "wot Kho" 6259 6260 #: kdecore/kcalendarsystemjalali.cpp:209 6261 #, fuzzy, kde-format 6262 #| msgctxt "of Tir short" 6263 #| msgid "of Tir" 6264 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6265 msgid "of Tir" 6266 msgstr "wot Tira" 6267 6268 #: kdecore/kcalendarsystemjalali.cpp:211 6269 #, fuzzy, kde-format 6270 #| msgctxt "of Mordad short" 6271 #| msgid "of Mor" 6272 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6273 msgid "of Mor" 6274 msgstr "wot Mora" 6275 6276 #: kdecore/kcalendarsystemjalali.cpp:213 6277 #, fuzzy, kde-format 6278 #| msgctxt "of Shahrivar short" 6279 #| msgid "of Sha" 6280 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6281 msgid "of Sha" 6282 msgstr "wot Sha" 6283 6284 #: kdecore/kcalendarsystemjalali.cpp:215 6285 #, fuzzy, kde-format 6286 #| msgctxt "of Mehr short" 6287 #| msgid "of Meh" 6288 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6289 msgid "of Meh" 6290 msgstr "wot Meh" 6291 6292 #: kdecore/kcalendarsystemjalali.cpp:217 6293 #, fuzzy, kde-format 6294 #| msgctxt "of Aban short" 6295 #| msgid "of Aba" 6296 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6297 msgid "of Aba" 6298 msgstr "wot Aba" 6299 6300 #: kdecore/kcalendarsystemjalali.cpp:219 6301 #, fuzzy, kde-format 6302 #| msgctxt "of Azar short" 6303 #| msgid "of Aza" 6304 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6305 msgid "of Aza" 6306 msgstr " Aza" 6307 6308 #: kdecore/kcalendarsystemjalali.cpp:221 6309 #, fuzzy, kde-format 6310 #| msgctxt "of Dei short" 6311 #| msgid "of Dei" 6312 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6313 msgid "of Dei" 6314 msgstr "Dei" 6315 6316 #: kdecore/kcalendarsystemjalali.cpp:223 6317 #, fuzzy, kde-format 6318 #| msgctxt "of Bahman short" 6319 #| msgid "of Bah" 6320 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6321 msgid "of Bah" 6322 msgstr "wot Bah" 6323 6324 #: kdecore/kcalendarsystemjalali.cpp:225 6325 #, fuzzy, kde-format 6326 #| msgctxt "of Esfand short" 6327 #| msgid "of Esf" 6328 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6329 msgid "of Esf" 6330 msgstr "wot Esf" 6331 6332 #: kdecore/kcalendarsystemjalali.cpp:234 6333 #, fuzzy, kde-format 6334 #| msgctxt "Farvardin short" 6335 #| msgid "Far" 6336 msgctxt "Jalali month 1 - KLocale::ShortName" 6337 msgid "Far" 6338 msgstr "Far" 6339 6340 #: kdecore/kcalendarsystemjalali.cpp:236 6341 #, fuzzy, kde-format 6342 #| msgctxt "Ordibehesht short" 6343 #| msgid "Ord" 6344 msgctxt "Jalali month 2 - KLocale::ShortName" 6345 msgid "Ord" 6346 msgstr "Ord" 6347 6348 #: kdecore/kcalendarsystemjalali.cpp:238 6349 #, fuzzy, kde-format 6350 #| msgctxt "Khordad short" 6351 #| msgid "Kho" 6352 msgctxt "Jalali month 3 - KLocale::ShortName" 6353 msgid "Kho" 6354 msgstr "Kho" 6355 6356 #: kdecore/kcalendarsystemjalali.cpp:240 6357 #, fuzzy, kde-format 6358 #| msgctxt "Tir short" 6359 #| msgid "Tir" 6360 msgctxt "Jalali month 4 - KLocale::ShortName" 6361 msgid "Tir" 6362 msgstr "Tir" 6363 6364 #: kdecore/kcalendarsystemjalali.cpp:242 6365 #, fuzzy, kde-format 6366 #| msgctxt "Mordad short" 6367 #| msgid "Mor" 6368 msgctxt "Jalali month 5 - KLocale::ShortName" 6369 msgid "Mor" 6370 msgstr "Mor" 6371 6372 #: kdecore/kcalendarsystemjalali.cpp:244 6373 #, fuzzy, kde-format 6374 #| msgctxt "Shahrivar short" 6375 #| msgid "Sha" 6376 msgctxt "Jalali month 6 - KLocale::ShortName" 6377 msgid "Sha" 6378 msgstr "Sha" 6379 6380 #: kdecore/kcalendarsystemjalali.cpp:246 6381 #, fuzzy, kde-format 6382 #| msgctxt "Mehr short" 6383 #| msgid "Meh" 6384 msgctxt "Jalali month 7 - KLocale::ShortName" 6385 msgid "Meh" 6386 msgstr "Meh" 6387 6388 #: kdecore/kcalendarsystemjalali.cpp:248 6389 #, fuzzy, kde-format 6390 #| msgctxt "Aban short" 6391 #| msgid "Aba" 6392 msgctxt "Jalali month 8 - KLocale::ShortName" 6393 msgid "Aba" 6394 msgstr "Aba" 6395 6396 #: kdecore/kcalendarsystemjalali.cpp:250 6397 #, fuzzy, kde-format 6398 #| msgctxt "Azar short" 6399 #| msgid "Aza" 6400 msgctxt "Jalali month 9 - KLocale::ShortName" 6401 msgid "Aza" 6402 msgstr "Aza" 6403 6404 #: kdecore/kcalendarsystemjalali.cpp:252 6405 #, fuzzy, kde-format 6406 #| msgctxt "Dei short" 6407 #| msgid "Dei" 6408 msgctxt "Jalali month 10 - KLocale::ShortName" 6409 msgid "Dei" 6410 msgstr "Dei" 6411 6412 #: kdecore/kcalendarsystemjalali.cpp:254 6413 #, fuzzy, kde-format 6414 #| msgctxt "Bahman short" 6415 #| msgid "Bah" 6416 msgctxt "Jalali month 11 - KLocale::ShortName" 6417 msgid "Bah" 6418 msgstr "Bah" 6419 6420 #: kdecore/kcalendarsystemjalali.cpp:256 6421 #, fuzzy, kde-format 6422 #| msgctxt "Esfand" 6423 #| msgid "Esf" 6424 msgctxt "Jalali month 12 - KLocale::ShortName" 6425 msgid "Esf" 6426 msgstr "Esf" 6427 6428 #: kdecore/kcalendarsystemjalali.cpp:265 6429 #, fuzzy, kde-format 6430 #| msgid "of Farvardin" 6431 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6432 msgid "of Farvardin" 6433 msgstr "wot Farwardina" 6434 6435 #: kdecore/kcalendarsystemjalali.cpp:267 6436 #, fuzzy, kde-format 6437 #| msgid "of Ordibehesht" 6438 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6439 msgid "of Ordibehesht" 6440 msgstr "wot Ordibeheshta" 6441 6442 #: kdecore/kcalendarsystemjalali.cpp:269 6443 #, fuzzy, kde-format 6444 #| msgid "of Khordad" 6445 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6446 msgid "of Khordad" 6447 msgstr "wot Khordad" 6448 6449 #: kdecore/kcalendarsystemjalali.cpp:271 6450 #, fuzzy, kde-format 6451 #| msgctxt "of Tir short" 6452 #| msgid "of Tir" 6453 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6454 msgid "of Tir" 6455 msgstr "wot Tira" 6456 6457 #: kdecore/kcalendarsystemjalali.cpp:273 6458 #, fuzzy, kde-format 6459 #| msgid "of Mordad" 6460 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6461 msgid "of Mordad" 6462 msgstr "wot Mordad" 6463 6464 #: kdecore/kcalendarsystemjalali.cpp:275 6465 #, fuzzy, kde-format 6466 #| msgid "of Shahrivar" 6467 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6468 msgid "of Shahrivar" 6469 msgstr "wot Shahrivar" 6470 6471 #: kdecore/kcalendarsystemjalali.cpp:277 6472 #, fuzzy, kde-format 6473 #| msgid "of Mehr" 6474 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6475 msgid "of Mehr" 6476 msgstr "wot Mehr" 6477 6478 #: kdecore/kcalendarsystemjalali.cpp:279 6479 #, fuzzy, kde-format 6480 #| msgid "of Aban" 6481 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6482 msgid "of Aban" 6483 msgstr "wot Aban" 6484 6485 #: kdecore/kcalendarsystemjalali.cpp:281 6486 #, fuzzy, kde-format 6487 #| msgid "of Azar" 6488 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6489 msgid "of Azar" 6490 msgstr "wot Azar" 6491 6492 #: kdecore/kcalendarsystemjalali.cpp:283 6493 #, fuzzy, kde-format 6494 #| msgctxt "of Dei short" 6495 #| msgid "of Dei" 6496 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6497 msgid "of Dei" 6498 msgstr "Dei" 6499 6500 #: kdecore/kcalendarsystemjalali.cpp:285 6501 #, fuzzy, kde-format 6502 #| msgid "of Bahman" 6503 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6504 msgid "of Bahman" 6505 msgstr "wot Bahman" 6506 6507 #: kdecore/kcalendarsystemjalali.cpp:287 6508 #, fuzzy, kde-format 6509 #| msgid "of Esfand" 6510 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6511 msgid "of Esfand" 6512 msgstr "wot Esfand" 6513 6514 #: kdecore/kcalendarsystemjalali.cpp:296 6515 #, fuzzy, kde-format 6516 #| msgid "Farvardin" 6517 msgctxt "Jalali month 1 - KLocale::LongName" 6518 msgid "Farvardin" 6519 msgstr "Farvardin" 6520 6521 #: kdecore/kcalendarsystemjalali.cpp:298 6522 #, fuzzy, kde-format 6523 #| msgid "Ordibehesht" 6524 msgctxt "Jalali month 2 - KLocale::LongName" 6525 msgid "Ordibehesht" 6526 msgstr "Ordibehesht" 6527 6528 #: kdecore/kcalendarsystemjalali.cpp:300 6529 #, fuzzy, kde-format 6530 #| msgid "Khordad" 6531 msgctxt "Jalali month 3 - KLocale::LongName" 6532 msgid "Khordad" 6533 msgstr "Khordad" 6534 6535 #: kdecore/kcalendarsystemjalali.cpp:302 6536 #, fuzzy, kde-format 6537 #| msgctxt "Tir short" 6538 #| msgid "Tir" 6539 msgctxt "Jalali month 4 - KLocale::LongName" 6540 msgid "Tir" 6541 msgstr "Tir" 6542 6543 #: kdecore/kcalendarsystemjalali.cpp:304 6544 #, fuzzy, kde-format 6545 #| msgid "Mordad" 6546 msgctxt "Jalali month 5 - KLocale::LongName" 6547 msgid "Mordad" 6548 msgstr "Mordad" 6549 6550 #: kdecore/kcalendarsystemjalali.cpp:306 6551 #, fuzzy, kde-format 6552 #| msgid "Shahrivar" 6553 msgctxt "Jalali month 6 - KLocale::LongName" 6554 msgid "Shahrivar" 6555 msgstr "Shahrivar" 6556 6557 #: kdecore/kcalendarsystemjalali.cpp:308 6558 #, fuzzy, kde-format 6559 #| msgid "Mehr" 6560 msgctxt "Jalali month 7 - KLocale::LongName" 6561 msgid "Mehr" 6562 msgstr "Mehr" 6563 6564 #: kdecore/kcalendarsystemjalali.cpp:310 6565 #, fuzzy, kde-format 6566 #| msgid "Aban" 6567 msgctxt "Jalali month 8 - KLocale::LongName" 6568 msgid "Aban" 6569 msgstr "Aban" 6570 6571 #: kdecore/kcalendarsystemjalali.cpp:312 6572 #, fuzzy, kde-format 6573 #| msgid "Azar" 6574 msgctxt "Jalali month 9 - KLocale::LongName" 6575 msgid "Azar" 6576 msgstr "Azar" 6577 6578 #: kdecore/kcalendarsystemjalali.cpp:314 6579 #, fuzzy, kde-format 6580 #| msgctxt "Dei short" 6581 #| msgid "Dei" 6582 msgctxt "Jalali month 10 - KLocale::LongName" 6583 msgid "Dei" 6584 msgstr "Dei" 6585 6586 #: kdecore/kcalendarsystemjalali.cpp:316 6587 #, fuzzy, kde-format 6588 #| msgid "Bahman" 6589 msgctxt "Jalali month 11 - KLocale::LongName" 6590 msgid "Bahman" 6591 msgstr "Bahman" 6592 6593 #: kdecore/kcalendarsystemjalali.cpp:318 6594 #, fuzzy, kde-format 6595 #| msgid "Esfand" 6596 msgctxt "Jalali month 12 - KLocale::LongName" 6597 msgid "Esfand" 6598 msgstr "Esfand" 6599 6600 #: kdecore/kcalendarsystemjalali.cpp:331 6601 #, kde-format 6602 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6603 msgid "2" 6604 msgstr "" 6605 6606 #: kdecore/kcalendarsystemjalali.cpp:333 6607 #, kde-format 6608 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6609 msgid "3" 6610 msgstr "" 6611 6612 #: kdecore/kcalendarsystemjalali.cpp:335 6613 #, kde-format 6614 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6615 msgid "4" 6616 msgstr "" 6617 6618 #: kdecore/kcalendarsystemjalali.cpp:337 6619 #, kde-format 6620 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6621 msgid "5" 6622 msgstr "" 6623 6624 #: kdecore/kcalendarsystemjalali.cpp:339 6625 #, kde-format 6626 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6627 msgid "J" 6628 msgstr "" 6629 6630 #: kdecore/kcalendarsystemjalali.cpp:341 6631 #, kde-format 6632 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6633 msgid "S" 6634 msgstr "" 6635 6636 #: kdecore/kcalendarsystemjalali.cpp:343 6637 #, kde-format 6638 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6639 msgid "1" 6640 msgstr "" 6641 6642 #: kdecore/kcalendarsystemjalali.cpp:352 6643 #, fuzzy, kde-format 6644 #| msgctxt "Do shanbe short" 6645 #| msgid "2sh" 6646 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6647 msgid "2sh" 6648 msgstr "2sh" 6649 6650 #: kdecore/kcalendarsystemjalali.cpp:354 6651 #, fuzzy, kde-format 6652 #| msgctxt "Se shanbe short" 6653 #| msgid "3sh" 6654 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6655 msgid "3sh" 6656 msgstr "3sh" 6657 6658 #: kdecore/kcalendarsystemjalali.cpp:356 6659 #, fuzzy, kde-format 6660 #| msgctxt "Chahar shanbe short" 6661 #| msgid "4sh" 6662 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6663 msgid "4sh" 6664 msgstr "4sh" 6665 6666 #: kdecore/kcalendarsystemjalali.cpp:358 6667 #, fuzzy, kde-format 6668 #| msgctxt "Panj shanbe short" 6669 #| msgid "5sh" 6670 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6671 msgid "5sh" 6672 msgstr "5sh" 6673 6674 #: kdecore/kcalendarsystemjalali.cpp:360 6675 #, fuzzy, kde-format 6676 #| msgctxt "Jumee short" 6677 #| msgid "Jom" 6678 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6679 msgid "Jom" 6680 msgstr "Jom" 6681 6682 #: kdecore/kcalendarsystemjalali.cpp:362 6683 #, fuzzy, kde-format 6684 #| msgid "Shanbe" 6685 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6686 msgid "Shn" 6687 msgstr "Shanbe" 6688 6689 #: kdecore/kcalendarsystemjalali.cpp:364 6690 #, fuzzy, kde-format 6691 #| msgctxt "Yek-shanbe short" 6692 #| msgid "1sh" 6693 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6694 msgid "1sh" 6695 msgstr "1sh" 6696 6697 #: kdecore/kcalendarsystemjalali.cpp:371 6698 #, fuzzy, kde-format 6699 #| msgid "Do shanbe" 6700 msgctxt "Jalali weekday 1 - KLocale::LongName" 6701 msgid "Do shanbe" 6702 msgstr "Do shanbe" 6703 6704 #: kdecore/kcalendarsystemjalali.cpp:373 6705 #, fuzzy, kde-format 6706 #| msgid "Se shanbe" 6707 msgctxt "Jalali weekday 2 - KLocale::LongName" 6708 msgid "Se shanbe" 6709 msgstr "Se shanbe" 6710 6711 #: kdecore/kcalendarsystemjalali.cpp:375 6712 #, fuzzy, kde-format 6713 #| msgid "Chahar shanbe" 6714 msgctxt "Jalali weekday 3 - KLocale::LongName" 6715 msgid "Chahar shanbe" 6716 msgstr "Chahar shanbe" 6717 6718 #: kdecore/kcalendarsystemjalali.cpp:377 6719 #, fuzzy, kde-format 6720 #| msgid "Panj shanbe" 6721 msgctxt "Jalali weekday 4 - KLocale::LongName" 6722 msgid "Panj shanbe" 6723 msgstr "Panj shanbe" 6724 6725 #: kdecore/kcalendarsystemjalali.cpp:379 6726 #, fuzzy, kde-format 6727 #| msgid "Jumee" 6728 msgctxt "Jalali weekday 5 - KLocale::LongName" 6729 msgid "Jumee" 6730 msgstr "Jumee" 6731 6732 #: kdecore/kcalendarsystemjalali.cpp:381 6733 #, fuzzy, kde-format 6734 #| msgid "Shanbe" 6735 msgctxt "Jalali weekday 6 - KLocale::LongName" 6736 msgid "Shanbe" 6737 msgstr "Shanbe" 6738 6739 #: kdecore/kcalendarsystemjalali.cpp:383 6740 #, fuzzy, kde-format 6741 #| msgid "Yek-shanbe" 6742 msgctxt "Jalali weekday 7 - KLocale::LongName" 6743 msgid "Yek-shanbe" 6744 msgstr "Yek-shanbe" 6745 6746 #: kdecore/kcalendarsystemjapanese.cpp:62 6747 #, kde-format 6748 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6749 msgid "Meiji" 6750 msgstr "" 6751 6752 #: kdecore/kcalendarsystemjapanese.cpp:64 6753 #, kde-format 6754 msgctxt "" 6755 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6756 "e.g. Meiji 1" 6757 msgid "%EC Gannen" 6758 msgstr "" 6759 6760 #: kdecore/kcalendarsystemjapanese.cpp:66 6761 #, kde-format 6762 msgctxt "" 6763 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6764 "e.g. Meiji 22" 6765 msgid "%EC %Ey" 6766 msgstr "" 6767 6768 #: kdecore/kcalendarsystemjapanese.cpp:69 6769 #, kde-format 6770 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6771 msgid "Taishō" 6772 msgstr "" 6773 6774 #: kdecore/kcalendarsystemjapanese.cpp:71 6775 #, kde-format 6776 msgctxt "" 6777 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6778 "1, e.g. Taishō 1" 6779 msgid "%EC Gannen" 6780 msgstr "" 6781 6782 #: kdecore/kcalendarsystemjapanese.cpp:73 6783 #, kde-format 6784 msgctxt "" 6785 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6786 "1, e.g. Taishō 22" 6787 msgid "%EC %Ey" 6788 msgstr "" 6789 6790 #: kdecore/kcalendarsystemjapanese.cpp:76 6791 #, fuzzy, kde-format 6792 #| msgctxt "Shahrivar short" 6793 #| msgid "Sha" 6794 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6795 msgid "Shōwa" 6796 msgstr "Sha" 6797 6798 #: kdecore/kcalendarsystemjapanese.cpp:78 6799 #, kde-format 6800 msgctxt "" 6801 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6802 "e.g. Shōwa 1" 6803 msgid "%EC Gannen" 6804 msgstr "" 6805 6806 #: kdecore/kcalendarsystemjapanese.cpp:80 6807 #, kde-format 6808 msgctxt "" 6809 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6810 "e.g. Shōwa 22" 6811 msgid "%EC %Ey" 6812 msgstr "" 6813 6814 #: kdecore/kcalendarsystemjapanese.cpp:83 6815 #, kde-format 6816 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6817 msgid "Heisei" 6818 msgstr "" 6819 6820 #: kdecore/kcalendarsystemjapanese.cpp:85 6821 #, kde-format 6822 msgctxt "" 6823 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6824 "1, e.g. Heisei 1" 6825 msgid "%EC Gannen" 6826 msgstr "" 6827 6828 #: kdecore/kcalendarsystemjapanese.cpp:87 6829 #, kde-format 6830 msgctxt "" 6831 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6832 "1, e.g. Heisei 22" 6833 msgid "%EC %Ey" 6834 msgstr "" 6835 6836 #: kdecore/kcalendarsystemjapanese.cpp:164 6837 #, fuzzy, kde-format 6838 msgctxt "Japanese year 1 of era" 6839 msgid "Gannen" 6840 msgstr "Zeleń:" 6841 6842 #: kdecore/kcalendarsystemjulian.cpp:73 6843 #, kde-format 6844 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6845 msgid "Before Common Era" 6846 msgstr "" 6847 6848 #: kdecore/kcalendarsystemjulian.cpp:74 6849 #, kde-format 6850 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6851 msgid "BCE" 6852 msgstr "" 6853 6854 #: kdecore/kcalendarsystemjulian.cpp:76 6855 #, kde-format 6856 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6857 msgid "Before Christ" 6858 msgstr "" 6859 6860 #: kdecore/kcalendarsystemjulian.cpp:77 6861 #, kde-format 6862 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6863 msgid "BC" 6864 msgstr "" 6865 6866 #: kdecore/kcalendarsystemjulian.cpp:79 6867 #, kde-format 6868 msgctxt "" 6869 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6870 msgid "%Ey %EC" 6871 msgstr "" 6872 6873 #: kdecore/kcalendarsystemjulian.cpp:83 6874 #, kde-format 6875 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6876 msgid "Common Era" 6877 msgstr "" 6878 6879 #: kdecore/kcalendarsystemjulian.cpp:84 6880 #, kde-format 6881 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6882 msgid "CE" 6883 msgstr "" 6884 6885 #: kdecore/kcalendarsystemjulian.cpp:86 6886 #, kde-format 6887 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6888 msgid "Anno Domini" 6889 msgstr "" 6890 6891 #: kdecore/kcalendarsystemjulian.cpp:87 6892 #, kde-format 6893 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6894 msgid "AD" 6895 msgstr "" 6896 6897 #: kdecore/kcalendarsystemjulian.cpp:89 6898 #, kde-format 6899 msgctxt "" 6900 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6901 msgid "%Ey %EC" 6902 msgstr "" 6903 6904 #: kdecore/kcalendarsystemjulian.cpp:172 6905 #, kde-format 6906 msgctxt "Julian month 1 - KLocale::NarrowName" 6907 msgid "J" 6908 msgstr "" 6909 6910 #: kdecore/kcalendarsystemjulian.cpp:174 6911 #, kde-format 6912 msgctxt "Julian month 2 - KLocale::NarrowName" 6913 msgid "F" 6914 msgstr "" 6915 6916 #: kdecore/kcalendarsystemjulian.cpp:176 6917 #, kde-format 6918 msgctxt "Julian month 3 - KLocale::NarrowName" 6919 msgid "M" 6920 msgstr "" 6921 6922 #: kdecore/kcalendarsystemjulian.cpp:178 6923 #, fuzzy, kde-format 6924 #| msgid "Av" 6925 msgctxt "Julian month 4 - KLocale::NarrowName" 6926 msgid "A" 6927 msgstr "Av" 6928 6929 #: kdecore/kcalendarsystemjulian.cpp:180 6930 #, kde-format 6931 msgctxt "Julian month 5 - KLocale::NarrowName" 6932 msgid "M" 6933 msgstr "" 6934 6935 #: kdecore/kcalendarsystemjulian.cpp:182 6936 #, kde-format 6937 msgctxt "Julian month 6 - KLocale::NarrowName" 6938 msgid "J" 6939 msgstr "" 6940 6941 #: kdecore/kcalendarsystemjulian.cpp:184 6942 #, kde-format 6943 msgctxt "Julian month 7 - KLocale::NarrowName" 6944 msgid "J" 6945 msgstr "" 6946 6947 #: kdecore/kcalendarsystemjulian.cpp:186 6948 #, fuzzy, kde-format 6949 #| msgid "Av" 6950 msgctxt "Julian month 8 - KLocale::NarrowName" 6951 msgid "A" 6952 msgstr "Av" 6953 6954 #: kdecore/kcalendarsystemjulian.cpp:188 6955 #, kde-format 6956 msgctxt "Julian month 9 - KLocale::NarrowName" 6957 msgid "S" 6958 msgstr "" 6959 6960 #: kdecore/kcalendarsystemjulian.cpp:190 6961 #, kde-format 6962 msgctxt "Julian month 10 - KLocale::NarrowName" 6963 msgid "O" 6964 msgstr "" 6965 6966 #: kdecore/kcalendarsystemjulian.cpp:192 6967 #, kde-format 6968 msgctxt "Julian month 11 - KLocale::NarrowName" 6969 msgid "N" 6970 msgstr "" 6971 6972 #: kdecore/kcalendarsystemjulian.cpp:194 6973 #, kde-format 6974 msgctxt "Julian month 12 - KLocale::NarrowName" 6975 msgid "D" 6976 msgstr "" 6977 6978 #: kdecore/kcalendarsystemjulian.cpp:203 6979 #, fuzzy, kde-format 6980 #| msgctxt "of January" 6981 #| msgid "of Jan" 6982 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6983 msgid "of Jan" 6984 msgstr "januara" 6985 6986 #: kdecore/kcalendarsystemjulian.cpp:205 6987 #, fuzzy, kde-format 6988 #| msgctxt "of February" 6989 #| msgid "of Feb" 6990 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6991 msgid "of Feb" 6992 msgstr "februara" 6993 6994 #: kdecore/kcalendarsystemjulian.cpp:207 6995 #, fuzzy, kde-format 6996 #| msgctxt "of March" 6997 #| msgid "of Mar" 6998 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6999 msgid "of Mar" 7000 msgstr "měrca" 7001 7002 #: kdecore/kcalendarsystemjulian.cpp:209 7003 #, fuzzy, kde-format 7004 #| msgctxt "of April" 7005 #| msgid "of Apr" 7006 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7007 msgid "of Apr" 7008 msgstr "apryla" 7009 7010 #: kdecore/kcalendarsystemjulian.cpp:211 7011 #, fuzzy, kde-format 7012 #| msgctxt "of May short" 7013 #| msgid "of May" 7014 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7015 msgid "of May" 7016 msgstr "meje" 7017 7018 #: kdecore/kcalendarsystemjulian.cpp:213 7019 #, fuzzy, kde-format 7020 #| msgctxt "of June" 7021 #| msgid "of Jun" 7022 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7023 msgid "of Jun" 7024 msgstr "junija" 7025 7026 #: kdecore/kcalendarsystemjulian.cpp:215 7027 #, fuzzy, kde-format 7028 #| msgctxt "of July" 7029 #| msgid "of Jul" 7030 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7031 msgid "of Jul" 7032 msgstr "julija" 7033 7034 #: kdecore/kcalendarsystemjulian.cpp:217 7035 #, fuzzy, kde-format 7036 #| msgctxt "of August" 7037 #| msgid "of Aug" 7038 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7039 msgid "of Aug" 7040 msgstr "awgusta" 7041 7042 #: kdecore/kcalendarsystemjulian.cpp:219 7043 #, fuzzy, kde-format 7044 #| msgctxt "of September" 7045 #| msgid "of Sep" 7046 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7047 msgid "of Sep" 7048 msgstr "septembra" 7049 7050 #: kdecore/kcalendarsystemjulian.cpp:221 7051 #, fuzzy, kde-format 7052 #| msgctxt "of October" 7053 #| msgid "of Oct" 7054 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7055 msgid "of Oct" 7056 msgstr "oktobra" 7057 7058 #: kdecore/kcalendarsystemjulian.cpp:223 7059 #, fuzzy, kde-format 7060 #| msgctxt "of November" 7061 #| msgid "of Nov" 7062 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7063 msgid "of Nov" 7064 msgstr "nowembra" 7065 7066 #: kdecore/kcalendarsystemjulian.cpp:225 7067 #, fuzzy, kde-format 7068 #| msgctxt "of December" 7069 #| msgid "of Dec" 7070 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7071 msgid "of Dec" 7072 msgstr "decembra" 7073 7074 #: kdecore/kcalendarsystemjulian.cpp:234 7075 #, fuzzy, kde-format 7076 #| msgctxt "January" 7077 #| msgid "Jan" 7078 msgctxt "Julian month 1 - KLocale::ShortName" 7079 msgid "Jan" 7080 msgstr "jan" 7081 7082 #: kdecore/kcalendarsystemjulian.cpp:236 7083 #, fuzzy, kde-format 7084 #| msgctxt "February" 7085 #| msgid "Feb" 7086 msgctxt "Julian month 2 - KLocale::ShortName" 7087 msgid "Feb" 7088 msgstr "feb" 7089 7090 #: kdecore/kcalendarsystemjulian.cpp:238 7091 #, fuzzy, kde-format 7092 #| msgctxt "March" 7093 #| msgid "Mar" 7094 msgctxt "Julian month 3 - KLocale::ShortName" 7095 msgid "Mar" 7096 msgstr "měr" 7097 7098 #: kdecore/kcalendarsystemjulian.cpp:240 7099 #, fuzzy, kde-format 7100 #| msgctxt "April" 7101 #| msgid "Apr" 7102 msgctxt "Julian month 4 - KLocale::ShortName" 7103 msgid "Apr" 7104 msgstr "apr" 7105 7106 #: kdecore/kcalendarsystemjulian.cpp:242 7107 #, fuzzy, kde-format 7108 #| msgctxt "May short" 7109 #| msgid "May" 7110 msgctxt "Julian month 5 - KLocale::ShortName" 7111 msgid "May" 7112 msgstr "mej" 7113 7114 #: kdecore/kcalendarsystemjulian.cpp:244 7115 #, fuzzy, kde-format 7116 #| msgctxt "June" 7117 #| msgid "Jun" 7118 msgctxt "Julian month 6 - KLocale::ShortName" 7119 msgid "Jun" 7120 msgstr "jun" 7121 7122 #: kdecore/kcalendarsystemjulian.cpp:246 7123 #, fuzzy, kde-format 7124 #| msgctxt "July" 7125 #| msgid "Jul" 7126 msgctxt "Julian month 7 - KLocale::ShortName" 7127 msgid "Jul" 7128 msgstr "jul" 7129 7130 #: kdecore/kcalendarsystemjulian.cpp:248 7131 #, fuzzy, kde-format 7132 #| msgctxt "August" 7133 #| msgid "Aug" 7134 msgctxt "Julian month 8 - KLocale::ShortName" 7135 msgid "Aug" 7136 msgstr "awg" 7137 7138 #: kdecore/kcalendarsystemjulian.cpp:250 7139 #, fuzzy, kde-format 7140 #| msgctxt "September" 7141 #| msgid "Sep" 7142 msgctxt "Julian month 9 - KLocale::ShortName" 7143 msgid "Sep" 7144 msgstr "sep" 7145 7146 #: kdecore/kcalendarsystemjulian.cpp:252 7147 #, fuzzy, kde-format 7148 #| msgctxt "October" 7149 #| msgid "Oct" 7150 msgctxt "Julian month 10 - KLocale::ShortName" 7151 msgid "Oct" 7152 msgstr "okt" 7153 7154 #: kdecore/kcalendarsystemjulian.cpp:254 7155 #, fuzzy, kde-format 7156 #| msgctxt "November" 7157 #| msgid "Nov" 7158 msgctxt "Julian month 11 - KLocale::ShortName" 7159 msgid "Nov" 7160 msgstr "now" 7161 7162 #: kdecore/kcalendarsystemjulian.cpp:256 7163 #, fuzzy, kde-format 7164 #| msgctxt "December" 7165 #| msgid "Dec" 7166 msgctxt "Julian month 12 - KLocale::ShortName" 7167 msgid "Dec" 7168 msgstr "dec" 7169 7170 #: kdecore/kcalendarsystemjulian.cpp:265 7171 #, fuzzy, kde-format 7172 #| msgid "of January" 7173 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7174 msgid "of January" 7175 msgstr "januara" 7176 7177 #: kdecore/kcalendarsystemjulian.cpp:267 7178 #, fuzzy, kde-format 7179 #| msgid "of February" 7180 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7181 msgid "of February" 7182 msgstr "februara" 7183 7184 #: kdecore/kcalendarsystemjulian.cpp:269 7185 #, fuzzy, kde-format 7186 #| msgid "of March" 7187 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7188 msgid "of March" 7189 msgstr "měrca" 7190 7191 #: kdecore/kcalendarsystemjulian.cpp:271 7192 #, fuzzy, kde-format 7193 #| msgid "of April" 7194 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7195 msgid "of April" 7196 msgstr "apryla" 7197 7198 #: kdecore/kcalendarsystemjulian.cpp:273 7199 #, fuzzy, kde-format 7200 #| msgctxt "of May short" 7201 #| msgid "of May" 7202 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7203 msgid "of May" 7204 msgstr "meje" 7205 7206 #: kdecore/kcalendarsystemjulian.cpp:275 7207 #, fuzzy, kde-format 7208 #| msgid "of June" 7209 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7210 msgid "of June" 7211 msgstr "junija" 7212 7213 #: kdecore/kcalendarsystemjulian.cpp:277 7214 #, fuzzy, kde-format 7215 #| msgid "of July" 7216 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7217 msgid "of July" 7218 msgstr "julija" 7219 7220 #: kdecore/kcalendarsystemjulian.cpp:279 7221 #, fuzzy, kde-format 7222 #| msgid "of August" 7223 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7224 msgid "of August" 7225 msgstr "awgusta" 7226 7227 #: kdecore/kcalendarsystemjulian.cpp:281 7228 #, fuzzy, kde-format 7229 #| msgid "of September" 7230 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7231 msgid "of September" 7232 msgstr "septembra" 7233 7234 #: kdecore/kcalendarsystemjulian.cpp:283 7235 #, fuzzy, kde-format 7236 #| msgid "of October" 7237 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7238 msgid "of October" 7239 msgstr "oktobra" 7240 7241 #: kdecore/kcalendarsystemjulian.cpp:285 7242 #, fuzzy, kde-format 7243 #| msgid "of November" 7244 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7245 msgid "of November" 7246 msgstr "nowembra" 7247 7248 #: kdecore/kcalendarsystemjulian.cpp:287 7249 #, fuzzy, kde-format 7250 #| msgid "of December" 7251 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7252 msgid "of December" 7253 msgstr "decembra" 7254 7255 #: kdecore/kcalendarsystemjulian.cpp:296 7256 #, fuzzy, kde-format 7257 #| msgid "January" 7258 msgctxt "Julian month 1 - KLocale::LongName" 7259 msgid "January" 7260 msgstr "januar" 7261 7262 #: kdecore/kcalendarsystemjulian.cpp:298 7263 #, fuzzy, kde-format 7264 #| msgid "February" 7265 msgctxt "Julian month 2 - KLocale::LongName" 7266 msgid "February" 7267 msgstr "februar" 7268 7269 #: kdecore/kcalendarsystemjulian.cpp:300 7270 #, fuzzy, kde-format 7271 #| msgctxt "March long" 7272 #| msgid "March" 7273 msgctxt "Julian month 3 - KLocale::LongName" 7274 msgid "March" 7275 msgstr "měrc" 7276 7277 #: kdecore/kcalendarsystemjulian.cpp:302 7278 #, fuzzy, kde-format 7279 #| msgid "April" 7280 msgctxt "Julian month 4 - KLocale::LongName" 7281 msgid "April" 7282 msgstr "apryl" 7283 7284 #: kdecore/kcalendarsystemjulian.cpp:304 7285 #, fuzzy, kde-format 7286 #| msgctxt "May short" 7287 #| msgid "May" 7288 msgctxt "Julian month 5 - KLocale::LongName" 7289 msgid "May" 7290 msgstr "mej" 7291 7292 #: kdecore/kcalendarsystemjulian.cpp:306 7293 #, fuzzy, kde-format 7294 #| msgid "June" 7295 msgctxt "Julian month 6 - KLocale::LongName" 7296 msgid "June" 7297 msgstr "junij" 7298 7299 #: kdecore/kcalendarsystemjulian.cpp:308 7300 #, fuzzy, kde-format 7301 #| msgid "July" 7302 msgctxt "Julian month 7 - KLocale::LongName" 7303 msgid "July" 7304 msgstr "julij" 7305 7306 #: kdecore/kcalendarsystemjulian.cpp:310 7307 #, fuzzy, kde-format 7308 #| msgctxt "August long" 7309 #| msgid "August" 7310 msgctxt "Julian month 8 - KLocale::LongName" 7311 msgid "August" 7312 msgstr "awgust" 7313 7314 #: kdecore/kcalendarsystemjulian.cpp:312 7315 #, fuzzy, kde-format 7316 #| msgid "September" 7317 msgctxt "Julian month 9 - KLocale::LongName" 7318 msgid "September" 7319 msgstr "september" 7320 7321 #: kdecore/kcalendarsystemjulian.cpp:314 7322 #, fuzzy, kde-format 7323 #| msgid "October" 7324 msgctxt "Julian month 10 - KLocale::LongName" 7325 msgid "October" 7326 msgstr "oktober" 7327 7328 #: kdecore/kcalendarsystemjulian.cpp:316 7329 #, fuzzy, kde-format 7330 #| msgid "November" 7331 msgctxt "Julian month 11 - KLocale::LongName" 7332 msgid "November" 7333 msgstr "nowember" 7334 7335 #: kdecore/kcalendarsystemjulian.cpp:318 7336 #, fuzzy, kde-format 7337 #| msgid "December" 7338 msgctxt "Julian month 12 - KLocale::LongName" 7339 msgid "December" 7340 msgstr "december" 7341 7342 #: kdecore/kcalendarsystemjulian.cpp:331 7343 #, kde-format 7344 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7345 msgid "M" 7346 msgstr "" 7347 7348 #: kdecore/kcalendarsystemjulian.cpp:333 7349 #, kde-format 7350 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7351 msgid "T" 7352 msgstr "" 7353 7354 #: kdecore/kcalendarsystemjulian.cpp:335 7355 #, kde-format 7356 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7357 msgid "W" 7358 msgstr "" 7359 7360 #: kdecore/kcalendarsystemjulian.cpp:337 7361 #, kde-format 7362 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7363 msgid "T" 7364 msgstr "" 7365 7366 #: kdecore/kcalendarsystemjulian.cpp:339 7367 #, kde-format 7368 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7369 msgid "F" 7370 msgstr "" 7371 7372 #: kdecore/kcalendarsystemjulian.cpp:341 7373 #, kde-format 7374 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7375 msgid "S" 7376 msgstr "" 7377 7378 #: kdecore/kcalendarsystemjulian.cpp:343 7379 #, kde-format 7380 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7381 msgid "S" 7382 msgstr "" 7383 7384 #: kdecore/kcalendarsystemjulian.cpp:352 7385 #, fuzzy, kde-format 7386 #| msgctxt "Monday" 7387 #| msgid "Mon" 7388 msgctxt "Julian weekday 1 - KLocale::ShortName" 7389 msgid "Mon" 7390 msgstr "Pó" 7391 7392 #: kdecore/kcalendarsystemjulian.cpp:354 7393 #, fuzzy, kde-format 7394 #| msgctxt "Tuesday" 7395 #| msgid "Tue" 7396 msgctxt "Julian weekday 2 - KLocale::ShortName" 7397 msgid "Tue" 7398 msgstr "Wu" 7399 7400 #: kdecore/kcalendarsystemjulian.cpp:356 7401 #, fuzzy, kde-format 7402 #| msgctxt "Wednesday" 7403 #| msgid "Wed" 7404 msgctxt "Julian weekday 3 - KLocale::ShortName" 7405 msgid "Wed" 7406 msgstr "Srj" 7407 7408 #: kdecore/kcalendarsystemjulian.cpp:358 7409 #, fuzzy, kde-format 7410 #| msgctxt "Thursday" 7411 #| msgid "Thu" 7412 msgctxt "Julian weekday 4 - KLocale::ShortName" 7413 msgid "Thu" 7414 msgstr "Štw" 7415 7416 #: kdecore/kcalendarsystemjulian.cpp:360 7417 #, fuzzy, kde-format 7418 #| msgctxt "Friday" 7419 #| msgid "Fri" 7420 msgctxt "Julian weekday 5 - KLocale::ShortName" 7421 msgid "Fri" 7422 msgstr "Pj" 7423 7424 #: kdecore/kcalendarsystemjulian.cpp:362 7425 #, fuzzy, kde-format 7426 #| msgctxt "Saturday" 7427 #| msgid "Sat" 7428 msgctxt "Julian weekday 6 - KLocale::ShortName" 7429 msgid "Sat" 7430 msgstr "So" 7431 7432 #: kdecore/kcalendarsystemjulian.cpp:364 7433 #, fuzzy, kde-format 7434 #| msgctxt "Sunday" 7435 #| msgid "Sun" 7436 msgctxt "Julian weekday 7 - KLocale::ShortName" 7437 msgid "Sun" 7438 msgstr "Nje" 7439 7440 #: kdecore/kcalendarsystemjulian.cpp:371 7441 #, fuzzy, kde-format 7442 #| msgid "Monday" 7443 msgctxt "Julian weekday 1 - KLocale::LongName" 7444 msgid "Monday" 7445 msgstr "Póndźela" 7446 7447 #: kdecore/kcalendarsystemjulian.cpp:373 7448 #, fuzzy, kde-format 7449 #| msgid "Tuesday" 7450 msgctxt "Julian weekday 2 - KLocale::LongName" 7451 msgid "Tuesday" 7452 msgstr "Wutora" 7453 7454 #: kdecore/kcalendarsystemjulian.cpp:375 7455 #, fuzzy, kde-format 7456 #| msgid "Wednesday" 7457 msgctxt "Julian weekday 3 - KLocale::LongName" 7458 msgid "Wednesday" 7459 msgstr "Srjeda" 7460 7461 #: kdecore/kcalendarsystemjulian.cpp:377 7462 #, fuzzy, kde-format 7463 #| msgid "Thursday" 7464 msgctxt "Julian weekday 4 - KLocale::LongName" 7465 msgid "Thursday" 7466 msgstr "Štwórtk" 7467 7468 #: kdecore/kcalendarsystemjulian.cpp:379 7469 #, fuzzy, kde-format 7470 #| msgid "Friday" 7471 msgctxt "Julian weekday 5 - KLocale::LongName" 7472 msgid "Friday" 7473 msgstr "Pjatk" 7474 7475 #: kdecore/kcalendarsystemjulian.cpp:381 7476 #, fuzzy, kde-format 7477 #| msgid "Saturday" 7478 msgctxt "Julian weekday 6 - KLocale::LongName" 7479 msgid "Saturday" 7480 msgstr "Sobota" 7481 7482 #: kdecore/kcalendarsystemjulian.cpp:383 7483 #, fuzzy, kde-format 7484 #| msgid "Sunday" 7485 msgctxt "Julian weekday 7 - KLocale::LongName" 7486 msgid "Sunday" 7487 msgstr "Njedźela" 7488 7489 #: kdecore/kcalendarsystemminguo.cpp:57 7490 #, kde-format 7491 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7492 msgid "Republic of China Era" 7493 msgstr "" 7494 7495 #: kdecore/kcalendarsystemminguo.cpp:58 7496 #, kde-format 7497 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7498 msgid "ROC" 7499 msgstr "" 7500 7501 #: kdecore/kcalendarsystemminguo.cpp:59 7502 #, kde-format 7503 msgctxt "" 7504 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7505 msgid "%EC %Ey" 7506 msgstr "" 7507 7508 #: kdecore/kcalendarsystemthai.cpp:58 7509 #, kde-format 7510 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7511 msgid "Buddhist Era" 7512 msgstr "" 7513 7514 #: kdecore/kcalendarsystemthai.cpp:59 7515 #, kde-format 7516 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7517 msgid "BE" 7518 msgstr "" 7519 7520 #: kdecore/kcalendarsystemthai.cpp:60 7521 #, kde-format 7522 msgctxt "" 7523 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7524 msgid "%Ey %EC" 7525 msgstr "" 7526 7527 #: kdecore/kcmdlineargs.cpp:278 7528 #, kde-format 7529 msgid "Use the X-server display 'displayname'" 7530 msgstr "Wužiwaj X-serverowy display 'mjeno displayja'." 7531 7532 #: kdecore/kcmdlineargs.cpp:281 7533 #, kde-format 7534 msgid "Restore the application for the given 'sessionId'" 7535 msgstr "Wuchowaj aplikaciju za daty identifikator sesije." 7536 7537 #: kdecore/kcmdlineargs.cpp:282 7538 #, kde-format 7539 msgid "" 7540 "Causes the application to install a private color\n" 7541 "map on an 8-bit display" 7542 msgstr "" 7543 "Praji aplikaciji, zo ma priwatne barby na 8-bitowym displayju instalować." 7544 7545 #: kdecore/kcmdlineargs.cpp:283 7546 #, kde-format 7547 msgid "" 7548 "Limits the number of colors allocated in the color\n" 7549 "cube on an 8-bit display, if the application is\n" 7550 "using the QApplication::ManyColor color\n" 7551 "specification" 7552 msgstr "" 7553 "Wobmjezuje ličbu barbow, alocěrowanych w barbowym kubusu\n" 7554 "na 8-bitowym displayju, jeli program wužiwa barbowu specifikaciju\n" 7555 "QApplication::ManyColor." 7556 7557 #: kdecore/kcmdlineargs.cpp:284 7558 #, kde-format 7559 msgid "tells Qt to never grab the mouse or the keyboard" 7560 msgstr "praji Qt, zo nima ženje ani myšku ani tastaturu njeblokować." 7561 7562 #: kdecore/kcmdlineargs.cpp:285 7563 #, kde-format 7564 msgid "" 7565 "running under a debugger can cause an implicit\n" 7566 "-nograb, use -dograb to override" 7567 msgstr "" 7568 "w debuggeru móže implicitny -nograb nastać,\n" 7569 "wužiwaj potom -dograb." 7570 7571 #: kdecore/kcmdlineargs.cpp:286 7572 #, kde-format 7573 msgid "switches to synchronous mode for debugging" 7574 msgstr "přešaltuje do synchroniskeho modusa za debugging." 7575 7576 #: kdecore/kcmdlineargs.cpp:288 7577 #, kde-format 7578 msgid "defines the application font" 7579 msgstr "definuje pismo programa." 7580 7581 #: kdecore/kcmdlineargs.cpp:290 7582 #, kde-format 7583 msgid "" 7584 "sets the default background color and an\n" 7585 "application palette (light and dark shades are\n" 7586 "calculated)" 7587 msgstr "" 7588 "postaji standardowu pozadkowu barbu a\n" 7589 "paletu (ćmowe a swětłe wotsćiny so wobličuja)." 7590 7591 #: kdecore/kcmdlineargs.cpp:292 7592 #, kde-format 7593 msgid "sets the default foreground color" 7594 msgstr "postaji standardowu pismowu barbu." 7595 7596 #: kdecore/kcmdlineargs.cpp:294 7597 #, kde-format 7598 msgid "sets the default button color" 7599 msgstr "postaji standardowu kneflowu barbu." 7600 7601 #: kdecore/kcmdlineargs.cpp:295 7602 #, kde-format 7603 msgid "sets the application name" 7604 msgstr "postaji mjeno programa." 7605 7606 #: kdecore/kcmdlineargs.cpp:296 7607 #, kde-format 7608 msgid "sets the application title (caption)" 7609 msgstr "postaji titl programa." 7610 7611 #: kdecore/kcmdlineargs.cpp:297 7612 #, kde-format 7613 msgid "load the testability framework" 7614 msgstr "" 7615 7616 #: kdecore/kcmdlineargs.cpp:299 7617 #, kde-format 7618 msgid "" 7619 "forces the application to use a TrueColor visual on\n" 7620 "an 8-bit display" 7621 msgstr "" 7622 "nuzuje program k wužiwanju TrueColor visual\n" 7623 "na 8-bitowym displayju." 7624 7625 #: kdecore/kcmdlineargs.cpp:300 7626 #, kde-format 7627 msgid "" 7628 "sets XIM (X Input Method) input style. Possible\n" 7629 "values are onthespot, overthespot, offthespot and\n" 7630 "root" 7631 msgstr "" 7632 "postaji zapodawanski stil XIM (X Input Method). Móžne hódnoty\n" 7633 "su onthespot, overthespot, offthespot a root." 7634 7635 #: kdecore/kcmdlineargs.cpp:301 7636 #, kde-format 7637 msgid "set XIM server" 7638 msgstr "postaji XIM-server." 7639 7640 #: kdecore/kcmdlineargs.cpp:302 7641 #, kde-format 7642 msgid "disable XIM" 7643 msgstr "hasnje XIM." 7644 7645 #: kdecore/kcmdlineargs.cpp:304 7646 #, kde-format 7647 msgid "mirrors the whole layout of widgets" 7648 msgstr "špiheluje cyły arrangement elementow." 7649 7650 #: kdecore/kcmdlineargs.cpp:305 7651 #, kde-format 7652 msgid "applies the Qt stylesheet to the application widgets" 7653 msgstr "nałoži Qt-stylesheet na widgety aplikacije" 7654 7655 #: kdecore/kcmdlineargs.cpp:306 7656 #, kde-format 7657 msgid "" 7658 "use a different graphics system instead of the default one, options are " 7659 "raster and opengl (experimental)" 7660 msgstr "" 7661 7662 #: kdecore/kcmdlineargs.cpp:307 7663 #, kde-format 7664 msgid "" 7665 "QML JS debugger information. Application must be\n" 7666 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7667 "enabled" 7668 msgstr "" 7669 7670 #: kdecore/kcmdlineargs.cpp:308 7671 #, kde-format 7672 msgid "The windowing system platform (e.g. xcb or wayland)" 7673 msgstr "" 7674 7675 #: kdecore/kcmdlineargs.cpp:310 7676 #, kde-format 7677 msgid "Use 'caption' as name in the titlebar" 7678 msgstr "Wužiwaj 'titl' jako mjeno w titlowym pasku wokna." 7679 7680 #: kdecore/kcmdlineargs.cpp:311 7681 #, kde-format 7682 msgid "Use 'icon' as the application icon" 7683 msgstr "Wužiwaj 'piktogram' jako piktogram za program." 7684 7685 #: kdecore/kcmdlineargs.cpp:312 7686 #, kde-format 7687 msgid "Use alternative configuration file" 7688 msgstr "Wužiwaj hinašu konfiguracisku dataju." 7689 7690 #: kdecore/kcmdlineargs.cpp:313 7691 #, kde-format 7692 msgid "Disable crash handler, to get core dumps" 7693 msgstr "Crash handler hasnyć, zo by core dump dóstał." 7694 7695 #: kdecore/kcmdlineargs.cpp:315 7696 #, kde-format 7697 msgid "Waits for a WM_NET compatible windowmanager" 7698 msgstr "Čaka na WM_NET-kompatibelny woknowy manager." 7699 7700 #: kdecore/kcmdlineargs.cpp:317 7701 #, kde-format 7702 msgid "sets the application GUI style" 7703 msgstr "postaji GUI-stil programa." 7704 7705 #: kdecore/kcmdlineargs.cpp:318 7706 #, fuzzy, kde-format 7707 #| msgid "" 7708 #| "sets the client geometry of the main widget - see man X for the argument " 7709 #| "format" 7710 msgid "" 7711 "sets the client geometry of the main widget - see man X for the argument " 7712 "format (usually WidthxHeight+XPos+YPos)" 7713 msgstr "" 7714 "postaji geometriju hłowneho elementa wotwisneho programa - hlejće \"man X\" " 7715 "dla formata argumenta" 7716 7717 #: kdecore/kcmdlineargs.cpp:436 7718 #, kde-format 7719 msgid "KDE Application" 7720 msgstr "KDE-aplikacija " 7721 7722 #: kdecore/kcmdlineargs.cpp:497 7723 #, kde-format 7724 msgid "Qt" 7725 msgstr "Qt" 7726 7727 #: kdecore/kcmdlineargs.cpp:500 7728 #, kde-format 7729 msgid "KDE" 7730 msgstr "KDE" 7731 7732 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7733 #, fuzzy, kde-format 7734 #| msgid "ERROR: Unknown protocol '%1'" 7735 msgid "Unknown option '%1'." 7736 msgstr "ZMYLK: Njeznaty protokol '%1'" 7737 7738 #: kdecore/kcmdlineargs.cpp:841 7739 #, kde-format 7740 msgctxt "@info:shell %1 is cmdoption name" 7741 msgid "'%1' missing." 7742 msgstr "'%1' faluje." 7743 7744 #: kdecore/kcmdlineargs.cpp:895 7745 #, kde-format 7746 msgctxt "" 7747 "@info:shell message on appcmd --version; do not translate 'Development " 7748 "Platform'%3 application name, other %n version strings" 7749 msgid "" 7750 "Qt: %1\n" 7751 "KDE Frameworks: %2\n" 7752 "%3: %4\n" 7753 msgstr "" 7754 7755 #: kdecore/kcmdlineargs.cpp:921 7756 #, kde-format 7757 msgctxt "the 2nd argument is a list of name+address, one on each line" 7758 msgid "" 7759 "%1 was written by\n" 7760 "%2" 7761 msgstr "" 7762 "%1 bu napisane wot\n" 7763 "%2" 7764 7765 #: kdecore/kcmdlineargs.cpp:924 7766 #, kde-format 7767 msgid "This application was written by somebody who wants to remain anonymous." 7768 msgstr "" 7769 7770 #: kdecore/kcmdlineargs.cpp:929 7771 #, kde-format 7772 msgid "Please use http://bugs.kde.org to report bugs.\n" 7773 msgstr "" 7774 7775 #: kdecore/kcmdlineargs.cpp:931 7776 #, kde-format 7777 msgid "Please report bugs to %1.\n" 7778 msgstr "" 7779 7780 #: kdecore/kcmdlineargs.cpp:961 7781 #, kde-format 7782 msgid "Unexpected argument '%1'." 7783 msgstr "" 7784 7785 #: kdecore/kcmdlineargs.cpp:1074 7786 #, kde-format 7787 msgid "Use --help to get a list of available command line options." 7788 msgstr "" 7789 7790 #: kdecore/kcmdlineargs.cpp:1096 7791 #, kde-format 7792 msgid "[options] " 7793 msgstr "" 7794 7795 #: kdecore/kcmdlineargs.cpp:1101 7796 #, kde-format 7797 msgid "[%1-options]" 7798 msgstr "" 7799 7800 #: kdecore/kcmdlineargs.cpp:1122 7801 #, kde-format 7802 msgid "Usage: %1 %2\n" 7803 msgstr "" 7804 7805 #: kdecore/kcmdlineargs.cpp:1125 7806 #, kde-format 7807 msgid "" 7808 "\n" 7809 "Generic options:\n" 7810 msgstr "" 7811 7812 #: kdecore/kcmdlineargs.cpp:1127 7813 #, kde-format 7814 msgid "Show help about options" 7815 msgstr "" 7816 7817 #: kdecore/kcmdlineargs.cpp:1133 7818 #, kde-format 7819 msgid "Show %1 specific options" 7820 msgstr "" 7821 7822 #: kdecore/kcmdlineargs.cpp:1140 7823 #, kde-format 7824 msgid "Show all options" 7825 msgstr "" 7826 7827 #: kdecore/kcmdlineargs.cpp:1141 7828 #, kde-format 7829 msgid "Show author information" 7830 msgstr "" 7831 7832 #: kdecore/kcmdlineargs.cpp:1142 7833 #, kde-format 7834 msgid "Show version information" 7835 msgstr "" 7836 7837 #: kdecore/kcmdlineargs.cpp:1143 7838 #, kde-format 7839 msgid "Show license information" 7840 msgstr "" 7841 7842 #: kdecore/kcmdlineargs.cpp:1144 7843 #, kde-format 7844 msgid "End of options" 7845 msgstr "" 7846 7847 #: kdecore/kcmdlineargs.cpp:1164 7848 #, kde-format 7849 msgid "" 7850 "\n" 7851 "%1 options:\n" 7852 msgstr "" 7853 7854 #: kdecore/kcmdlineargs.cpp:1166 7855 #, kde-format 7856 msgid "" 7857 "\n" 7858 "Options:\n" 7859 msgstr "" 7860 7861 #: kdecore/kcmdlineargs.cpp:1219 7862 #, kde-format 7863 msgid "" 7864 "\n" 7865 "Arguments:\n" 7866 msgstr "" 7867 7868 #: kdecore/kcmdlineargs.cpp:1580 7869 #, kde-format 7870 msgid "The files/URLs opened by the application will be deleted after use" 7871 msgstr "Dataje/URL, kiž je aplikacija wočiniła, so po wužiwanju zniča" 7872 7873 #: kdecore/kcmdlineargs.cpp:1581 7874 #, kde-format 7875 msgid "KDE-tempfile" 7876 msgstr "KDE-temporarna dataja" 7877 7878 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7879 #: kdecore/kdatetime.cpp:2985 7880 #, fuzzy, kde-format 7881 msgid "am" 7882 msgstr "rano" 7883 7884 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7885 #: kdecore/kdatetime.cpp:2990 7886 #, kde-format 7887 msgid "pm" 7888 msgstr "popołdnju" 7889 7890 #: kdecore/klibloader.cpp:100 7891 #, kde-format 7892 msgid "Library \"%1\" not found" 7893 msgstr "Njejsym biblioteku namakał: \"%1\"" 7894 7895 #: kdecore/klocale_kde.cpp:785 7896 #, fuzzy, kde-format 7897 #| msgctxt "@item Text character set" 7898 #| msgid "Arabic" 7899 msgctxt "digit set" 7900 msgid "Arabic-Indic" 7901 msgstr "Arabske" 7902 7903 #: kdecore/klocale_kde.cpp:788 7904 #, fuzzy, kde-format 7905 #| msgctxt "KCharselect unicode block name" 7906 #| msgid "Bengali" 7907 msgctxt "digit set" 7908 msgid "Bengali" 7909 msgstr "Bengali" 7910 7911 #: kdecore/klocale_kde.cpp:791 7912 #, fuzzy, kde-format 7913 #| msgctxt "KCharselect unicode block name" 7914 #| msgid "Devanagari" 7915 msgctxt "digit set" 7916 msgid "Devanagari" 7917 msgstr "Devanagari" 7918 7919 #: kdecore/klocale_kde.cpp:794 7920 #, kde-format 7921 msgctxt "digit set" 7922 msgid "Eastern Arabic-Indic" 7923 msgstr "" 7924 7925 #: kdecore/klocale_kde.cpp:797 7926 #, fuzzy, kde-format 7927 #| msgctxt "KCharselect unicode block name" 7928 #| msgid "Gujarati" 7929 msgctxt "digit set" 7930 msgid "Gujarati" 7931 msgstr "Gujarati" 7932 7933 #: kdecore/klocale_kde.cpp:800 7934 #, fuzzy, kde-format 7935 #| msgctxt "KCharselect unicode block name" 7936 #| msgid "Gurmukhi" 7937 msgctxt "digit set" 7938 msgid "Gurmukhi" 7939 msgstr "Gurmukhi" 7940 7941 #: kdecore/klocale_kde.cpp:803 7942 #, fuzzy, kde-format 7943 #| msgctxt "KCharselect unicode block name" 7944 #| msgid "Kannada" 7945 msgctxt "digit set" 7946 msgid "Kannada" 7947 msgstr "Kannada" 7948 7949 #: kdecore/klocale_kde.cpp:806 7950 #, fuzzy, kde-format 7951 #| msgctxt "KCharselect unicode block name" 7952 #| msgid "Khmer" 7953 msgctxt "digit set" 7954 msgid "Khmer" 7955 msgstr "Khmer" 7956 7957 #: kdecore/klocale_kde.cpp:809 7958 #, fuzzy, kde-format 7959 #| msgctxt "KCharselect unicode block name" 7960 #| msgid "Malayalam" 7961 msgctxt "digit set" 7962 msgid "Malayalam" 7963 msgstr "Malayalam" 7964 7965 #: kdecore/klocale_kde.cpp:812 7966 #, fuzzy, kde-format 7967 #| msgctxt "KCharselect unicode block name" 7968 #| msgid "Oriya" 7969 msgctxt "digit set" 7970 msgid "Oriya" 7971 msgstr "Oriya" 7972 7973 #: kdecore/klocale_kde.cpp:815 7974 #, fuzzy, kde-format 7975 #| msgctxt "KCharselect unicode block name" 7976 #| msgid "Tamil" 7977 msgctxt "digit set" 7978 msgid "Tamil" 7979 msgstr "Tamil" 7980 7981 #: kdecore/klocale_kde.cpp:818 7982 #, fuzzy, kde-format 7983 #| msgctxt "KCharselect unicode block name" 7984 #| msgid "Telugu" 7985 msgctxt "digit set" 7986 msgid "Telugu" 7987 msgstr "Telugu" 7988 7989 #: kdecore/klocale_kde.cpp:821 7990 #, fuzzy, kde-format 7991 #| msgid "R. Thaani" 7992 msgctxt "digit set" 7993 msgid "Thai" 7994 msgstr "R. Thaani" 7995 7996 #: kdecore/klocale_kde.cpp:824 7997 #, fuzzy, kde-format 7998 #| msgctxt "@item Text character set" 7999 #| msgid "Arabic" 8000 msgctxt "digit set" 8001 msgid "Arabic" 8002 msgstr "Arabske" 8003 8004 #: kdecore/klocale_kde.cpp:829 8005 #, fuzzy, kde-format 8006 #| msgctxt "dictionary name. %1-language and %2-country name" 8007 #| msgid "%1 (%2)" 8008 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8009 msgid "%1 (%2)" 8010 msgstr "%1 (%2)" 8011 8012 #. i18n: comments below, they are used by the 8013 #. translators. 8014 #. This prefix is shared by all current dialects. 8015 #. i18n: Dumb message, avoid any markup or scripting. 8016 #: kdecore/klocale_kde.cpp:1327 8017 #, fuzzy, kde-format 8018 #| msgid "%1 B" 8019 msgctxt "size in bytes" 8020 msgid "%1 B" 8021 msgstr "%1 B" 8022 8023 #. i18n: Dumb message, avoid any markup or scripting. 8024 #: kdecore/klocale_kde.cpp:1332 8025 #, fuzzy, kde-format 8026 #| msgid "%1 B" 8027 msgctxt "size in 1000 bytes" 8028 msgid "%1 kB" 8029 msgstr "%1 B" 8030 8031 #. i18n: Dumb message, avoid any markup or scripting. 8032 #: kdecore/klocale_kde.cpp:1334 8033 #, fuzzy, kde-format 8034 #| msgid "%1 MiB" 8035 msgctxt "size in 10^6 bytes" 8036 msgid "%1 MB" 8037 msgstr "%1 MiB" 8038 8039 #. i18n: Dumb message, avoid any markup or scripting. 8040 #: kdecore/klocale_kde.cpp:1336 8041 #, fuzzy, kde-format 8042 #| msgid "%1 GiB" 8043 msgctxt "size in 10^9 bytes" 8044 msgid "%1 GB" 8045 msgstr "%1 GiB" 8046 8047 #. i18n: Dumb message, avoid any markup or scripting. 8048 #: kdecore/klocale_kde.cpp:1338 8049 #, fuzzy, kde-format 8050 #| msgid "%1 TiB" 8051 msgctxt "size in 10^12 bytes" 8052 msgid "%1 TB" 8053 msgstr "%1 TiB" 8054 8055 #. i18n: Dumb message, avoid any markup or scripting. 8056 #: kdecore/klocale_kde.cpp:1340 8057 #, fuzzy, kde-format 8058 #| msgid "%1 B" 8059 msgctxt "size in 10^15 bytes" 8060 msgid "%1 PB" 8061 msgstr "%1 B" 8062 8063 #. i18n: Dumb message, avoid any markup or scripting. 8064 #: kdecore/klocale_kde.cpp:1342 8065 #, fuzzy, kde-format 8066 #| msgid "%1 B" 8067 msgctxt "size in 10^18 bytes" 8068 msgid "%1 EB" 8069 msgstr "%1 B" 8070 8071 #. i18n: Dumb message, avoid any markup or scripting. 8072 #: kdecore/klocale_kde.cpp:1344 8073 #, fuzzy, kde-format 8074 #| msgid "%1 B" 8075 msgctxt "size in 10^21 bytes" 8076 msgid "%1 ZB" 8077 msgstr "%1 B" 8078 8079 #. i18n: Dumb message, avoid any markup or scripting. 8080 #: kdecore/klocale_kde.cpp:1346 8081 #, fuzzy, kde-format 8082 #| msgid "%1 B" 8083 msgctxt "size in 10^24 bytes" 8084 msgid "%1 YB" 8085 msgstr "%1 B" 8086 8087 #. i18n: Dumb message, avoid any markup or scripting. 8088 #: kdecore/klocale_kde.cpp:1351 8089 #, fuzzy, kde-format 8090 #| msgid "%1 KiB" 8091 msgctxt "memory size in 1024 bytes" 8092 msgid "%1 KB" 8093 msgstr "%1 KiB" 8094 8095 #. i18n: Dumb message, avoid any markup or scripting. 8096 #: kdecore/klocale_kde.cpp:1353 8097 #, fuzzy, kde-format 8098 #| msgid "%1 MiB" 8099 msgctxt "memory size in 2^20 bytes" 8100 msgid "%1 MB" 8101 msgstr "%1 MiB" 8102 8103 #. i18n: Dumb message, avoid any markup or scripting. 8104 #: kdecore/klocale_kde.cpp:1355 8105 #, fuzzy, kde-format 8106 #| msgid "%1 GiB" 8107 msgctxt "memory size in 2^30 bytes" 8108 msgid "%1 GB" 8109 msgstr "%1 GiB" 8110 8111 #. i18n: Dumb message, avoid any markup or scripting. 8112 #: kdecore/klocale_kde.cpp:1357 8113 #, fuzzy, kde-format 8114 #| msgid "%1 TiB" 8115 msgctxt "memory size in 2^40 bytes" 8116 msgid "%1 TB" 8117 msgstr "%1 TiB" 8118 8119 #. i18n: Dumb message, avoid any markup or scripting. 8120 #: kdecore/klocale_kde.cpp:1359 8121 #, fuzzy, kde-format 8122 #| msgid "%1 B" 8123 msgctxt "memory size in 2^50 bytes" 8124 msgid "%1 PB" 8125 msgstr "%1 B" 8126 8127 #. i18n: Dumb message, avoid any markup or scripting. 8128 #: kdecore/klocale_kde.cpp:1361 8129 #, fuzzy, kde-format 8130 #| msgid "%1 B" 8131 msgctxt "memory size in 2^60 bytes" 8132 msgid "%1 EB" 8133 msgstr "%1 B" 8134 8135 #. i18n: Dumb message, avoid any markup or scripting. 8136 #: kdecore/klocale_kde.cpp:1363 8137 #, fuzzy, kde-format 8138 #| msgid "%1 B" 8139 msgctxt "memory size in 2^70 bytes" 8140 msgid "%1 ZB" 8141 msgstr "%1 B" 8142 8143 #. i18n: Dumb message, avoid any markup or scripting. 8144 #: kdecore/klocale_kde.cpp:1365 8145 #, fuzzy, kde-format 8146 #| msgid "%1 B" 8147 msgctxt "memory size in 2^80 bytes" 8148 msgid "%1 YB" 8149 msgstr "%1 B" 8150 8151 #. i18n: Dumb message, avoid any markup or scripting. 8152 #: kdecore/klocale_kde.cpp:1371 8153 #, fuzzy, kde-format 8154 #| msgid "%1 KiB" 8155 msgctxt "size in 1024 bytes" 8156 msgid "%1 KiB" 8157 msgstr "%1 KiB" 8158 8159 #. i18n: Dumb message, avoid any markup or scripting. 8160 #: kdecore/klocale_kde.cpp:1373 8161 #, fuzzy, kde-format 8162 #| msgid "%1 MiB" 8163 msgctxt "size in 2^20 bytes" 8164 msgid "%1 MiB" 8165 msgstr "%1 MiB" 8166 8167 #. i18n: Dumb message, avoid any markup or scripting. 8168 #: kdecore/klocale_kde.cpp:1375 8169 #, fuzzy, kde-format 8170 #| msgid "%1 GiB" 8171 msgctxt "size in 2^30 bytes" 8172 msgid "%1 GiB" 8173 msgstr "%1 GiB" 8174 8175 #. i18n: Dumb message, avoid any markup or scripting. 8176 #: kdecore/klocale_kde.cpp:1377 8177 #, fuzzy, kde-format 8178 #| msgid "%1 TiB" 8179 msgctxt "size in 2^40 bytes" 8180 msgid "%1 TiB" 8181 msgstr "%1 TiB" 8182 8183 #. i18n: Dumb message, avoid any markup or scripting. 8184 #: kdecore/klocale_kde.cpp:1379 8185 #, fuzzy, kde-format 8186 #| msgid "%1 TiB" 8187 msgctxt "size in 2^50 bytes" 8188 msgid "%1 PiB" 8189 msgstr "%1 TiB" 8190 8191 #. i18n: Dumb message, avoid any markup or scripting. 8192 #: kdecore/klocale_kde.cpp:1381 8193 #, fuzzy, kde-format 8194 #| msgid "%1 TiB" 8195 msgctxt "size in 2^60 bytes" 8196 msgid "%1 EiB" 8197 msgstr "%1 TiB" 8198 8199 #. i18n: Dumb message, avoid any markup or scripting. 8200 #: kdecore/klocale_kde.cpp:1383 8201 #, fuzzy, kde-format 8202 #| msgid "%1 TiB" 8203 msgctxt "size in 2^70 bytes" 8204 msgid "%1 ZiB" 8205 msgstr "%1 TiB" 8206 8207 #. i18n: Dumb message, avoid any markup or scripting. 8208 #: kdecore/klocale_kde.cpp:1385 8209 #, fuzzy, kde-format 8210 #| msgid "%1 TiB" 8211 msgctxt "size in 2^80 bytes" 8212 msgid "%1 YiB" 8213 msgstr "%1 TiB" 8214 8215 #: kdecore/klocale_kde.cpp:1472 8216 #, fuzzy, kde-format 8217 #| msgid "%1 days" 8218 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8219 msgid "%1 days" 8220 msgstr "%1 dnjow" 8221 8222 #: kdecore/klocale_kde.cpp:1475 8223 #, fuzzy, kde-format 8224 #| msgid "%1 hours" 8225 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8226 msgid "%1 hours" 8227 msgstr "%1 hodźin" 8228 8229 #: kdecore/klocale_kde.cpp:1478 8230 #, fuzzy, kde-format 8231 #| msgid "%1 minutes" 8232 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8233 msgid "%1 minutes" 8234 msgstr "%1 mjeńšin" 8235 8236 #: kdecore/klocale_kde.cpp:1481 8237 #, fuzzy, kde-format 8238 #| msgid "%1 seconds" 8239 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8240 msgid "%1 seconds" 8241 msgstr "%1 sekundow" 8242 8243 #: kdecore/klocale_kde.cpp:1484 8244 #, kde-format 8245 msgctxt "@item:intext" 8246 msgid "%1 millisecond" 8247 msgid_plural "%1 milliseconds" 8248 msgstr[0] "" 8249 msgstr[1] "" 8250 msgstr[2] "" 8251 msgstr[3] "" 8252 8253 #: kdecore/klocale_kde.cpp:1491 8254 #, kde-format 8255 msgctxt "@item:intext" 8256 msgid "1 day" 8257 msgid_plural "%1 days" 8258 msgstr[0] "" 8259 msgstr[1] "" 8260 msgstr[2] "" 8261 msgstr[3] "" 8262 8263 #: kdecore/klocale_kde.cpp:1493 8264 #, kde-format 8265 msgctxt "@item:intext" 8266 msgid "1 hour" 8267 msgid_plural "%1 hours" 8268 msgstr[0] "" 8269 msgstr[1] "" 8270 msgstr[2] "" 8271 msgstr[3] "" 8272 8273 #: kdecore/klocale_kde.cpp:1495 8274 #, kde-format 8275 msgctxt "@item:intext" 8276 msgid "1 minute" 8277 msgid_plural "%1 minutes" 8278 msgstr[0] "" 8279 msgstr[1] "" 8280 msgstr[2] "" 8281 msgstr[3] "" 8282 8283 #: kdecore/klocale_kde.cpp:1497 8284 #, kde-format 8285 msgctxt "@item:intext" 8286 msgid "1 second" 8287 msgid_plural "%1 seconds" 8288 msgstr[0] "" 8289 msgstr[1] "" 8290 msgstr[2] "" 8291 msgstr[3] "" 8292 8293 #: kdecore/klocale_kde.cpp:1521 8294 #, kde-format 8295 msgctxt "" 8296 "@item:intext days and hours. This uses the previous item:intext messages. If " 8297 "this does not fit the grammar of your language please contact the i18n team " 8298 "to solve the problem" 8299 msgid "%1 and %2" 8300 msgstr "%1 a %2" 8301 8302 #: kdecore/klocale_kde.cpp:1527 8303 #, kde-format 8304 msgctxt "" 8305 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8306 "If this does not fit the grammar of your language please contact the i18n " 8307 "team to solve the problem" 8308 msgid "%1 and %2" 8309 msgstr "%1 a %2" 8310 8311 #: kdecore/klocale_kde.cpp:1534 8312 #, kde-format 8313 msgctxt "" 8314 "@item:intext minutes and seconds. This uses the previous item:intext " 8315 "messages. If this does not fit the grammar of your language please contact " 8316 "the i18n team to solve the problem" 8317 msgid "%1 and %2" 8318 msgstr "%1 a %2" 8319 8320 #: kdecore/klocale_kde.cpp:2153 8321 #, kde-format 8322 msgctxt "Before Noon KLocale::LongName" 8323 msgid "Ante Meridiem" 8324 msgstr "" 8325 8326 #: kdecore/klocale_kde.cpp:2154 8327 #, fuzzy, kde-format 8328 #| msgid "Av" 8329 msgctxt "Before Noon KLocale::ShortName" 8330 msgid "AM" 8331 msgstr "Av" 8332 8333 #: kdecore/klocale_kde.cpp:2155 8334 #, fuzzy, kde-format 8335 #| msgid "Av" 8336 msgctxt "Before Noon KLocale::NarrowName" 8337 msgid "A" 8338 msgstr "Av" 8339 8340 #: kdecore/klocale_kde.cpp:2158 8341 #, kde-format 8342 msgctxt "After Noon KLocale::LongName" 8343 msgid "Post Meridiem" 8344 msgstr "" 8345 8346 #: kdecore/klocale_kde.cpp:2159 8347 #, kde-format 8348 msgctxt "After Noon KLocale::ShortName" 8349 msgid "PM" 8350 msgstr "" 8351 8352 #: kdecore/klocale_kde.cpp:2160 8353 #, kde-format 8354 msgctxt "After Noon KLocale::NarrowName" 8355 msgid "P" 8356 msgstr "" 8357 8358 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8359 #, kde-format 8360 msgctxt "concatenation of dates and time" 8361 msgid "%1 %2" 8362 msgstr "%1%2" 8363 8364 #: kdecore/klocale_kde.cpp:2267 8365 #, kde-format 8366 msgctxt "concatenation of date/time and time zone" 8367 msgid "%1 %2" 8368 msgstr "%1 %2" 8369 8370 #: kdecore/ksavefile.cpp:99 8371 #, kde-format 8372 msgid "No target filename has been given." 8373 msgstr "" 8374 8375 #: kdecore/ksavefile.cpp:106 8376 #, kde-format 8377 msgid "Already opened." 8378 msgstr "" 8379 8380 #: kdecore/ksavefile.cpp:135 8381 #, kde-format 8382 msgid "Insufficient permissions in target directory." 8383 msgstr "" 8384 8385 #: kdecore/ksavefile.cpp:139 8386 #, kde-format 8387 msgid "Unable to open temporary file." 8388 msgstr "" 8389 8390 #: kdecore/ksavefile.cpp:249 8391 #, kde-format 8392 msgid "Synchronization to disk failed" 8393 msgstr "" 8394 8395 #: kdecore/ksavefile.cpp:280 8396 #, kde-format 8397 msgid "Error during rename." 8398 msgstr "" 8399 8400 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8401 #, kde-format 8402 msgid "Timed out trying to connect to remote host" 8403 msgstr "Čas překročeny při kontaktowanju serwera" 8404 8405 #: kdecore/netsupp.cpp:866 8406 #, kde-format 8407 msgid "address family for nodename not supported" 8408 msgstr "adresowa swójba za suk njepodpěrowany" 8409 8410 #: kdecore/netsupp.cpp:868 8411 #, kde-format 8412 msgid "invalid value for 'ai_flags'" 8413 msgstr "njedowolena hódnota za 'ai_flags'" 8414 8415 #: kdecore/netsupp.cpp:870 8416 #, kde-format 8417 msgid "'ai_family' not supported" 8418 msgstr "'ai_family' njepodpěrane" 8419 8420 #: kdecore/netsupp.cpp:872 8421 #, kde-format 8422 msgid "no address associated with nodename" 8423 msgstr "žana adresa k mjenu tutoho suka njesłuša" 8424 8425 #: kdecore/netsupp.cpp:874 8426 #, kde-format 8427 msgid "servname not supported for ai_socktype" 8428 msgstr "servname njepodpěrany za ai_socktype" 8429 8430 #: kdecore/netsupp.cpp:875 8431 #, kde-format 8432 msgid "'ai_socktype' not supported" 8433 msgstr "'ai_socktype' njepodpěrany" 8434 8435 #: kdecore/netsupp.cpp:876 8436 #, kde-format 8437 msgid "system error" 8438 msgstr "systemowy zmylk" 8439 8440 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8441 #, kde-format 8442 msgid "KDE Test Program" 8443 msgstr "KDE testowy program" 8444 8445 #: kdecore/TIMEZONES:1 8446 #, kde-format 8447 msgid "Africa/Abidjan" 8448 msgstr "" 8449 8450 #: kdecore/TIMEZONES:2 8451 #, kde-format 8452 msgid "Africa/Accra" 8453 msgstr "" 8454 8455 #: kdecore/TIMEZONES:3 8456 #, kde-format 8457 msgid "Africa/Addis_Ababa" 8458 msgstr "" 8459 8460 #: kdecore/TIMEZONES:4 8461 #, kde-format 8462 msgid "Africa/Algiers" 8463 msgstr "" 8464 8465 #: kdecore/TIMEZONES:5 8466 #, kde-format 8467 msgid "Africa/Asmara" 8468 msgstr "" 8469 8470 #: kdecore/TIMEZONES:6 8471 #, kde-format 8472 msgid "Africa/Asmera" 8473 msgstr "" 8474 8475 #: kdecore/TIMEZONES:7 8476 #, kde-format 8477 msgid "Africa/Bamako" 8478 msgstr "" 8479 8480 #: kdecore/TIMEZONES:8 8481 #, kde-format 8482 msgid "Africa/Bangui" 8483 msgstr "" 8484 8485 #: kdecore/TIMEZONES:9 8486 #, kde-format 8487 msgid "Africa/Banjul" 8488 msgstr "" 8489 8490 #: kdecore/TIMEZONES:10 8491 #, kde-format 8492 msgid "Africa/Bissau" 8493 msgstr "" 8494 8495 #: kdecore/TIMEZONES:11 8496 #, kde-format 8497 msgid "Africa/Blantyre" 8498 msgstr "" 8499 8500 #: kdecore/TIMEZONES:12 8501 #, kde-format 8502 msgid "Africa/Brazzaville" 8503 msgstr "" 8504 8505 #: kdecore/TIMEZONES:13 8506 #, kde-format 8507 msgid "Africa/Bujumbura" 8508 msgstr "" 8509 8510 #: kdecore/TIMEZONES:14 8511 #, kde-format 8512 msgid "Africa/Cairo" 8513 msgstr "" 8514 8515 #: kdecore/TIMEZONES:15 8516 #, kde-format 8517 msgid "Africa/Casablanca" 8518 msgstr "" 8519 8520 #: kdecore/TIMEZONES:16 8521 #, kde-format 8522 msgid "Africa/Ceuta" 8523 msgstr "" 8524 8525 #. i18n: comment to the previous timezone 8526 #: kdecore/TIMEZONES:18 8527 #, kde-format 8528 msgid "Ceuta & Melilla" 8529 msgstr "" 8530 8531 #. i18n: comment to the previous timezone 8532 #: kdecore/TIMEZONES:20 8533 #, kde-format 8534 msgid "Ceuta, Melilla" 8535 msgstr "" 8536 8537 #: kdecore/TIMEZONES:21 8538 #, kde-format 8539 msgid "Africa/Conakry" 8540 msgstr "" 8541 8542 #: kdecore/TIMEZONES:22 8543 #, kde-format 8544 msgid "Africa/Dakar" 8545 msgstr "" 8546 8547 #: kdecore/TIMEZONES:23 8548 #, kde-format 8549 msgid "Africa/Dar_es_Salaam" 8550 msgstr "" 8551 8552 #: kdecore/TIMEZONES:24 8553 #, kde-format 8554 msgid "Africa/Djibouti" 8555 msgstr "" 8556 8557 #: kdecore/TIMEZONES:25 8558 #, kde-format 8559 msgid "Africa/Douala" 8560 msgstr "" 8561 8562 #: kdecore/TIMEZONES:26 8563 #, kde-format 8564 msgid "Africa/El_Aaiun" 8565 msgstr "" 8566 8567 #: kdecore/TIMEZONES:27 8568 #, kde-format 8569 msgid "Africa/Freetown" 8570 msgstr "" 8571 8572 #: kdecore/TIMEZONES:28 8573 #, kde-format 8574 msgid "Africa/Gaborone" 8575 msgstr "" 8576 8577 #: kdecore/TIMEZONES:29 8578 #, kde-format 8579 msgid "Africa/Harare" 8580 msgstr "" 8581 8582 #: kdecore/TIMEZONES:30 8583 #, kde-format 8584 msgid "Africa/Johannesburg" 8585 msgstr "" 8586 8587 #: kdecore/TIMEZONES:31 8588 #, kde-format 8589 msgid "Africa/Juba" 8590 msgstr "" 8591 8592 #: kdecore/TIMEZONES:32 8593 #, kde-format 8594 msgid "Africa/Kampala" 8595 msgstr "" 8596 8597 #: kdecore/TIMEZONES:33 8598 #, kde-format 8599 msgid "Africa/Khartoum" 8600 msgstr "" 8601 8602 #: kdecore/TIMEZONES:34 8603 #, kde-format 8604 msgid "Africa/Kigali" 8605 msgstr "" 8606 8607 #: kdecore/TIMEZONES:35 8608 #, kde-format 8609 msgid "Africa/Kinshasa" 8610 msgstr "" 8611 8612 #. i18n: comment to the previous timezone 8613 #: kdecore/TIMEZONES:37 8614 #, kde-format 8615 msgid "west Dem. Rep. of Congo" 8616 msgstr "" 8617 8618 #. i18n: comment to the previous timezone 8619 #: kdecore/TIMEZONES:39 8620 #, kde-format 8621 msgid "Dem. Rep. of Congo (west)" 8622 msgstr "" 8623 8624 #: kdecore/TIMEZONES:40 8625 #, kde-format 8626 msgid "Africa/Lagos" 8627 msgstr "" 8628 8629 #: kdecore/TIMEZONES:41 8630 #, kde-format 8631 msgid "Africa/Libreville" 8632 msgstr "" 8633 8634 #: kdecore/TIMEZONES:42 8635 #, kde-format 8636 msgid "Africa/Lome" 8637 msgstr "" 8638 8639 #: kdecore/TIMEZONES:43 8640 #, kde-format 8641 msgid "Africa/Luanda" 8642 msgstr "" 8643 8644 #: kdecore/TIMEZONES:44 8645 #, kde-format 8646 msgid "Africa/Lubumbashi" 8647 msgstr "" 8648 8649 #. i18n: comment to the previous timezone 8650 #: kdecore/TIMEZONES:46 8651 #, kde-format 8652 msgid "east Dem. Rep. of Congo" 8653 msgstr "" 8654 8655 #. i18n: comment to the previous timezone 8656 #: kdecore/TIMEZONES:48 8657 #, kde-format 8658 msgid "Dem. Rep. of Congo (east)" 8659 msgstr "" 8660 8661 #: kdecore/TIMEZONES:49 8662 #, kde-format 8663 msgid "Africa/Lusaka" 8664 msgstr "" 8665 8666 #: kdecore/TIMEZONES:50 8667 #, kde-format 8668 msgid "Africa/Malabo" 8669 msgstr "" 8670 8671 #: kdecore/TIMEZONES:51 8672 #, kde-format 8673 msgid "Africa/Maputo" 8674 msgstr "" 8675 8676 #: kdecore/TIMEZONES:52 8677 #, kde-format 8678 msgid "Africa/Maseru" 8679 msgstr "" 8680 8681 #: kdecore/TIMEZONES:53 8682 #, kde-format 8683 msgid "Africa/Mbabane" 8684 msgstr "" 8685 8686 #: kdecore/TIMEZONES:54 8687 #, kde-format 8688 msgid "Africa/Mogadishu" 8689 msgstr "" 8690 8691 #: kdecore/TIMEZONES:55 8692 #, kde-format 8693 msgid "Africa/Monrovia" 8694 msgstr "" 8695 8696 #: kdecore/TIMEZONES:56 8697 #, kde-format 8698 msgid "Africa/Nairobi" 8699 msgstr "" 8700 8701 #: kdecore/TIMEZONES:57 8702 #, kde-format 8703 msgid "Africa/Ndjamena" 8704 msgstr "" 8705 8706 #: kdecore/TIMEZONES:58 8707 #, kde-format 8708 msgid "Africa/Niamey" 8709 msgstr "" 8710 8711 #: kdecore/TIMEZONES:59 8712 #, kde-format 8713 msgid "Africa/Nouakchott" 8714 msgstr "" 8715 8716 #: kdecore/TIMEZONES:60 8717 #, kde-format 8718 msgid "Africa/Ouagadougou" 8719 msgstr "" 8720 8721 #: kdecore/TIMEZONES:61 8722 #, kde-format 8723 msgid "Africa/Porto-Novo" 8724 msgstr "" 8725 8726 #: kdecore/TIMEZONES:62 8727 #, kde-format 8728 msgid "Africa/Pretoria" 8729 msgstr "" 8730 8731 #: kdecore/TIMEZONES:63 8732 #, kde-format 8733 msgid "Africa/Sao_Tome" 8734 msgstr "" 8735 8736 #: kdecore/TIMEZONES:64 8737 #, kde-format 8738 msgid "Africa/Timbuktu" 8739 msgstr "" 8740 8741 #: kdecore/TIMEZONES:65 8742 #, kde-format 8743 msgid "Africa/Tripoli" 8744 msgstr "" 8745 8746 #: kdecore/TIMEZONES:66 8747 #, kde-format 8748 msgid "Africa/Tunis" 8749 msgstr "" 8750 8751 #: kdecore/TIMEZONES:67 8752 #, kde-format 8753 msgid "Africa/Windhoek" 8754 msgstr "" 8755 8756 #: kdecore/TIMEZONES:68 8757 #, kde-format 8758 msgid "America/Adak" 8759 msgstr "" 8760 8761 #. i18n: comment to the previous timezone 8762 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8763 #, kde-format 8764 msgid "Aleutian Islands" 8765 msgstr "" 8766 8767 #: kdecore/TIMEZONES:71 8768 #, kde-format 8769 msgid "America/Anchorage" 8770 msgstr "" 8771 8772 #. i18n: comment to the previous timezone 8773 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8774 #, kde-format 8775 msgid "Alaska Time" 8776 msgstr "" 8777 8778 #. i18n: comment to the previous timezone 8779 #: kdecore/TIMEZONES:75 8780 #, kde-format 8781 msgid "Alaska (most areas)" 8782 msgstr "" 8783 8784 #: kdecore/TIMEZONES:76 8785 #, kde-format 8786 msgid "America/Anguilla" 8787 msgstr "" 8788 8789 #: kdecore/TIMEZONES:77 8790 #, kde-format 8791 msgid "America/Antigua" 8792 msgstr "" 8793 8794 #: kdecore/TIMEZONES:78 8795 #, kde-format 8796 msgid "America/Araguaina" 8797 msgstr "" 8798 8799 #. i18n: comment to the previous timezone 8800 #: kdecore/TIMEZONES:80 8801 #, kde-format 8802 msgid "Tocantins" 8803 msgstr "" 8804 8805 #: kdecore/TIMEZONES:81 8806 #, kde-format 8807 msgid "America/Argentina/Buenos_Aires" 8808 msgstr "" 8809 8810 #. i18n: comment to the previous timezone 8811 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8812 #, kde-format 8813 msgid "Buenos Aires (BA, CF)" 8814 msgstr "" 8815 8816 #: kdecore/TIMEZONES:84 8817 #, kde-format 8818 msgid "America/Argentina/Catamarca" 8819 msgstr "" 8820 8821 #. i18n: comment to the previous timezone 8822 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8823 #, kde-format 8824 msgid "Catamarca (CT), Chubut (CH)" 8825 msgstr "" 8826 8827 #. i18n: comment to the previous timezone 8828 #: kdecore/TIMEZONES:88 8829 #, kde-format 8830 msgid "Catamarca (CT); Chubut (CH)" 8831 msgstr "" 8832 8833 #: kdecore/TIMEZONES:89 8834 #, kde-format 8835 msgid "America/Argentina/ComodRivadavia" 8836 msgstr "" 8837 8838 #: kdecore/TIMEZONES:92 8839 #, kde-format 8840 msgid "America/Argentina/Cordoba" 8841 msgstr "" 8842 8843 #. i18n: comment to the previous timezone 8844 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8845 #, kde-format 8846 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8847 msgstr "" 8848 8849 #. i18n: comment to the previous timezone 8850 #: kdecore/TIMEZONES:96 8851 #, kde-format 8852 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8853 msgstr "" 8854 8855 #. i18n: comment to the previous timezone 8856 #: kdecore/TIMEZONES:98 8857 #, kde-format 8858 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8859 msgstr "" 8860 8861 #: kdecore/TIMEZONES:99 8862 #, kde-format 8863 msgid "America/Argentina/Jujuy" 8864 msgstr "" 8865 8866 #. i18n: comment to the previous timezone 8867 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8868 #, kde-format 8869 msgid "Jujuy (JY)" 8870 msgstr "" 8871 8872 #: kdecore/TIMEZONES:102 8873 #, kde-format 8874 msgid "America/Argentina/La_Rioja" 8875 msgstr "" 8876 8877 #. i18n: comment to the previous timezone 8878 #: kdecore/TIMEZONES:104 8879 #, kde-format 8880 msgid "La Rioja (LR)" 8881 msgstr "" 8882 8883 #: kdecore/TIMEZONES:105 8884 #, kde-format 8885 msgid "America/Argentina/Mendoza" 8886 msgstr "" 8887 8888 #. i18n: comment to the previous timezone 8889 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8890 #, kde-format 8891 msgid "Mendoza (MZ)" 8892 msgstr "" 8893 8894 #: kdecore/TIMEZONES:108 8895 #, kde-format 8896 msgid "America/Argentina/Rio_Gallegos" 8897 msgstr "" 8898 8899 #. i18n: comment to the previous timezone 8900 #: kdecore/TIMEZONES:110 8901 #, kde-format 8902 msgid "Santa Cruz (SC)" 8903 msgstr "" 8904 8905 #: kdecore/TIMEZONES:111 8906 #, kde-format 8907 msgid "America/Argentina/Salta" 8908 msgstr "" 8909 8910 #. i18n: comment to the previous timezone 8911 #: kdecore/TIMEZONES:113 8912 #, kde-format 8913 msgid "(SA, LP, NQ, RN)" 8914 msgstr "" 8915 8916 #. i18n: comment to the previous timezone 8917 #: kdecore/TIMEZONES:115 8918 #, kde-format 8919 msgid "Salta (SA, LP, NQ, RN)" 8920 msgstr "" 8921 8922 #: kdecore/TIMEZONES:116 8923 #, kde-format 8924 msgid "America/Argentina/San_Juan" 8925 msgstr "" 8926 8927 #. i18n: comment to the previous timezone 8928 #: kdecore/TIMEZONES:118 8929 #, kde-format 8930 msgid "San Juan (SJ)" 8931 msgstr "" 8932 8933 #: kdecore/TIMEZONES:119 8934 #, kde-format 8935 msgid "America/Argentina/San_Luis" 8936 msgstr "" 8937 8938 #. i18n: comment to the previous timezone 8939 #: kdecore/TIMEZONES:121 8940 #, kde-format 8941 msgid "San Luis (SL)" 8942 msgstr "" 8943 8944 #: kdecore/TIMEZONES:122 8945 #, kde-format 8946 msgid "America/Argentina/Tucuman" 8947 msgstr "" 8948 8949 #. i18n: comment to the previous timezone 8950 #: kdecore/TIMEZONES:124 8951 #, kde-format 8952 msgid "Tucuman (TM)" 8953 msgstr "" 8954 8955 #: kdecore/TIMEZONES:125 8956 #, kde-format 8957 msgid "America/Argentina/Ushuaia" 8958 msgstr "" 8959 8960 #. i18n: comment to the previous timezone 8961 #: kdecore/TIMEZONES:127 8962 #, kde-format 8963 msgid "Tierra del Fuego (TF)" 8964 msgstr "" 8965 8966 #: kdecore/TIMEZONES:128 8967 #, kde-format 8968 msgid "America/Aruba" 8969 msgstr "" 8970 8971 #: kdecore/TIMEZONES:129 8972 #, kde-format 8973 msgid "America/Asuncion" 8974 msgstr "" 8975 8976 #: kdecore/TIMEZONES:130 8977 #, kde-format 8978 msgid "America/Atikokan" 8979 msgstr "" 8980 8981 #. i18n: comment to the previous timezone 8982 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8983 #, kde-format 8984 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8985 msgstr "" 8986 8987 #. i18n: comment to the previous timezone 8988 #: kdecore/TIMEZONES:134 8989 #, kde-format 8990 msgid "EST - ON (Atikokan); NU (Coral H)" 8991 msgstr "" 8992 8993 #: kdecore/TIMEZONES:135 8994 #, kde-format 8995 msgid "America/Atka" 8996 msgstr "" 8997 8998 #: kdecore/TIMEZONES:138 8999 #, kde-format 9000 msgid "America/Bahia" 9001 msgstr "" 9002 9003 #. i18n: comment to the previous timezone 9004 #: kdecore/TIMEZONES:140 9005 #, kde-format 9006 msgid "Bahia" 9007 msgstr "" 9008 9009 #: kdecore/TIMEZONES:141 9010 #, kde-format 9011 msgid "America/Bahia_Banderas" 9012 msgstr "" 9013 9014 #. i18n: comment to the previous timezone 9015 #: kdecore/TIMEZONES:143 9016 #, kde-format 9017 msgid "Mexican Central Time - Bahia de Banderas" 9018 msgstr "" 9019 9020 #. i18n: comment to the previous timezone 9021 #: kdecore/TIMEZONES:145 9022 #, kde-format 9023 msgid "Central Time - Bahia de Banderas" 9024 msgstr "" 9025 9026 #: kdecore/TIMEZONES:146 9027 #, kde-format 9028 msgid "America/Barbados" 9029 msgstr "" 9030 9031 #: kdecore/TIMEZONES:147 9032 #, kde-format 9033 msgid "America/Belem" 9034 msgstr "" 9035 9036 #. i18n: comment to the previous timezone 9037 #: kdecore/TIMEZONES:149 9038 #, kde-format 9039 msgid "Amapa, E Para" 9040 msgstr "" 9041 9042 #. i18n: comment to the previous timezone 9043 #: kdecore/TIMEZONES:151 9044 #, kde-format 9045 msgid "Para (east); Amapa" 9046 msgstr "" 9047 9048 #: kdecore/TIMEZONES:152 9049 #, kde-format 9050 msgid "America/Belize" 9051 msgstr "" 9052 9053 #: kdecore/TIMEZONES:153 9054 #, kde-format 9055 msgid "America/Blanc-Sablon" 9056 msgstr "" 9057 9058 #. i18n: comment to the previous timezone 9059 #: kdecore/TIMEZONES:155 9060 #, kde-format 9061 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9062 msgstr "" 9063 9064 #. i18n: comment to the previous timezone 9065 #: kdecore/TIMEZONES:157 9066 #, kde-format 9067 msgid "AST - QC (Lower North Shore)" 9068 msgstr "" 9069 9070 #: kdecore/TIMEZONES:158 9071 #, kde-format 9072 msgid "America/Boa_Vista" 9073 msgstr "" 9074 9075 #. i18n: comment to the previous timezone 9076 #: kdecore/TIMEZONES:160 9077 #, kde-format 9078 msgid "Roraima" 9079 msgstr "" 9080 9081 #: kdecore/TIMEZONES:161 9082 #, kde-format 9083 msgid "America/Bogota" 9084 msgstr "" 9085 9086 #: kdecore/TIMEZONES:162 9087 #, kde-format 9088 msgid "America/Boise" 9089 msgstr "" 9090 9091 #. i18n: comment to the previous timezone 9092 #: kdecore/TIMEZONES:164 9093 #, kde-format 9094 msgid "Mountain Time - south Idaho & east Oregon" 9095 msgstr "" 9096 9097 #. i18n: comment to the previous timezone 9098 #: kdecore/TIMEZONES:166 9099 #, kde-format 9100 msgid "Mountain - ID (south); OR (east)" 9101 msgstr "" 9102 9103 #: kdecore/TIMEZONES:167 9104 #, kde-format 9105 msgid "America/Buenos_Aires" 9106 msgstr "" 9107 9108 #: kdecore/TIMEZONES:170 9109 #, kde-format 9110 msgid "America/Calgary" 9111 msgstr "" 9112 9113 #. i18n: comment to the previous timezone 9114 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9115 #, kde-format 9116 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9117 msgstr "" 9118 9119 #: kdecore/TIMEZONES:173 9120 #, kde-format 9121 msgid "America/Cambridge_Bay" 9122 msgstr "" 9123 9124 #. i18n: comment to the previous timezone 9125 #: kdecore/TIMEZONES:175 9126 #, kde-format 9127 msgid "Mountain Time - west Nunavut" 9128 msgstr "" 9129 9130 #. i18n: comment to the previous timezone 9131 #: kdecore/TIMEZONES:177 9132 #, kde-format 9133 msgid "Mountain - NU (west)" 9134 msgstr "" 9135 9136 #: kdecore/TIMEZONES:178 9137 #, kde-format 9138 msgid "America/Campo_Grande" 9139 msgstr "" 9140 9141 #. i18n: comment to the previous timezone 9142 #: kdecore/TIMEZONES:180 9143 #, kde-format 9144 msgid "Mato Grosso do Sul" 9145 msgstr "" 9146 9147 #: kdecore/TIMEZONES:181 9148 #, kde-format 9149 msgid "America/Cancun" 9150 msgstr "" 9151 9152 #. i18n: comment to the previous timezone 9153 #: kdecore/TIMEZONES:183 9154 #, kde-format 9155 msgid "Central Time - Quintana Roo" 9156 msgstr "" 9157 9158 #. i18n: comment to the previous timezone 9159 #: kdecore/TIMEZONES:185 9160 #, kde-format 9161 msgid "Eastern Standard Time - Quintana Roo" 9162 msgstr "" 9163 9164 #: kdecore/TIMEZONES:186 9165 #, kde-format 9166 msgid "America/Caracas" 9167 msgstr "" 9168 9169 #: kdecore/TIMEZONES:187 9170 #, kde-format 9171 msgid "America/Catamarca" 9172 msgstr "" 9173 9174 #: kdecore/TIMEZONES:190 9175 #, kde-format 9176 msgid "America/Cayenne" 9177 msgstr "" 9178 9179 #: kdecore/TIMEZONES:191 9180 #, kde-format 9181 msgid "America/Cayman" 9182 msgstr "" 9183 9184 #: kdecore/TIMEZONES:192 9185 #, kde-format 9186 msgid "America/Chicago" 9187 msgstr "" 9188 9189 #. i18n: comment to the previous timezone 9190 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9191 #, kde-format 9192 msgid "Central Time" 9193 msgstr "" 9194 9195 #. i18n: comment to the previous timezone 9196 #: kdecore/TIMEZONES:196 9197 #, kde-format 9198 msgid "Central (most areas)" 9199 msgstr "" 9200 9201 #: kdecore/TIMEZONES:197 9202 #, kde-format 9203 msgid "America/Chihuahua" 9204 msgstr "" 9205 9206 #. i18n: comment to the previous timezone 9207 #: kdecore/TIMEZONES:199 9208 #, kde-format 9209 msgid "Mountain Time - Chihuahua" 9210 msgstr "" 9211 9212 #. i18n: comment to the previous timezone 9213 #: kdecore/TIMEZONES:201 9214 #, kde-format 9215 msgid "Mexican Mountain Time - Chihuahua away from US border" 9216 msgstr "" 9217 9218 #. i18n: comment to the previous timezone 9219 #: kdecore/TIMEZONES:203 9220 #, kde-format 9221 msgid "Mountain Time - Chihuahua (most areas)" 9222 msgstr "" 9223 9224 #: kdecore/TIMEZONES:204 9225 #, kde-format 9226 msgid "America/Coral_Harbour" 9227 msgstr "" 9228 9229 #: kdecore/TIMEZONES:207 9230 #, kde-format 9231 msgid "America/Cordoba" 9232 msgstr "" 9233 9234 #: kdecore/TIMEZONES:210 9235 #, kde-format 9236 msgid "America/Costa_Rica" 9237 msgstr "" 9238 9239 #: kdecore/TIMEZONES:211 9240 #, kde-format 9241 msgid "America/Creston" 9242 msgstr "" 9243 9244 #. i18n: comment to the previous timezone 9245 #: kdecore/TIMEZONES:213 9246 #, kde-format 9247 msgid "Mountain Standard Time - Creston, British Columbia" 9248 msgstr "" 9249 9250 #. i18n: comment to the previous timezone 9251 #: kdecore/TIMEZONES:215 9252 #, kde-format 9253 msgid "MST - BC (Creston)" 9254 msgstr "" 9255 9256 #: kdecore/TIMEZONES:216 9257 #, kde-format 9258 msgid "America/Cuiaba" 9259 msgstr "" 9260 9261 #. i18n: comment to the previous timezone 9262 #: kdecore/TIMEZONES:218 9263 #, kde-format 9264 msgid "Mato Grosso" 9265 msgstr "" 9266 9267 #: kdecore/TIMEZONES:219 9268 #, kde-format 9269 msgid "America/Curacao" 9270 msgstr "" 9271 9272 #: kdecore/TIMEZONES:220 9273 #, kde-format 9274 msgid "America/Danmarkshavn" 9275 msgstr "" 9276 9277 #. i18n: comment to the previous timezone 9278 #: kdecore/TIMEZONES:222 9279 #, kde-format 9280 msgid "east coast, north of Scoresbysund" 9281 msgstr "" 9282 9283 #. i18n: comment to the previous timezone 9284 #: kdecore/TIMEZONES:224 9285 #, kde-format 9286 msgid "National Park (east coast)" 9287 msgstr "" 9288 9289 #: kdecore/TIMEZONES:225 9290 #, kde-format 9291 msgid "America/Dawson" 9292 msgstr "" 9293 9294 #. i18n: comment to the previous timezone 9295 #: kdecore/TIMEZONES:227 9296 #, kde-format 9297 msgid "Pacific Time - north Yukon" 9298 msgstr "" 9299 9300 #. i18n: comment to the previous timezone 9301 #: kdecore/TIMEZONES:229 9302 #, kde-format 9303 msgid "MST - Yukon (west)" 9304 msgstr "" 9305 9306 #: kdecore/TIMEZONES:230 9307 #, kde-format 9308 msgid "America/Dawson_Creek" 9309 msgstr "" 9310 9311 #. i18n: comment to the previous timezone 9312 #: kdecore/TIMEZONES:232 9313 #, kde-format 9314 msgid "" 9315 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9316 msgstr "" 9317 9318 #. i18n: comment to the previous timezone 9319 #: kdecore/TIMEZONES:234 9320 #, kde-format 9321 msgid "MST - BC (Dawson Cr, Ft St John)" 9322 msgstr "" 9323 9324 #: kdecore/TIMEZONES:235 9325 #, kde-format 9326 msgid "America/Denver" 9327 msgstr "" 9328 9329 #. i18n: comment to the previous timezone 9330 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9331 #, kde-format 9332 msgid "Mountain Time" 9333 msgstr "" 9334 9335 #. i18n: comment to the previous timezone 9336 #: kdecore/TIMEZONES:239 9337 #, kde-format 9338 msgid "Mountain (most areas)" 9339 msgstr "" 9340 9341 #: kdecore/TIMEZONES:240 9342 #, kde-format 9343 msgid "America/Detroit" 9344 msgstr "" 9345 9346 #. i18n: comment to the previous timezone 9347 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9348 #, kde-format 9349 msgid "Eastern Time - Michigan - most locations" 9350 msgstr "" 9351 9352 #. i18n: comment to the previous timezone 9353 #: kdecore/TIMEZONES:244 9354 #, kde-format 9355 msgid "Eastern - MI (most areas)" 9356 msgstr "" 9357 9358 #: kdecore/TIMEZONES:245 9359 #, kde-format 9360 msgid "America/Dominica" 9361 msgstr "" 9362 9363 #: kdecore/TIMEZONES:246 9364 #, kde-format 9365 msgid "America/Edmonton" 9366 msgstr "" 9367 9368 #. i18n: comment to the previous timezone 9369 #: kdecore/TIMEZONES:250 9370 #, kde-format 9371 msgid "Mountain - AB; BC (E); SK (W)" 9372 msgstr "" 9373 9374 #: kdecore/TIMEZONES:251 9375 #, kde-format 9376 msgid "America/Eirunepe" 9377 msgstr "" 9378 9379 #. i18n: comment to the previous timezone 9380 #: kdecore/TIMEZONES:253 9381 #, kde-format 9382 msgid "W Amazonas" 9383 msgstr "" 9384 9385 #. i18n: comment to the previous timezone 9386 #: kdecore/TIMEZONES:255 9387 #, kde-format 9388 msgid "Amazonas (west)" 9389 msgstr "" 9390 9391 #: kdecore/TIMEZONES:256 9392 #, kde-format 9393 msgid "America/El_Salvador" 9394 msgstr "" 9395 9396 #: kdecore/TIMEZONES:257 9397 #, kde-format 9398 msgid "America/Ensenada" 9399 msgstr "" 9400 9401 #. i18n: comment to the previous timezone 9402 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9403 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9404 #, kde-format 9405 msgid "Pacific Time" 9406 msgstr "" 9407 9408 #: kdecore/TIMEZONES:260 9409 #, kde-format 9410 msgid "America/Fort_Nelson" 9411 msgstr "" 9412 9413 #. i18n: comment to the previous timezone 9414 #: kdecore/TIMEZONES:262 9415 #, kde-format 9416 msgid "MST - BC (Ft Nelson)" 9417 msgstr "" 9418 9419 #: kdecore/TIMEZONES:263 9420 #, kde-format 9421 msgid "America/Fort_Wayne" 9422 msgstr "" 9423 9424 #. i18n: comment to the previous timezone 9425 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9426 #: kdecore/TIMEZONES:1419 9427 #, kde-format 9428 msgid "Eastern Time - Indiana - most locations" 9429 msgstr "" 9430 9431 #: kdecore/TIMEZONES:266 9432 #, kde-format 9433 msgid "America/Fortaleza" 9434 msgstr "" 9435 9436 #. i18n: comment to the previous timezone 9437 #: kdecore/TIMEZONES:268 9438 #, kde-format 9439 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9440 msgstr "" 9441 9442 #. i18n: comment to the previous timezone 9443 #: kdecore/TIMEZONES:270 9444 #, kde-format 9445 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9446 msgstr "" 9447 9448 #: kdecore/TIMEZONES:271 9449 #, kde-format 9450 msgid "America/Fredericton" 9451 msgstr "" 9452 9453 #. i18n: comment to the previous timezone 9454 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9455 #, kde-format 9456 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9457 msgstr "" 9458 9459 #: kdecore/TIMEZONES:274 9460 #, kde-format 9461 msgid "America/Glace_Bay" 9462 msgstr "" 9463 9464 #. i18n: comment to the previous timezone 9465 #: kdecore/TIMEZONES:276 9466 #, kde-format 9467 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9468 msgstr "" 9469 9470 #. i18n: comment to the previous timezone 9471 #: kdecore/TIMEZONES:278 9472 #, kde-format 9473 msgid "Atlantic - NS (Cape Breton)" 9474 msgstr "" 9475 9476 #: kdecore/TIMEZONES:279 9477 #, kde-format 9478 msgid "America/Godthab" 9479 msgstr "" 9480 9481 #. i18n: comment to the previous timezone 9482 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9483 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9484 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9485 #: kdecore/TIMEZONES:1350 9486 #, kde-format 9487 msgid "most locations" 9488 msgstr "" 9489 9490 #: kdecore/TIMEZONES:282 9491 #, kde-format 9492 msgid "America/Goose_Bay" 9493 msgstr "" 9494 9495 #. i18n: comment to the previous timezone 9496 #: kdecore/TIMEZONES:284 9497 #, kde-format 9498 msgid "Atlantic Time - Labrador - most locations" 9499 msgstr "" 9500 9501 #. i18n: comment to the previous timezone 9502 #: kdecore/TIMEZONES:286 9503 #, kde-format 9504 msgid "Atlantic - Labrador (most areas)" 9505 msgstr "" 9506 9507 #: kdecore/TIMEZONES:287 9508 #, kde-format 9509 msgid "America/Grand_Turk" 9510 msgstr "" 9511 9512 #: kdecore/TIMEZONES:288 9513 #, kde-format 9514 msgid "America/Grenada" 9515 msgstr "" 9516 9517 #: kdecore/TIMEZONES:289 9518 #, kde-format 9519 msgid "America/Guadeloupe" 9520 msgstr "" 9521 9522 #: kdecore/TIMEZONES:290 9523 #, kde-format 9524 msgid "America/Guatemala" 9525 msgstr "" 9526 9527 #: kdecore/TIMEZONES:291 9528 #, kde-format 9529 msgid "America/Guayaquil" 9530 msgstr "" 9531 9532 #. i18n: comment to the previous timezone 9533 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9534 #: kdecore/TIMEZONES:1400 9535 #, kde-format 9536 msgid "mainland" 9537 msgstr "" 9538 9539 #. i18n: comment to the previous timezone 9540 #: kdecore/TIMEZONES:295 9541 #, kde-format 9542 msgid "Ecuador (mainland)" 9543 msgstr "" 9544 9545 #: kdecore/TIMEZONES:296 9546 #, kde-format 9547 msgid "America/Guyana" 9548 msgstr "" 9549 9550 #: kdecore/TIMEZONES:297 9551 #, kde-format 9552 msgid "America/Halifax" 9553 msgstr "" 9554 9555 #. i18n: comment to the previous timezone 9556 #: kdecore/TIMEZONES:301 9557 #, kde-format 9558 msgid "Atlantic - NS (most areas); PE" 9559 msgstr "" 9560 9561 #: kdecore/TIMEZONES:302 9562 #, kde-format 9563 msgid "America/Havana" 9564 msgstr "" 9565 9566 #: kdecore/TIMEZONES:303 9567 #, kde-format 9568 msgid "America/Hermosillo" 9569 msgstr "" 9570 9571 #. i18n: comment to the previous timezone 9572 #: kdecore/TIMEZONES:305 9573 #, kde-format 9574 msgid "Mountain Standard Time - Sonora" 9575 msgstr "" 9576 9577 #: kdecore/TIMEZONES:306 9578 #, kde-format 9579 msgid "America/Indiana/Indianapolis" 9580 msgstr "" 9581 9582 #. i18n: comment to the previous timezone 9583 #: kdecore/TIMEZONES:310 9584 #, kde-format 9585 msgid "Eastern - IN (most areas)" 9586 msgstr "" 9587 9588 #: kdecore/TIMEZONES:311 9589 #, kde-format 9590 msgid "America/Indiana/Knox" 9591 msgstr "" 9592 9593 #. i18n: comment to the previous timezone 9594 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9595 #, kde-format 9596 msgid "Eastern Time - Indiana - Starke County" 9597 msgstr "" 9598 9599 #. i18n: comment to the previous timezone 9600 #: kdecore/TIMEZONES:315 9601 #, kde-format 9602 msgid "Central Time - Indiana - Starke County" 9603 msgstr "" 9604 9605 #. i18n: comment to the previous timezone 9606 #: kdecore/TIMEZONES:317 9607 #, kde-format 9608 msgid "Central - IN (Starke)" 9609 msgstr "" 9610 9611 #: kdecore/TIMEZONES:318 9612 #, kde-format 9613 msgid "America/Indiana/Marengo" 9614 msgstr "" 9615 9616 #. i18n: comment to the previous timezone 9617 #: kdecore/TIMEZONES:320 9618 #, kde-format 9619 msgid "Eastern Time - Indiana - Crawford County" 9620 msgstr "" 9621 9622 #. i18n: comment to the previous timezone 9623 #: kdecore/TIMEZONES:322 9624 #, kde-format 9625 msgid "Eastern - IN (Crawford)" 9626 msgstr "" 9627 9628 #: kdecore/TIMEZONES:323 9629 #, kde-format 9630 msgid "America/Indiana/Petersburg" 9631 msgstr "" 9632 9633 #. i18n: comment to the previous timezone 9634 #: kdecore/TIMEZONES:325 9635 #, kde-format 9636 msgid "Central Time - Indiana - Pike County" 9637 msgstr "" 9638 9639 #. i18n: comment to the previous timezone 9640 #: kdecore/TIMEZONES:327 9641 #, kde-format 9642 msgid "Eastern Time - Indiana - Pike County" 9643 msgstr "" 9644 9645 #. i18n: comment to the previous timezone 9646 #: kdecore/TIMEZONES:329 9647 #, kde-format 9648 msgid "Eastern - IN (Pike)" 9649 msgstr "" 9650 9651 #: kdecore/TIMEZONES:330 9652 #, kde-format 9653 msgid "America/Indiana/Tell_City" 9654 msgstr "" 9655 9656 #. i18n: comment to the previous timezone 9657 #: kdecore/TIMEZONES:332 9658 #, kde-format 9659 msgid "Central Time - Indiana - Perry County" 9660 msgstr "" 9661 9662 #. i18n: comment to the previous timezone 9663 #: kdecore/TIMEZONES:334 9664 #, kde-format 9665 msgid "Central - IN (Perry)" 9666 msgstr "" 9667 9668 #: kdecore/TIMEZONES:335 9669 #, kde-format 9670 msgid "America/Indiana/Vevay" 9671 msgstr "" 9672 9673 #. i18n: comment to the previous timezone 9674 #: kdecore/TIMEZONES:337 9675 #, kde-format 9676 msgid "Eastern Time - Indiana - Switzerland County" 9677 msgstr "" 9678 9679 #. i18n: comment to the previous timezone 9680 #: kdecore/TIMEZONES:339 9681 #, kde-format 9682 msgid "Eastern - IN (Switzerland)" 9683 msgstr "" 9684 9685 #: kdecore/TIMEZONES:340 9686 #, kde-format 9687 msgid "America/Indiana/Vincennes" 9688 msgstr "" 9689 9690 #. i18n: comment to the previous timezone 9691 #: kdecore/TIMEZONES:342 9692 #, kde-format 9693 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9694 msgstr "" 9695 9696 #. i18n: comment to the previous timezone 9697 #: kdecore/TIMEZONES:344 9698 #, kde-format 9699 msgid "Eastern - IN (Da, Du, K, Mn)" 9700 msgstr "" 9701 9702 #: kdecore/TIMEZONES:345 9703 #, kde-format 9704 msgid "America/Indiana/Winamac" 9705 msgstr "" 9706 9707 #. i18n: comment to the previous timezone 9708 #: kdecore/TIMEZONES:347 9709 #, kde-format 9710 msgid "Eastern Time - Indiana - Pulaski County" 9711 msgstr "" 9712 9713 #. i18n: comment to the previous timezone 9714 #: kdecore/TIMEZONES:349 9715 #, kde-format 9716 msgid "Eastern - IN (Pulaski)" 9717 msgstr "" 9718 9719 #: kdecore/TIMEZONES:350 9720 #, kde-format 9721 msgid "America/Indianapolis" 9722 msgstr "" 9723 9724 #: kdecore/TIMEZONES:353 9725 #, kde-format 9726 msgid "America/Inuvik" 9727 msgstr "" 9728 9729 #. i18n: comment to the previous timezone 9730 #: kdecore/TIMEZONES:355 9731 #, kde-format 9732 msgid "Mountain Time - west Northwest Territories" 9733 msgstr "" 9734 9735 #. i18n: comment to the previous timezone 9736 #: kdecore/TIMEZONES:357 9737 #, kde-format 9738 msgid "Mountain - NT (west)" 9739 msgstr "" 9740 9741 #: kdecore/TIMEZONES:358 9742 #, kde-format 9743 msgid "America/Iqaluit" 9744 msgstr "" 9745 9746 #. i18n: comment to the previous timezone 9747 #: kdecore/TIMEZONES:360 9748 #, kde-format 9749 msgid "Eastern Time - east Nunavut - most locations" 9750 msgstr "" 9751 9752 #. i18n: comment to the previous timezone 9753 #: kdecore/TIMEZONES:362 9754 #, kde-format 9755 msgid "Eastern - NU (most east areas)" 9756 msgstr "" 9757 9758 #: kdecore/TIMEZONES:363 9759 #, kde-format 9760 msgid "America/Jamaica" 9761 msgstr "" 9762 9763 #: kdecore/TIMEZONES:364 9764 #, kde-format 9765 msgid "America/Jujuy" 9766 msgstr "" 9767 9768 #: kdecore/TIMEZONES:367 9769 #, kde-format 9770 msgid "America/Juneau" 9771 msgstr "" 9772 9773 #. i18n: comment to the previous timezone 9774 #: kdecore/TIMEZONES:369 9775 #, kde-format 9776 msgid "Alaska Time - Alaska panhandle" 9777 msgstr "" 9778 9779 #. i18n: comment to the previous timezone 9780 #: kdecore/TIMEZONES:371 9781 #, kde-format 9782 msgid "Alaska - Juneau area" 9783 msgstr "" 9784 9785 #: kdecore/TIMEZONES:372 9786 #, kde-format 9787 msgid "America/Kentucky/Louisville" 9788 msgstr "" 9789 9790 #. i18n: comment to the previous timezone 9791 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9792 #, kde-format 9793 msgid "Eastern Time - Kentucky - Louisville area" 9794 msgstr "" 9795 9796 #. i18n: comment to the previous timezone 9797 #: kdecore/TIMEZONES:376 9798 #, kde-format 9799 msgid "Eastern - KY (Louisville area)" 9800 msgstr "" 9801 9802 #: kdecore/TIMEZONES:377 9803 #, kde-format 9804 msgid "America/Kentucky/Monticello" 9805 msgstr "" 9806 9807 #. i18n: comment to the previous timezone 9808 #: kdecore/TIMEZONES:379 9809 #, kde-format 9810 msgid "Eastern Time - Kentucky - Wayne County" 9811 msgstr "" 9812 9813 #. i18n: comment to the previous timezone 9814 #: kdecore/TIMEZONES:381 9815 #, kde-format 9816 msgid "Eastern - KY (Wayne)" 9817 msgstr "" 9818 9819 #: kdecore/TIMEZONES:382 9820 #, kde-format 9821 msgid "America/Knox_IN" 9822 msgstr "" 9823 9824 #: kdecore/TIMEZONES:385 9825 #, kde-format 9826 msgid "America/Kralendijk" 9827 msgstr "" 9828 9829 #: kdecore/TIMEZONES:386 9830 #, kde-format 9831 msgid "America/La_Paz" 9832 msgstr "" 9833 9834 #: kdecore/TIMEZONES:387 9835 #, kde-format 9836 msgid "America/Lima" 9837 msgstr "" 9838 9839 #: kdecore/TIMEZONES:388 9840 #, kde-format 9841 msgid "America/Los_Angeles" 9842 msgstr "" 9843 9844 #. i18n: comment to the previous timezone 9845 #: kdecore/TIMEZONES:392 9846 #, kde-format 9847 msgid "Pacific" 9848 msgstr "" 9849 9850 #: kdecore/TIMEZONES:393 9851 #, kde-format 9852 msgid "America/Louisville" 9853 msgstr "" 9854 9855 #: kdecore/TIMEZONES:396 9856 #, kde-format 9857 msgid "America/Lower_Princes" 9858 msgstr "" 9859 9860 #: kdecore/TIMEZONES:397 9861 #, kde-format 9862 msgid "America/Maceio" 9863 msgstr "" 9864 9865 #. i18n: comment to the previous timezone 9866 #: kdecore/TIMEZONES:399 9867 #, kde-format 9868 msgid "Alagoas, Sergipe" 9869 msgstr "" 9870 9871 #: kdecore/TIMEZONES:400 9872 #, kde-format 9873 msgid "America/Managua" 9874 msgstr "" 9875 9876 #: kdecore/TIMEZONES:401 9877 #, kde-format 9878 msgid "America/Manaus" 9879 msgstr "" 9880 9881 #. i18n: comment to the previous timezone 9882 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9883 #, kde-format 9884 msgid "E Amazonas" 9885 msgstr "" 9886 9887 #. i18n: comment to the previous timezone 9888 #: kdecore/TIMEZONES:405 9889 #, kde-format 9890 msgid "Amazonas (east)" 9891 msgstr "" 9892 9893 #: kdecore/TIMEZONES:406 9894 #, kde-format 9895 msgid "America/Marigot" 9896 msgstr "" 9897 9898 #: kdecore/TIMEZONES:407 9899 #, kde-format 9900 msgid "America/Martinique" 9901 msgstr "" 9902 9903 #: kdecore/TIMEZONES:408 9904 #, kde-format 9905 msgid "America/Matamoros" 9906 msgstr "" 9907 9908 #. i18n: comment to the previous timezone 9909 #: kdecore/TIMEZONES:410 9910 #, kde-format 9911 msgid "" 9912 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9913 msgstr "" 9914 9915 #. i18n: comment to the previous timezone 9916 #: kdecore/TIMEZONES:412 9917 #, kde-format 9918 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9919 msgstr "" 9920 9921 #: kdecore/TIMEZONES:413 9922 #, kde-format 9923 msgid "America/Mazatlan" 9924 msgstr "" 9925 9926 #. i18n: comment to the previous timezone 9927 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9928 #, kde-format 9929 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9930 msgstr "" 9931 9932 #. i18n: comment to the previous timezone 9933 #: kdecore/TIMEZONES:417 9934 #, kde-format 9935 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9936 msgstr "" 9937 9938 #: kdecore/TIMEZONES:418 9939 #, kde-format 9940 msgid "America/Mendoza" 9941 msgstr "" 9942 9943 #: kdecore/TIMEZONES:421 9944 #, kde-format 9945 msgid "America/Menominee" 9946 msgstr "" 9947 9948 #. i18n: comment to the previous timezone 9949 #: kdecore/TIMEZONES:423 9950 #, kde-format 9951 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9952 msgstr "" 9953 9954 #. i18n: comment to the previous timezone 9955 #: kdecore/TIMEZONES:425 9956 #, kde-format 9957 msgid "Central - MI (Wisconsin border)" 9958 msgstr "" 9959 9960 #: kdecore/TIMEZONES:426 9961 #, kde-format 9962 msgid "America/Merida" 9963 msgstr "" 9964 9965 #. i18n: comment to the previous timezone 9966 #: kdecore/TIMEZONES:428 9967 #, kde-format 9968 msgid "Central Time - Campeche, Yucatan" 9969 msgstr "" 9970 9971 #: kdecore/TIMEZONES:429 9972 #, kde-format 9973 msgid "America/Metlakatla" 9974 msgstr "" 9975 9976 #. i18n: comment to the previous timezone 9977 #: kdecore/TIMEZONES:431 9978 #, kde-format 9979 msgid "Metlakatla Time - Annette Island" 9980 msgstr "" 9981 9982 #. i18n: comment to the previous timezone 9983 #: kdecore/TIMEZONES:433 9984 #, kde-format 9985 msgid "Alaska - Annette Island" 9986 msgstr "" 9987 9988 #: kdecore/TIMEZONES:434 9989 #, kde-format 9990 msgid "America/Mexico_City" 9991 msgstr "" 9992 9993 #. i18n: comment to the previous timezone 9994 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9995 #, kde-format 9996 msgid "Central Time - most locations" 9997 msgstr "" 9998 9999 #: kdecore/TIMEZONES:439 10000 #, kde-format 10001 msgid "America/Miquelon" 10002 msgstr "" 10003 10004 #: kdecore/TIMEZONES:440 10005 #, kde-format 10006 msgid "America/Moncton" 10007 msgstr "" 10008 10009 #. i18n: comment to the previous timezone 10010 #: kdecore/TIMEZONES:442 10011 #, kde-format 10012 msgid "Atlantic Time - New Brunswick" 10013 msgstr "" 10014 10015 #. i18n: comment to the previous timezone 10016 #: kdecore/TIMEZONES:444 10017 #, kde-format 10018 msgid "Atlantic - New Brunswick" 10019 msgstr "" 10020 10021 #: kdecore/TIMEZONES:445 10022 #, kde-format 10023 msgid "America/Monterrey" 10024 msgstr "" 10025 10026 #. i18n: comment to the previous timezone 10027 #: kdecore/TIMEZONES:447 10028 #, kde-format 10029 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10030 msgstr "" 10031 10032 #. i18n: comment to the previous timezone 10033 #: kdecore/TIMEZONES:449 10034 #, kde-format 10035 msgid "" 10036 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10037 "US border" 10038 msgstr "" 10039 10040 #. i18n: comment to the previous timezone 10041 #: kdecore/TIMEZONES:451 10042 #, kde-format 10043 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10044 msgstr "" 10045 10046 #: kdecore/TIMEZONES:452 10047 #, kde-format 10048 msgid "America/Montevideo" 10049 msgstr "" 10050 10051 #: kdecore/TIMEZONES:453 10052 #, kde-format 10053 msgid "America/Montreal" 10054 msgstr "" 10055 10056 #. i18n: comment to the previous timezone 10057 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10058 #, kde-format 10059 msgid "Eastern Time - Quebec - most locations" 10060 msgstr "" 10061 10062 #: kdecore/TIMEZONES:456 10063 #, kde-format 10064 msgid "America/Montserrat" 10065 msgstr "" 10066 10067 #: kdecore/TIMEZONES:457 10068 #, kde-format 10069 msgid "America/Nassau" 10070 msgstr "" 10071 10072 #: kdecore/TIMEZONES:458 10073 #, kde-format 10074 msgid "America/New_York" 10075 msgstr "" 10076 10077 #. i18n: comment to the previous timezone 10078 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10079 #, kde-format 10080 msgid "Eastern Time" 10081 msgstr "" 10082 10083 #. i18n: comment to the previous timezone 10084 #: kdecore/TIMEZONES:462 10085 #, kde-format 10086 msgid "Eastern (most areas)" 10087 msgstr "" 10088 10089 #: kdecore/TIMEZONES:463 10090 #, kde-format 10091 msgid "America/Nipigon" 10092 msgstr "" 10093 10094 #. i18n: comment to the previous timezone 10095 #: kdecore/TIMEZONES:465 10096 #, kde-format 10097 msgid "" 10098 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10099 msgstr "" 10100 10101 #. i18n: comment to the previous timezone 10102 #: kdecore/TIMEZONES:467 10103 #, kde-format 10104 msgid "Eastern - ON, QC (no DST 1967-73)" 10105 msgstr "" 10106 10107 #: kdecore/TIMEZONES:468 10108 #, kde-format 10109 msgid "America/Nome" 10110 msgstr "" 10111 10112 #. i18n: comment to the previous timezone 10113 #: kdecore/TIMEZONES:470 10114 #, kde-format 10115 msgid "Alaska Time - west Alaska" 10116 msgstr "" 10117 10118 #. i18n: comment to the previous timezone 10119 #: kdecore/TIMEZONES:472 10120 #, kde-format 10121 msgid "Alaska (west)" 10122 msgstr "" 10123 10124 #: kdecore/TIMEZONES:473 10125 #, kde-format 10126 msgid "America/Noronha" 10127 msgstr "" 10128 10129 #. i18n: comment to the previous timezone 10130 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10131 #, kde-format 10132 msgid "Atlantic islands" 10133 msgstr "" 10134 10135 #: kdecore/TIMEZONES:476 10136 #, kde-format 10137 msgid "America/North_Dakota/Beulah" 10138 msgstr "" 10139 10140 #. i18n: comment to the previous timezone 10141 #: kdecore/TIMEZONES:478 10142 #, kde-format 10143 msgid "Central Time - North Dakota - Mercer County" 10144 msgstr "" 10145 10146 #. i18n: comment to the previous timezone 10147 #: kdecore/TIMEZONES:480 10148 #, kde-format 10149 msgid "Central - ND (Mercer)" 10150 msgstr "" 10151 10152 #: kdecore/TIMEZONES:481 10153 #, kde-format 10154 msgid "America/North_Dakota/Center" 10155 msgstr "" 10156 10157 #. i18n: comment to the previous timezone 10158 #: kdecore/TIMEZONES:483 10159 #, kde-format 10160 msgid "Central Time - North Dakota - Oliver County" 10161 msgstr "" 10162 10163 #. i18n: comment to the previous timezone 10164 #: kdecore/TIMEZONES:485 10165 #, kde-format 10166 msgid "Central - ND (Oliver)" 10167 msgstr "" 10168 10169 #: kdecore/TIMEZONES:486 10170 #, kde-format 10171 msgid "America/North_Dakota/New_Salem" 10172 msgstr "" 10173 10174 #. i18n: comment to the previous timezone 10175 #: kdecore/TIMEZONES:488 10176 #, kde-format 10177 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10178 msgstr "" 10179 10180 #. i18n: comment to the previous timezone 10181 #: kdecore/TIMEZONES:490 10182 #, kde-format 10183 msgid "Central - ND (Morton rural)" 10184 msgstr "" 10185 10186 #: kdecore/TIMEZONES:491 10187 #, kde-format 10188 msgid "America/Nuuk" 10189 msgstr "" 10190 10191 #. i18n: comment to the previous timezone 10192 #: kdecore/TIMEZONES:493 10193 #, kde-format 10194 msgid "Greenland (most areas)" 10195 msgstr "" 10196 10197 #: kdecore/TIMEZONES:494 10198 #, kde-format 10199 msgid "America/Ojinaga" 10200 msgstr "" 10201 10202 #. i18n: comment to the previous timezone 10203 #: kdecore/TIMEZONES:496 10204 #, kde-format 10205 msgid "US Mountain Time - Chihuahua near US border" 10206 msgstr "" 10207 10208 #. i18n: comment to the previous timezone 10209 #: kdecore/TIMEZONES:498 10210 #, kde-format 10211 msgid "Mountain Time US - Chihuahua (US border)" 10212 msgstr "" 10213 10214 #: kdecore/TIMEZONES:499 10215 #, kde-format 10216 msgid "America/Ontario" 10217 msgstr "" 10218 10219 #: kdecore/TIMEZONES:502 10220 #, kde-format 10221 msgid "America/Panama" 10222 msgstr "" 10223 10224 #: kdecore/TIMEZONES:503 10225 #, kde-format 10226 msgid "America/Pangnirtung" 10227 msgstr "" 10228 10229 #. i18n: comment to the previous timezone 10230 #: kdecore/TIMEZONES:505 10231 #, kde-format 10232 msgid "Eastern Time - Pangnirtung, Nunavut" 10233 msgstr "" 10234 10235 #. i18n: comment to the previous timezone 10236 #: kdecore/TIMEZONES:507 10237 #, kde-format 10238 msgid "Eastern - NU (Pangnirtung)" 10239 msgstr "" 10240 10241 #: kdecore/TIMEZONES:508 10242 #, kde-format 10243 msgid "America/Paramaribo" 10244 msgstr "" 10245 10246 #: kdecore/TIMEZONES:509 10247 #, kde-format 10248 msgid "America/Phoenix" 10249 msgstr "" 10250 10251 #. i18n: comment to the previous timezone 10252 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10253 #, kde-format 10254 msgid "Mountain Standard Time - Arizona" 10255 msgstr "" 10256 10257 #. i18n: comment to the previous timezone 10258 #: kdecore/TIMEZONES:513 10259 #, kde-format 10260 msgid "MST - Arizona (except Navajo)" 10261 msgstr "" 10262 10263 #: kdecore/TIMEZONES:514 10264 #, kde-format 10265 msgid "America/Port-au-Prince" 10266 msgstr "" 10267 10268 #: kdecore/TIMEZONES:515 10269 #, kde-format 10270 msgid "America/Port_of_Spain" 10271 msgstr "" 10272 10273 #: kdecore/TIMEZONES:516 10274 #, kde-format 10275 msgid "America/Porto_Acre" 10276 msgstr "" 10277 10278 #. i18n: comment to the previous timezone 10279 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10280 #, kde-format 10281 msgid "Acre" 10282 msgstr "" 10283 10284 #: kdecore/TIMEZONES:519 10285 #, kde-format 10286 msgid "America/Porto_Velho" 10287 msgstr "" 10288 10289 #. i18n: comment to the previous timezone 10290 #: kdecore/TIMEZONES:521 10291 #, kde-format 10292 msgid "Rondonia" 10293 msgstr "" 10294 10295 #: kdecore/TIMEZONES:522 10296 #, kde-format 10297 msgid "America/Puerto_Rico" 10298 msgstr "" 10299 10300 #: kdecore/TIMEZONES:523 10301 #, kde-format 10302 msgid "America/Punta_Arenas" 10303 msgstr "" 10304 10305 #. i18n: comment to the previous timezone 10306 #: kdecore/TIMEZONES:525 10307 #, kde-format 10308 msgid "Region of Magallanes" 10309 msgstr "" 10310 10311 #: kdecore/TIMEZONES:526 10312 #, kde-format 10313 msgid "America/Rainy_River" 10314 msgstr "" 10315 10316 #. i18n: comment to the previous timezone 10317 #: kdecore/TIMEZONES:528 10318 #, kde-format 10319 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10320 msgstr "" 10321 10322 #. i18n: comment to the previous timezone 10323 #: kdecore/TIMEZONES:530 10324 #, kde-format 10325 msgid "Central - ON (Rainy R, Ft Frances)" 10326 msgstr "" 10327 10328 #: kdecore/TIMEZONES:531 10329 #, kde-format 10330 msgid "America/Rankin_Inlet" 10331 msgstr "" 10332 10333 #. i18n: comment to the previous timezone 10334 #: kdecore/TIMEZONES:533 10335 #, kde-format 10336 msgid "Central Time - central Nunavut" 10337 msgstr "" 10338 10339 #. i18n: comment to the previous timezone 10340 #: kdecore/TIMEZONES:535 10341 #, kde-format 10342 msgid "Central - NU (central)" 10343 msgstr "" 10344 10345 #: kdecore/TIMEZONES:536 10346 #, kde-format 10347 msgid "America/Recife" 10348 msgstr "" 10349 10350 #. i18n: comment to the previous timezone 10351 #: kdecore/TIMEZONES:538 10352 #, kde-format 10353 msgid "Pernambuco" 10354 msgstr "" 10355 10356 #: kdecore/TIMEZONES:539 10357 #, kde-format 10358 msgid "America/Regina" 10359 msgstr "" 10360 10361 #. i18n: comment to the previous timezone 10362 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10363 #: kdecore/TIMEZONES:1123 10364 #, kde-format 10365 msgid "Central Standard Time - Saskatchewan - most locations" 10366 msgstr "" 10367 10368 #. i18n: comment to the previous timezone 10369 #: kdecore/TIMEZONES:543 10370 #, kde-format 10371 msgid "CST - SK (most areas)" 10372 msgstr "" 10373 10374 #: kdecore/TIMEZONES:544 10375 #, kde-format 10376 msgid "America/Resolute" 10377 msgstr "" 10378 10379 #. i18n: comment to the previous timezone 10380 #: kdecore/TIMEZONES:546 10381 #, kde-format 10382 msgid "Eastern Time - Resolute, Nunavut" 10383 msgstr "" 10384 10385 #. i18n: comment to the previous timezone 10386 #: kdecore/TIMEZONES:548 10387 #, kde-format 10388 msgid "Central Standard Time - Resolute, Nunavut" 10389 msgstr "" 10390 10391 #. i18n: comment to the previous timezone 10392 #: kdecore/TIMEZONES:550 10393 #, kde-format 10394 msgid "Central - NU (Resolute)" 10395 msgstr "" 10396 10397 #: kdecore/TIMEZONES:551 10398 #, kde-format 10399 msgid "America/Rio_Branco" 10400 msgstr "" 10401 10402 #: kdecore/TIMEZONES:554 10403 #, kde-format 10404 msgid "America/Rosario" 10405 msgstr "" 10406 10407 #: kdecore/TIMEZONES:557 10408 #, kde-format 10409 msgid "America/Santa_Isabel" 10410 msgstr "" 10411 10412 #. i18n: comment to the previous timezone 10413 #: kdecore/TIMEZONES:559 10414 #, kde-format 10415 msgid "Mexican Pacific Time - Baja California away from US border" 10416 msgstr "" 10417 10418 #: kdecore/TIMEZONES:560 10419 #, kde-format 10420 msgid "America/Santarem" 10421 msgstr "" 10422 10423 #. i18n: comment to the previous timezone 10424 #: kdecore/TIMEZONES:562 10425 #, fuzzy, kde-format 10426 msgid "W Para" 10427 msgstr "měrca" 10428 10429 #. i18n: comment to the previous timezone 10430 #: kdecore/TIMEZONES:564 10431 #, kde-format 10432 msgid "Para (west)" 10433 msgstr "" 10434 10435 #: kdecore/TIMEZONES:565 10436 #, kde-format 10437 msgid "America/Santiago" 10438 msgstr "" 10439 10440 #. i18n: comment to the previous timezone 10441 #: kdecore/TIMEZONES:569 10442 #, kde-format 10443 msgid "Chile (most areas)" 10444 msgstr "" 10445 10446 #: kdecore/TIMEZONES:570 10447 #, kde-format 10448 msgid "America/Santo_Domingo" 10449 msgstr "" 10450 10451 #: kdecore/TIMEZONES:571 10452 #, kde-format 10453 msgid "America/Sao_Paulo" 10454 msgstr "" 10455 10456 #. i18n: comment to the previous timezone 10457 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10458 #, kde-format 10459 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10460 msgstr "" 10461 10462 #. i18n: comment to the previous timezone 10463 #: kdecore/TIMEZONES:575 10464 #, kde-format 10465 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10466 msgstr "" 10467 10468 #: kdecore/TIMEZONES:576 10469 #, kde-format 10470 msgid "America/Saskatoon" 10471 msgstr "" 10472 10473 #: kdecore/TIMEZONES:579 10474 #, kde-format 10475 msgid "America/Scoresbysund" 10476 msgstr "" 10477 10478 #. i18n: comment to the previous timezone 10479 #: kdecore/TIMEZONES:581 10480 #, kde-format 10481 msgid "Scoresbysund / Ittoqqortoormiit" 10482 msgstr "" 10483 10484 #. i18n: comment to the previous timezone 10485 #: kdecore/TIMEZONES:583 10486 #, kde-format 10487 msgid "Scoresbysund/Ittoqqortoormiit" 10488 msgstr "" 10489 10490 #: kdecore/TIMEZONES:584 10491 #, kde-format 10492 msgid "America/Shiprock" 10493 msgstr "" 10494 10495 #. i18n: comment to the previous timezone 10496 #: kdecore/TIMEZONES:586 10497 #, kde-format 10498 msgid "Mountain Time - Navajo" 10499 msgstr "" 10500 10501 #: kdecore/TIMEZONES:587 10502 #, kde-format 10503 msgid "America/Sitka" 10504 msgstr "" 10505 10506 #. i18n: comment to the previous timezone 10507 #: kdecore/TIMEZONES:589 10508 #, kde-format 10509 msgid "Alaska Time - southeast Alaska panhandle" 10510 msgstr "" 10511 10512 #. i18n: comment to the previous timezone 10513 #: kdecore/TIMEZONES:591 10514 #, kde-format 10515 msgid "Alaska - Sitka area" 10516 msgstr "" 10517 10518 #: kdecore/TIMEZONES:592 10519 #, kde-format 10520 msgid "America/St_Barthelemy" 10521 msgstr "" 10522 10523 #: kdecore/TIMEZONES:593 10524 #, kde-format 10525 msgid "America/St_Johns" 10526 msgstr "" 10527 10528 #. i18n: comment to the previous timezone 10529 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10530 #, kde-format 10531 msgid "Newfoundland Time, including SE Labrador" 10532 msgstr "" 10533 10534 #. i18n: comment to the previous timezone 10535 #: kdecore/TIMEZONES:597 10536 #, kde-format 10537 msgid "Newfoundland; Labrador (southeast)" 10538 msgstr "" 10539 10540 #: kdecore/TIMEZONES:598 10541 #, kde-format 10542 msgid "America/St_Kitts" 10543 msgstr "" 10544 10545 #: kdecore/TIMEZONES:599 10546 #, kde-format 10547 msgid "America/St_Lucia" 10548 msgstr "" 10549 10550 #: kdecore/TIMEZONES:600 10551 #, kde-format 10552 msgid "America/St_Thomas" 10553 msgstr "" 10554 10555 #: kdecore/TIMEZONES:601 10556 #, kde-format 10557 msgid "America/St_Vincent" 10558 msgstr "" 10559 10560 #: kdecore/TIMEZONES:602 10561 #, kde-format 10562 msgid "America/Swift_Current" 10563 msgstr "" 10564 10565 #. i18n: comment to the previous timezone 10566 #: kdecore/TIMEZONES:604 10567 #, kde-format 10568 msgid "Central Standard Time - Saskatchewan - midwest" 10569 msgstr "" 10570 10571 #. i18n: comment to the previous timezone 10572 #: kdecore/TIMEZONES:606 10573 #, kde-format 10574 msgid "CST - SK (midwest)" 10575 msgstr "" 10576 10577 #: kdecore/TIMEZONES:607 10578 #, kde-format 10579 msgid "America/Tegucigalpa" 10580 msgstr "" 10581 10582 #: kdecore/TIMEZONES:608 10583 #, kde-format 10584 msgid "America/Thule" 10585 msgstr "" 10586 10587 #. i18n: comment to the previous timezone 10588 #: kdecore/TIMEZONES:610 10589 #, kde-format 10590 msgid "Thule / Pituffik" 10591 msgstr "" 10592 10593 #. i18n: comment to the previous timezone 10594 #: kdecore/TIMEZONES:612 10595 #, kde-format 10596 msgid "Thule/Pituffik" 10597 msgstr "" 10598 10599 #: kdecore/TIMEZONES:613 10600 #, kde-format 10601 msgid "America/Thunder_Bay" 10602 msgstr "" 10603 10604 #. i18n: comment to the previous timezone 10605 #: kdecore/TIMEZONES:615 10606 #, kde-format 10607 msgid "Eastern Time - Thunder Bay, Ontario" 10608 msgstr "" 10609 10610 #. i18n: comment to the previous timezone 10611 #: kdecore/TIMEZONES:617 10612 #, kde-format 10613 msgid "Eastern - ON (Thunder Bay)" 10614 msgstr "" 10615 10616 #: kdecore/TIMEZONES:618 10617 #, kde-format 10618 msgid "America/Tijuana" 10619 msgstr "" 10620 10621 #. i18n: comment to the previous timezone 10622 #: kdecore/TIMEZONES:622 10623 #, kde-format 10624 msgid "US Pacific Time - Baja California near US border" 10625 msgstr "" 10626 10627 #. i18n: comment to the previous timezone 10628 #: kdecore/TIMEZONES:624 10629 #, kde-format 10630 msgid "Pacific Time US - Baja California" 10631 msgstr "" 10632 10633 #: kdecore/TIMEZONES:625 10634 #, kde-format 10635 msgid "America/Toronto" 10636 msgstr "" 10637 10638 #. i18n: comment to the previous timezone 10639 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10640 #, kde-format 10641 msgid "Eastern Time - Ontario - most locations" 10642 msgstr "" 10643 10644 #. i18n: comment to the previous timezone 10645 #: kdecore/TIMEZONES:629 10646 #, kde-format 10647 msgid "Eastern - ON, QC (most areas)" 10648 msgstr "" 10649 10650 #: kdecore/TIMEZONES:630 10651 #, kde-format 10652 msgid "America/Tortola" 10653 msgstr "" 10654 10655 #: kdecore/TIMEZONES:631 10656 #, kde-format 10657 msgid "America/Vancouver" 10658 msgstr "" 10659 10660 #. i18n: comment to the previous timezone 10661 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10662 #, kde-format 10663 msgid "Pacific Time - west British Columbia" 10664 msgstr "" 10665 10666 #. i18n: comment to the previous timezone 10667 #: kdecore/TIMEZONES:635 10668 #, kde-format 10669 msgid "Pacific - BC (most areas)" 10670 msgstr "" 10671 10672 #: kdecore/TIMEZONES:636 10673 #, kde-format 10674 msgid "America/Virgin" 10675 msgstr "" 10676 10677 #: kdecore/TIMEZONES:637 10678 #, kde-format 10679 msgid "America/Whitehorse" 10680 msgstr "" 10681 10682 #. i18n: comment to the previous timezone 10683 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10684 #, kde-format 10685 msgid "Pacific Time - south Yukon" 10686 msgstr "" 10687 10688 #. i18n: comment to the previous timezone 10689 #: kdecore/TIMEZONES:641 10690 #, kde-format 10691 msgid "MST - Yukon (east)" 10692 msgstr "" 10693 10694 #: kdecore/TIMEZONES:642 10695 #, kde-format 10696 msgid "America/Winnipeg" 10697 msgstr "" 10698 10699 #. i18n: comment to the previous timezone 10700 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10701 #, kde-format 10702 msgid "Central Time - Manitoba & west Ontario" 10703 msgstr "" 10704 10705 #. i18n: comment to the previous timezone 10706 #: kdecore/TIMEZONES:646 10707 #, kde-format 10708 msgid "Central - ON (west); Manitoba" 10709 msgstr "" 10710 10711 #: kdecore/TIMEZONES:647 10712 #, kde-format 10713 msgid "America/Yakutat" 10714 msgstr "" 10715 10716 #. i18n: comment to the previous timezone 10717 #: kdecore/TIMEZONES:649 10718 #, kde-format 10719 msgid "Alaska Time - Alaska panhandle neck" 10720 msgstr "" 10721 10722 #. i18n: comment to the previous timezone 10723 #: kdecore/TIMEZONES:651 10724 #, kde-format 10725 msgid "Alaska - Yakutat" 10726 msgstr "" 10727 10728 #: kdecore/TIMEZONES:652 10729 #, kde-format 10730 msgid "America/Yellowknife" 10731 msgstr "" 10732 10733 #. i18n: comment to the previous timezone 10734 #: kdecore/TIMEZONES:654 10735 #, kde-format 10736 msgid "Mountain Time - central Northwest Territories" 10737 msgstr "" 10738 10739 #. i18n: comment to the previous timezone 10740 #: kdecore/TIMEZONES:656 10741 #, kde-format 10742 msgid "Mountain - NT (central)" 10743 msgstr "" 10744 10745 #: kdecore/TIMEZONES:657 10746 #, kde-format 10747 msgid "Antarctica/Casey" 10748 msgstr "" 10749 10750 #. i18n: comment to the previous timezone 10751 #: kdecore/TIMEZONES:659 10752 #, kde-format 10753 msgid "Casey Station, Bailey Peninsula" 10754 msgstr "" 10755 10756 #. i18n: comment to the previous timezone 10757 #: kdecore/TIMEZONES:661 10758 #, kde-format 10759 msgid "Casey" 10760 msgstr "" 10761 10762 #: kdecore/TIMEZONES:662 10763 #, kde-format 10764 msgid "Antarctica/Davis" 10765 msgstr "" 10766 10767 #. i18n: comment to the previous timezone 10768 #: kdecore/TIMEZONES:664 10769 #, kde-format 10770 msgid "Davis Station, Vestfold Hills" 10771 msgstr "" 10772 10773 #. i18n: comment to the previous timezone 10774 #: kdecore/TIMEZONES:666 10775 #, kde-format 10776 msgid "Davis" 10777 msgstr "" 10778 10779 #: kdecore/TIMEZONES:667 10780 #, kde-format 10781 msgid "Antarctica/DumontDUrville" 10782 msgstr "" 10783 10784 #. i18n: comment to the previous timezone 10785 #: kdecore/TIMEZONES:669 10786 #, kde-format 10787 msgid "Dumont-d'Urville Station, Terre Adelie" 10788 msgstr "" 10789 10790 #. i18n: comment to the previous timezone 10791 #: kdecore/TIMEZONES:671 10792 #, kde-format 10793 msgid "Dumont-d'Urville" 10794 msgstr "" 10795 10796 #: kdecore/TIMEZONES:672 10797 #, kde-format 10798 msgid "Antarctica/Macquarie" 10799 msgstr "" 10800 10801 #. i18n: comment to the previous timezone 10802 #: kdecore/TIMEZONES:674 10803 #, kde-format 10804 msgid "Macquarie Island Station, Macquarie Island" 10805 msgstr "" 10806 10807 #. i18n: comment to the previous timezone 10808 #: kdecore/TIMEZONES:676 10809 #, kde-format 10810 msgid "Macquarie Island" 10811 msgstr "" 10812 10813 #: kdecore/TIMEZONES:677 10814 #, kde-format 10815 msgid "Antarctica/Mawson" 10816 msgstr "" 10817 10818 #. i18n: comment to the previous timezone 10819 #: kdecore/TIMEZONES:679 10820 #, kde-format 10821 msgid "Mawson Station, Holme Bay" 10822 msgstr "" 10823 10824 #. i18n: comment to the previous timezone 10825 #: kdecore/TIMEZONES:681 10826 #, kde-format 10827 msgid "Mawson" 10828 msgstr "" 10829 10830 #: kdecore/TIMEZONES:682 10831 #, kde-format 10832 msgid "Antarctica/McMurdo" 10833 msgstr "" 10834 10835 #. i18n: comment to the previous timezone 10836 #: kdecore/TIMEZONES:684 10837 #, kde-format 10838 msgid "McMurdo Station, Ross Island" 10839 msgstr "" 10840 10841 #. i18n: comment to the previous timezone 10842 #: kdecore/TIMEZONES:686 10843 #, kde-format 10844 msgid "New Zealand time - McMurdo, South Pole" 10845 msgstr "" 10846 10847 #: kdecore/TIMEZONES:687 10848 #, kde-format 10849 msgid "Antarctica/Palmer" 10850 msgstr "" 10851 10852 #. i18n: comment to the previous timezone 10853 #: kdecore/TIMEZONES:689 10854 #, kde-format 10855 msgid "Palmer Station, Anvers Island" 10856 msgstr "" 10857 10858 #. i18n: comment to the previous timezone 10859 #: kdecore/TIMEZONES:691 10860 #, kde-format 10861 msgid "Palmer" 10862 msgstr "" 10863 10864 #: kdecore/TIMEZONES:692 10865 #, kde-format 10866 msgid "Antarctica/Rothera" 10867 msgstr "" 10868 10869 #. i18n: comment to the previous timezone 10870 #: kdecore/TIMEZONES:694 10871 #, kde-format 10872 msgid "Rothera Station, Adelaide Island" 10873 msgstr "" 10874 10875 #. i18n: comment to the previous timezone 10876 #: kdecore/TIMEZONES:696 10877 #, kde-format 10878 msgid "Rothera" 10879 msgstr "" 10880 10881 #: kdecore/TIMEZONES:697 10882 #, kde-format 10883 msgid "Antarctica/South_Pole" 10884 msgstr "" 10885 10886 #. i18n: comment to the previous timezone 10887 #: kdecore/TIMEZONES:699 10888 #, kde-format 10889 msgid "Amundsen-Scott Station, South Pole" 10890 msgstr "" 10891 10892 #: kdecore/TIMEZONES:700 10893 #, kde-format 10894 msgid "Antarctica/Syowa" 10895 msgstr "" 10896 10897 #. i18n: comment to the previous timezone 10898 #: kdecore/TIMEZONES:702 10899 #, kde-format 10900 msgid "Syowa Station, E Ongul I" 10901 msgstr "" 10902 10903 #. i18n: comment to the previous timezone 10904 #: kdecore/TIMEZONES:704 10905 #, kde-format 10906 msgid "Syowa" 10907 msgstr "" 10908 10909 #: kdecore/TIMEZONES:705 10910 #, kde-format 10911 msgid "Antarctica/Troll" 10912 msgstr "" 10913 10914 #. i18n: comment to the previous timezone 10915 #: kdecore/TIMEZONES:707 10916 #, kde-format 10917 msgid "Troll" 10918 msgstr "" 10919 10920 #: kdecore/TIMEZONES:708 10921 #, kde-format 10922 msgid "Antarctica/Vostok" 10923 msgstr "" 10924 10925 #. i18n: comment to the previous timezone 10926 #: kdecore/TIMEZONES:710 10927 #, kde-format 10928 msgid "Vostok Station, S Magnetic Pole" 10929 msgstr "" 10930 10931 #. i18n: comment to the previous timezone 10932 #: kdecore/TIMEZONES:712 10933 #, kde-format 10934 msgid "Vostok Station, Lake Vostok" 10935 msgstr "" 10936 10937 #. i18n: comment to the previous timezone 10938 #: kdecore/TIMEZONES:714 10939 #, kde-format 10940 msgid "Vostok" 10941 msgstr "" 10942 10943 #: kdecore/TIMEZONES:715 10944 #, kde-format 10945 msgid "Arctic/Longyearbyen" 10946 msgstr "" 10947 10948 #: kdecore/TIMEZONES:716 10949 #, kde-format 10950 msgid "Asia/Aden" 10951 msgstr "" 10952 10953 #: kdecore/TIMEZONES:717 10954 #, kde-format 10955 msgid "Asia/Almaty" 10956 msgstr "" 10957 10958 #. i18n: comment to the previous timezone 10959 #: kdecore/TIMEZONES:721 10960 #, kde-format 10961 msgid "Kazakhstan (most areas)" 10962 msgstr "" 10963 10964 #: kdecore/TIMEZONES:722 10965 #, kde-format 10966 msgid "Asia/Amman" 10967 msgstr "" 10968 10969 #: kdecore/TIMEZONES:723 10970 #, kde-format 10971 msgid "Asia/Anadyr" 10972 msgstr "" 10973 10974 #. i18n: comment to the previous timezone 10975 #: kdecore/TIMEZONES:725 10976 #, kde-format 10977 msgid "Moscow+10 - Bering Sea" 10978 msgstr "" 10979 10980 #. i18n: comment to the previous timezone 10981 #: kdecore/TIMEZONES:727 10982 #, kde-format 10983 msgid "Moscow+08 - Bering Sea" 10984 msgstr "" 10985 10986 #. i18n: comment to the previous timezone 10987 #: kdecore/TIMEZONES:729 10988 #, kde-format 10989 msgid "MSK+09 - Bering Sea" 10990 msgstr "" 10991 10992 #: kdecore/TIMEZONES:730 10993 #, kde-format 10994 msgid "Asia/Aqtau" 10995 msgstr "" 10996 10997 #. i18n: comment to the previous timezone 10998 #: kdecore/TIMEZONES:732 10999 #, kde-format 11000 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11001 msgstr "" 11002 11003 #. i18n: comment to the previous timezone 11004 #: kdecore/TIMEZONES:734 11005 #, kde-format 11006 msgid "Mangghystau/Mankistau" 11007 msgstr "" 11008 11009 #: kdecore/TIMEZONES:735 11010 #, kde-format 11011 msgid "Asia/Aqtobe" 11012 msgstr "" 11013 11014 #. i18n: comment to the previous timezone 11015 #: kdecore/TIMEZONES:737 11016 #, kde-format 11017 msgid "Aqtobe (Aktobe)" 11018 msgstr "" 11019 11020 #. i18n: comment to the previous timezone 11021 #: kdecore/TIMEZONES:739 11022 #, kde-format 11023 msgid "Aqtobe/Aktobe" 11024 msgstr "" 11025 11026 #: kdecore/TIMEZONES:740 11027 #, kde-format 11028 msgid "Asia/Ashgabat" 11029 msgstr "" 11030 11031 #: kdecore/TIMEZONES:741 11032 #, kde-format 11033 msgid "Asia/Ashkhabad" 11034 msgstr "" 11035 11036 #: kdecore/TIMEZONES:742 11037 #, kde-format 11038 msgid "Asia/Atyrau" 11039 msgstr "" 11040 11041 #. i18n: comment to the previous timezone 11042 #: kdecore/TIMEZONES:744 11043 #, kde-format 11044 msgid "Atyrau/Atirau/Gur'yev" 11045 msgstr "" 11046 11047 #: kdecore/TIMEZONES:745 11048 #, kde-format 11049 msgid "Asia/Baghdad" 11050 msgstr "" 11051 11052 #: kdecore/TIMEZONES:746 11053 #, kde-format 11054 msgid "Asia/Bahrain" 11055 msgstr "" 11056 11057 #: kdecore/TIMEZONES:747 11058 #, kde-format 11059 msgid "Asia/Baku" 11060 msgstr "" 11061 11062 #: kdecore/TIMEZONES:748 11063 #, kde-format 11064 msgid "Asia/Bangkok" 11065 msgstr "" 11066 11067 #: kdecore/TIMEZONES:749 11068 #, kde-format 11069 msgid "Asia/Barnaul" 11070 msgstr "" 11071 11072 #. i18n: comment to the previous timezone 11073 #: kdecore/TIMEZONES:751 11074 #, kde-format 11075 msgid "MSK+04 - Altai" 11076 msgstr "" 11077 11078 #: kdecore/TIMEZONES:752 11079 #, kde-format 11080 msgid "Asia/Beijing" 11081 msgstr "" 11082 11083 #. i18n: comment to the previous timezone 11084 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11085 #, kde-format 11086 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11087 msgstr "" 11088 11089 #. i18n: comment to the previous timezone 11090 #: kdecore/TIMEZONES:756 11091 #, kde-format 11092 msgid "China Standard Time" 11093 msgstr "" 11094 11095 #: kdecore/TIMEZONES:757 11096 #, kde-format 11097 msgid "Asia/Beirut" 11098 msgstr "" 11099 11100 #: kdecore/TIMEZONES:758 11101 #, kde-format 11102 msgid "Asia/Bishkek" 11103 msgstr "" 11104 11105 #: kdecore/TIMEZONES:759 11106 #, kde-format 11107 msgid "Asia/Brunei" 11108 msgstr "" 11109 11110 #: kdecore/TIMEZONES:760 11111 #, kde-format 11112 msgid "Asia/Calcutta" 11113 msgstr "" 11114 11115 #: kdecore/TIMEZONES:761 11116 #, fuzzy, kde-format 11117 #| msgid "Do shanbe" 11118 msgid "Asia/Chita" 11119 msgstr "Do shanbe" 11120 11121 #. i18n: comment to the previous timezone 11122 #: kdecore/TIMEZONES:763 11123 #, kde-format 11124 msgid "MSK+06 - Zabaykalsky" 11125 msgstr "" 11126 11127 #: kdecore/TIMEZONES:764 11128 #, kde-format 11129 msgid "Asia/Choibalsan" 11130 msgstr "" 11131 11132 #. i18n: comment to the previous timezone 11133 #: kdecore/TIMEZONES:766 11134 #, kde-format 11135 msgid "Dornod, Sukhbaatar" 11136 msgstr "" 11137 11138 #: kdecore/TIMEZONES:767 11139 #, kde-format 11140 msgid "Asia/Chongqing" 11141 msgstr "" 11142 11143 #. i18n: comment to the previous timezone 11144 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11145 #, kde-format 11146 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11147 msgstr "" 11148 11149 #. i18n: comment to the previous timezone 11150 #: kdecore/TIMEZONES:771 11151 #, kde-format 11152 msgid "China mountains" 11153 msgstr "" 11154 11155 #: kdecore/TIMEZONES:772 11156 #, kde-format 11157 msgid "Asia/Chungking" 11158 msgstr "" 11159 11160 #: kdecore/TIMEZONES:775 11161 #, kde-format 11162 msgid "Asia/Colombo" 11163 msgstr "" 11164 11165 #: kdecore/TIMEZONES:776 11166 #, kde-format 11167 msgid "Asia/Dacca" 11168 msgstr "" 11169 11170 #: kdecore/TIMEZONES:777 11171 #, kde-format 11172 msgid "Asia/Damascus" 11173 msgstr "" 11174 11175 #: kdecore/TIMEZONES:778 11176 #, kde-format 11177 msgid "Asia/Dhaka" 11178 msgstr "" 11179 11180 #: kdecore/TIMEZONES:779 11181 #, kde-format 11182 msgid "Asia/Dili" 11183 msgstr "" 11184 11185 #: kdecore/TIMEZONES:780 11186 #, kde-format 11187 msgid "Asia/Dubai" 11188 msgstr "" 11189 11190 #: kdecore/TIMEZONES:781 11191 #, fuzzy, kde-format 11192 #| msgid "Do shanbe" 11193 msgid "Asia/Dushanbe" 11194 msgstr "Do shanbe" 11195 11196 #: kdecore/TIMEZONES:782 11197 #, kde-format 11198 msgid "Asia/Famagusta" 11199 msgstr "" 11200 11201 #. i18n: comment to the previous timezone 11202 #: kdecore/TIMEZONES:784 11203 #, kde-format 11204 msgid "Northern Cyprus" 11205 msgstr "" 11206 11207 #: kdecore/TIMEZONES:785 11208 #, kde-format 11209 msgid "Asia/Gaza" 11210 msgstr "" 11211 11212 #. i18n: comment to the previous timezone 11213 #: kdecore/TIMEZONES:787 11214 #, kde-format 11215 msgid "Gaza Strip" 11216 msgstr "" 11217 11218 #: kdecore/TIMEZONES:788 11219 #, kde-format 11220 msgid "Asia/Harbin" 11221 msgstr "" 11222 11223 #. i18n: comment to the previous timezone 11224 #: kdecore/TIMEZONES:790 11225 #, kde-format 11226 msgid "Heilongjiang (except Mohe), Jilin" 11227 msgstr "" 11228 11229 #. i18n: comment to the previous timezone 11230 #: kdecore/TIMEZONES:792 11231 #, kde-format 11232 msgid "China north" 11233 msgstr "" 11234 11235 #: kdecore/TIMEZONES:793 11236 #, kde-format 11237 msgid "Asia/Hebron" 11238 msgstr "" 11239 11240 #. i18n: comment to the previous timezone 11241 #: kdecore/TIMEZONES:795 11242 #, kde-format 11243 msgid "West Bank" 11244 msgstr "" 11245 11246 #: kdecore/TIMEZONES:796 11247 #, kde-format 11248 msgid "Asia/Ho_Chi_Minh" 11249 msgstr "" 11250 11251 #: kdecore/TIMEZONES:797 11252 #, kde-format 11253 msgid "Asia/Hong_Kong" 11254 msgstr "" 11255 11256 #: kdecore/TIMEZONES:798 11257 #, kde-format 11258 msgid "Asia/Hovd" 11259 msgstr "" 11260 11261 #. i18n: comment to the previous timezone 11262 #: kdecore/TIMEZONES:800 11263 #, kde-format 11264 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11265 msgstr "" 11266 11267 #: kdecore/TIMEZONES:801 11268 #, kde-format 11269 msgid "Asia/Irkutsk" 11270 msgstr "" 11271 11272 #. i18n: comment to the previous timezone 11273 #: kdecore/TIMEZONES:803 11274 #, kde-format 11275 msgid "Moscow+05 - Lake Baikal" 11276 msgstr "" 11277 11278 #. i18n: comment to the previous timezone 11279 #: kdecore/TIMEZONES:805 11280 #, kde-format 11281 msgid "MSK+05 - Irkutsk, Buryatia" 11282 msgstr "" 11283 11284 #: kdecore/TIMEZONES:806 11285 #, kde-format 11286 msgid "Asia/Jakarta" 11287 msgstr "" 11288 11289 #. i18n: comment to the previous timezone 11290 #: kdecore/TIMEZONES:808 11291 #, kde-format 11292 msgid "Java & Sumatra" 11293 msgstr "" 11294 11295 #. i18n: comment to the previous timezone 11296 #: kdecore/TIMEZONES:810 11297 #, kde-format 11298 msgid "Java, Sumatra" 11299 msgstr "" 11300 11301 #: kdecore/TIMEZONES:811 11302 #, kde-format 11303 msgid "Asia/Jayapura" 11304 msgstr "" 11305 11306 #. i18n: comment to the previous timezone 11307 #: kdecore/TIMEZONES:813 11308 #, kde-format 11309 msgid "Irian Jaya & the Moluccas" 11310 msgstr "" 11311 11312 #. i18n: comment to the previous timezone 11313 #: kdecore/TIMEZONES:815 11314 #, kde-format 11315 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11316 msgstr "" 11317 11318 #. i18n: comment to the previous timezone 11319 #: kdecore/TIMEZONES:817 11320 #, kde-format 11321 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11322 msgstr "" 11323 11324 #: kdecore/TIMEZONES:818 11325 #, kde-format 11326 msgid "Asia/Jerusalem" 11327 msgstr "" 11328 11329 #: kdecore/TIMEZONES:819 11330 #, kde-format 11331 msgid "Asia/Kabul" 11332 msgstr "" 11333 11334 #: kdecore/TIMEZONES:820 11335 #, kde-format 11336 msgid "Asia/Kamchatka" 11337 msgstr "" 11338 11339 #. i18n: comment to the previous timezone 11340 #: kdecore/TIMEZONES:822 11341 #, kde-format 11342 msgid "Moscow+09 - Kamchatka" 11343 msgstr "" 11344 11345 #. i18n: comment to the previous timezone 11346 #: kdecore/TIMEZONES:824 11347 #, kde-format 11348 msgid "Moscow+08 - Kamchatka" 11349 msgstr "" 11350 11351 #. i18n: comment to the previous timezone 11352 #: kdecore/TIMEZONES:826 11353 #, kde-format 11354 msgid "MSK+09 - Kamchatka" 11355 msgstr "" 11356 11357 #: kdecore/TIMEZONES:827 11358 #, kde-format 11359 msgid "Asia/Karachi" 11360 msgstr "" 11361 11362 #: kdecore/TIMEZONES:828 11363 #, kde-format 11364 msgid "Asia/Kashgar" 11365 msgstr "" 11366 11367 #. i18n: comment to the previous timezone 11368 #: kdecore/TIMEZONES:830 11369 #, kde-format 11370 msgid "west Tibet & Xinjiang" 11371 msgstr "" 11372 11373 #. i18n: comment to the previous timezone 11374 #: kdecore/TIMEZONES:832 11375 #, kde-format 11376 msgid "China west Xinjiang" 11377 msgstr "" 11378 11379 #: kdecore/TIMEZONES:833 11380 #, kde-format 11381 msgid "Asia/Kathmandu" 11382 msgstr "" 11383 11384 #: kdecore/TIMEZONES:834 11385 #, kde-format 11386 msgid "Asia/Katmandu" 11387 msgstr "" 11388 11389 #: kdecore/TIMEZONES:835 11390 #, fuzzy, kde-format 11391 #| msgid "Do shanbe" 11392 msgid "Asia/Khandyga" 11393 msgstr "Do shanbe" 11394 11395 #. i18n: comment to the previous timezone 11396 #: kdecore/TIMEZONES:837 11397 #, kde-format 11398 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11399 msgstr "" 11400 11401 #: kdecore/TIMEZONES:838 11402 #, kde-format 11403 msgid "Asia/Kolkata" 11404 msgstr "" 11405 11406 #: kdecore/TIMEZONES:839 11407 #, kde-format 11408 msgid "Asia/Krasnoyarsk" 11409 msgstr "" 11410 11411 #. i18n: comment to the previous timezone 11412 #: kdecore/TIMEZONES:841 11413 #, kde-format 11414 msgid "Moscow+04 - Yenisei River" 11415 msgstr "" 11416 11417 #. i18n: comment to the previous timezone 11418 #: kdecore/TIMEZONES:843 11419 #, kde-format 11420 msgid "MSK+04 - Krasnoyarsk area" 11421 msgstr "" 11422 11423 #: kdecore/TIMEZONES:844 11424 #, kde-format 11425 msgid "Asia/Kuala_Lumpur" 11426 msgstr "" 11427 11428 #. i18n: comment to the previous timezone 11429 #: kdecore/TIMEZONES:846 11430 #, kde-format 11431 msgid "peninsular Malaysia" 11432 msgstr "" 11433 11434 #. i18n: comment to the previous timezone 11435 #: kdecore/TIMEZONES:848 11436 #, kde-format 11437 msgid "Malaysia (peninsula)" 11438 msgstr "" 11439 11440 #: kdecore/TIMEZONES:849 11441 #, kde-format 11442 msgid "Asia/Kuching" 11443 msgstr "" 11444 11445 #. i18n: comment to the previous timezone 11446 #: kdecore/TIMEZONES:851 11447 #, kde-format 11448 msgid "Sabah & Sarawak" 11449 msgstr "" 11450 11451 #. i18n: comment to the previous timezone 11452 #: kdecore/TIMEZONES:853 11453 #, kde-format 11454 msgid "Sabah, Sarawak" 11455 msgstr "" 11456 11457 #: kdecore/TIMEZONES:854 11458 #, kde-format 11459 msgid "Asia/Kuwait" 11460 msgstr "" 11461 11462 #: kdecore/TIMEZONES:855 11463 #, kde-format 11464 msgid "Asia/Macao" 11465 msgstr "" 11466 11467 #: kdecore/TIMEZONES:856 11468 #, kde-format 11469 msgid "Asia/Macau" 11470 msgstr "" 11471 11472 #: kdecore/TIMEZONES:857 11473 #, kde-format 11474 msgid "Asia/Magadan" 11475 msgstr "" 11476 11477 #. i18n: comment to the previous timezone 11478 #: kdecore/TIMEZONES:859 11479 #, kde-format 11480 msgid "Moscow+08 - Magadan" 11481 msgstr "" 11482 11483 #. i18n: comment to the previous timezone 11484 #: kdecore/TIMEZONES:861 11485 #, kde-format 11486 msgid "MSK+08 - Magadan" 11487 msgstr "" 11488 11489 #: kdecore/TIMEZONES:862 11490 #, kde-format 11491 msgid "Asia/Makassar" 11492 msgstr "" 11493 11494 #. i18n: comment to the previous timezone 11495 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11496 #, kde-format 11497 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11498 msgstr "" 11499 11500 #. i18n: comment to the previous timezone 11501 #: kdecore/TIMEZONES:866 11502 #, kde-format 11503 msgid "" 11504 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11505 msgstr "" 11506 11507 #. i18n: comment to the previous timezone 11508 #: kdecore/TIMEZONES:868 11509 #, kde-format 11510 msgid "" 11511 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11512 msgstr "" 11513 11514 #: kdecore/TIMEZONES:869 11515 #, kde-format 11516 msgid "Asia/Manila" 11517 msgstr "" 11518 11519 #: kdecore/TIMEZONES:870 11520 #, kde-format 11521 msgid "Asia/Muscat" 11522 msgstr "" 11523 11524 #: kdecore/TIMEZONES:871 11525 #, kde-format 11526 msgid "Asia/Nicosia" 11527 msgstr "" 11528 11529 #. i18n: comment to the previous timezone 11530 #: kdecore/TIMEZONES:873 11531 #, kde-format 11532 msgid "Cyprus (most areas)" 11533 msgstr "" 11534 11535 #: kdecore/TIMEZONES:874 11536 #, kde-format 11537 msgid "Asia/Novokuznetsk" 11538 msgstr "" 11539 11540 #. i18n: comment to the previous timezone 11541 #: kdecore/TIMEZONES:876 11542 #, kde-format 11543 msgid "Moscow+03 - Novokuznetsk" 11544 msgstr "" 11545 11546 #. i18n: comment to the previous timezone 11547 #: kdecore/TIMEZONES:878 11548 #, kde-format 11549 msgid "MSK+04 - Kemerovo" 11550 msgstr "" 11551 11552 #: kdecore/TIMEZONES:879 11553 #, kde-format 11554 msgid "Asia/Novosibirsk" 11555 msgstr "" 11556 11557 #. i18n: comment to the previous timezone 11558 #: kdecore/TIMEZONES:881 11559 #, kde-format 11560 msgid "Moscow+03 - Novosibirsk" 11561 msgstr "" 11562 11563 #. i18n: comment to the previous timezone 11564 #: kdecore/TIMEZONES:883 11565 #, kde-format 11566 msgid "MSK+04 - Novosibirsk" 11567 msgstr "" 11568 11569 #: kdecore/TIMEZONES:884 11570 #, kde-format 11571 msgid "Asia/Omsk" 11572 msgstr "" 11573 11574 #. i18n: comment to the previous timezone 11575 #: kdecore/TIMEZONES:886 11576 #, kde-format 11577 msgid "Moscow+03 - west Siberia" 11578 msgstr "" 11579 11580 #. i18n: comment to the previous timezone 11581 #: kdecore/TIMEZONES:888 11582 #, kde-format 11583 msgid "MSK+03 - Omsk" 11584 msgstr "" 11585 11586 #: kdecore/TIMEZONES:889 11587 #, kde-format 11588 msgid "Asia/Oral" 11589 msgstr "" 11590 11591 #. i18n: comment to the previous timezone 11592 #: kdecore/TIMEZONES:891 11593 #, kde-format 11594 msgid "West Kazakhstan" 11595 msgstr "" 11596 11597 #: kdecore/TIMEZONES:892 11598 #, kde-format 11599 msgid "Asia/Phnom_Penh" 11600 msgstr "" 11601 11602 #: kdecore/TIMEZONES:893 11603 #, kde-format 11604 msgid "Asia/Pontianak" 11605 msgstr "" 11606 11607 #. i18n: comment to the previous timezone 11608 #: kdecore/TIMEZONES:895 11609 #, kde-format 11610 msgid "west & central Borneo" 11611 msgstr "" 11612 11613 #. i18n: comment to the previous timezone 11614 #: kdecore/TIMEZONES:897 11615 #, kde-format 11616 msgid "Borneo (west, central)" 11617 msgstr "" 11618 11619 #: kdecore/TIMEZONES:898 11620 #, kde-format 11621 msgid "Asia/Pyongyang" 11622 msgstr "" 11623 11624 #: kdecore/TIMEZONES:899 11625 #, kde-format 11626 msgid "Asia/Qatar" 11627 msgstr "" 11628 11629 #: kdecore/TIMEZONES:900 11630 #, fuzzy, kde-format 11631 #| msgid "Do shanbe" 11632 msgid "Asia/Qostanay" 11633 msgstr "Do shanbe" 11634 11635 #. i18n: comment to the previous timezone 11636 #: kdecore/TIMEZONES:902 11637 #, kde-format 11638 msgid "Qostanay/Kostanay/Kustanay" 11639 msgstr "" 11640 11641 #: kdecore/TIMEZONES:903 11642 #, kde-format 11643 msgid "Asia/Qyzylorda" 11644 msgstr "" 11645 11646 #. i18n: comment to the previous timezone 11647 #: kdecore/TIMEZONES:905 11648 #, kde-format 11649 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11650 msgstr "" 11651 11652 #. i18n: comment to the previous timezone 11653 #: kdecore/TIMEZONES:907 11654 #, kde-format 11655 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11656 msgstr "" 11657 11658 #: kdecore/TIMEZONES:908 11659 #, kde-format 11660 msgid "Asia/Rangoon" 11661 msgstr "" 11662 11663 #: kdecore/TIMEZONES:909 11664 #, kde-format 11665 msgid "Asia/Riyadh" 11666 msgstr "" 11667 11668 #: kdecore/TIMEZONES:910 11669 #, kde-format 11670 msgid "Asia/Saigon" 11671 msgstr "" 11672 11673 #: kdecore/TIMEZONES:911 11674 #, kde-format 11675 msgid "Asia/Sakhalin" 11676 msgstr "" 11677 11678 #. i18n: comment to the previous timezone 11679 #: kdecore/TIMEZONES:913 11680 #, kde-format 11681 msgid "Moscow+07 - Sakhalin Island" 11682 msgstr "" 11683 11684 #. i18n: comment to the previous timezone 11685 #: kdecore/TIMEZONES:915 11686 #, kde-format 11687 msgid "MSK+08 - Sakhalin Island" 11688 msgstr "" 11689 11690 #: kdecore/TIMEZONES:916 11691 #, kde-format 11692 msgid "Asia/Samarkand" 11693 msgstr "" 11694 11695 #. i18n: comment to the previous timezone 11696 #: kdecore/TIMEZONES:918 11697 #, kde-format 11698 msgid "west Uzbekistan" 11699 msgstr "" 11700 11701 #. i18n: comment to the previous timezone 11702 #: kdecore/TIMEZONES:920 11703 #, kde-format 11704 msgid "Uzbekistan (west)" 11705 msgstr "" 11706 11707 #: kdecore/TIMEZONES:921 11708 #, kde-format 11709 msgid "Asia/Seoul" 11710 msgstr "" 11711 11712 #: kdecore/TIMEZONES:922 11713 #, kde-format 11714 msgid "Asia/Shanghai" 11715 msgstr "" 11716 11717 #. i18n: comment to the previous timezone 11718 #: kdecore/TIMEZONES:926 11719 #, kde-format 11720 msgid "China east" 11721 msgstr "" 11722 11723 #. i18n: comment to the previous timezone 11724 #: kdecore/TIMEZONES:928 11725 #, kde-format 11726 msgid "Beijing Time" 11727 msgstr "" 11728 11729 #: kdecore/TIMEZONES:929 11730 #, kde-format 11731 msgid "Asia/Singapore" 11732 msgstr "" 11733 11734 #: kdecore/TIMEZONES:930 11735 #, kde-format 11736 msgid "Asia/Srednekolymsk" 11737 msgstr "" 11738 11739 #. i18n: comment to the previous timezone 11740 #: kdecore/TIMEZONES:932 11741 #, kde-format 11742 msgid "MSK+08 - Sakha (E); North Kuril Is" 11743 msgstr "" 11744 11745 #: kdecore/TIMEZONES:933 11746 #, kde-format 11747 msgid "Asia/Taipei" 11748 msgstr "" 11749 11750 #: kdecore/TIMEZONES:934 11751 #, kde-format 11752 msgid "Asia/Tashkent" 11753 msgstr "" 11754 11755 #. i18n: comment to the previous timezone 11756 #: kdecore/TIMEZONES:936 11757 #, kde-format 11758 msgid "east Uzbekistan" 11759 msgstr "" 11760 11761 #. i18n: comment to the previous timezone 11762 #: kdecore/TIMEZONES:938 11763 #, kde-format 11764 msgid "Uzbekistan (east)" 11765 msgstr "" 11766 11767 #: kdecore/TIMEZONES:939 11768 #, kde-format 11769 msgid "Asia/Tbilisi" 11770 msgstr "" 11771 11772 #: kdecore/TIMEZONES:940 11773 #, kde-format 11774 msgid "Asia/Tehran" 11775 msgstr "" 11776 11777 #: kdecore/TIMEZONES:941 11778 #, kde-format 11779 msgid "Asia/Tel_Aviv" 11780 msgstr "" 11781 11782 #: kdecore/TIMEZONES:942 11783 #, kde-format 11784 msgid "Asia/Thimbu" 11785 msgstr "" 11786 11787 #: kdecore/TIMEZONES:943 11788 #, kde-format 11789 msgid "Asia/Thimphu" 11790 msgstr "" 11791 11792 #: kdecore/TIMEZONES:944 11793 #, kde-format 11794 msgid "Asia/Tokyo" 11795 msgstr "" 11796 11797 #: kdecore/TIMEZONES:945 11798 #, kde-format 11799 msgid "Asia/Tomsk" 11800 msgstr "" 11801 11802 #. i18n: comment to the previous timezone 11803 #: kdecore/TIMEZONES:947 11804 #, kde-format 11805 msgid "MSK+04 - Tomsk" 11806 msgstr "" 11807 11808 #: kdecore/TIMEZONES:948 11809 #, kde-format 11810 msgid "Asia/Ujung_Pandang" 11811 msgstr "" 11812 11813 #: kdecore/TIMEZONES:951 11814 #, kde-format 11815 msgid "Asia/Ulaanbaatar" 11816 msgstr "" 11817 11818 #. i18n: comment to the previous timezone 11819 #: kdecore/TIMEZONES:955 11820 #, kde-format 11821 msgid "Mongolia (most areas)" 11822 msgstr "" 11823 11824 #: kdecore/TIMEZONES:956 11825 #, kde-format 11826 msgid "Asia/Ulan_Bator" 11827 msgstr "" 11828 11829 #: kdecore/TIMEZONES:959 11830 #, kde-format 11831 msgid "Asia/Urumqi" 11832 msgstr "" 11833 11834 #. i18n: comment to the previous timezone 11835 #: kdecore/TIMEZONES:961 11836 #, kde-format 11837 msgid "most of Tibet & Xinjiang" 11838 msgstr "" 11839 11840 #. i18n: comment to the previous timezone 11841 #: kdecore/TIMEZONES:963 11842 #, kde-format 11843 msgid "China Xinjiang-Tibet" 11844 msgstr "" 11845 11846 #. i18n: comment to the previous timezone 11847 #: kdecore/TIMEZONES:965 11848 #, kde-format 11849 msgid "Xinjiang Time" 11850 msgstr "" 11851 11852 #: kdecore/TIMEZONES:966 11853 #, kde-format 11854 msgid "Asia/Ust-Nera" 11855 msgstr "" 11856 11857 #. i18n: comment to the previous timezone 11858 #: kdecore/TIMEZONES:968 11859 #, kde-format 11860 msgid "MSK+07 - Oymyakonsky" 11861 msgstr "" 11862 11863 #: kdecore/TIMEZONES:969 11864 #, kde-format 11865 msgid "Asia/Vientiane" 11866 msgstr "" 11867 11868 #: kdecore/TIMEZONES:970 11869 #, kde-format 11870 msgid "Asia/Vladivostok" 11871 msgstr "" 11872 11873 #. i18n: comment to the previous timezone 11874 #: kdecore/TIMEZONES:972 11875 #, kde-format 11876 msgid "Moscow+07 - Amur River" 11877 msgstr "" 11878 11879 #. i18n: comment to the previous timezone 11880 #: kdecore/TIMEZONES:974 11881 #, kde-format 11882 msgid "MSK+07 - Amur River" 11883 msgstr "" 11884 11885 #: kdecore/TIMEZONES:975 11886 #, kde-format 11887 msgid "Asia/Yakutsk" 11888 msgstr "" 11889 11890 #. i18n: comment to the previous timezone 11891 #: kdecore/TIMEZONES:977 11892 #, kde-format 11893 msgid "Moscow+06 - Lena River" 11894 msgstr "" 11895 11896 #. i18n: comment to the previous timezone 11897 #: kdecore/TIMEZONES:979 11898 #, kde-format 11899 msgid "MSK+06 - Lena River" 11900 msgstr "" 11901 11902 #: kdecore/TIMEZONES:980 11903 #, kde-format 11904 msgid "Asia/Yangon" 11905 msgstr "" 11906 11907 #: kdecore/TIMEZONES:981 11908 #, kde-format 11909 msgid "Asia/Yekaterinburg" 11910 msgstr "" 11911 11912 #. i18n: comment to the previous timezone 11913 #: kdecore/TIMEZONES:983 11914 #, kde-format 11915 msgid "Moscow+02 - Urals" 11916 msgstr "" 11917 11918 #. i18n: comment to the previous timezone 11919 #: kdecore/TIMEZONES:985 11920 #, kde-format 11921 msgid "MSK+02 - Urals" 11922 msgstr "" 11923 11924 #: kdecore/TIMEZONES:986 11925 #, kde-format 11926 msgid "Asia/Yerevan" 11927 msgstr "" 11928 11929 #: kdecore/TIMEZONES:987 11930 #, kde-format 11931 msgid "Atlantic/Azores" 11932 msgstr "" 11933 11934 #. i18n: comment to the previous timezone 11935 #: kdecore/TIMEZONES:989 11936 #, kde-format 11937 msgid "Azores" 11938 msgstr "" 11939 11940 #: kdecore/TIMEZONES:990 11941 #, kde-format 11942 msgid "Atlantic/Bermuda" 11943 msgstr "" 11944 11945 #: kdecore/TIMEZONES:991 11946 #, kde-format 11947 msgid "Atlantic/Canary" 11948 msgstr "" 11949 11950 #. i18n: comment to the previous timezone 11951 #: kdecore/TIMEZONES:993 11952 #, kde-format 11953 msgid "Canary Islands" 11954 msgstr "" 11955 11956 #: kdecore/TIMEZONES:994 11957 #, kde-format 11958 msgid "Atlantic/Cape_Verde" 11959 msgstr "" 11960 11961 #: kdecore/TIMEZONES:995 11962 #, kde-format 11963 msgid "Atlantic/Faeroe" 11964 msgstr "" 11965 11966 #: kdecore/TIMEZONES:996 11967 #, kde-format 11968 msgid "Atlantic/Faroe" 11969 msgstr "" 11970 11971 #: kdecore/TIMEZONES:997 11972 #, kde-format 11973 msgid "Atlantic/Jan_Mayen" 11974 msgstr "" 11975 11976 #: kdecore/TIMEZONES:998 11977 #, kde-format 11978 msgid "Atlantic/Madeira" 11979 msgstr "" 11980 11981 #. i18n: comment to the previous timezone 11982 #: kdecore/TIMEZONES:1000 11983 #, kde-format 11984 msgid "Madeira Islands" 11985 msgstr "" 11986 11987 #: kdecore/TIMEZONES:1001 11988 #, kde-format 11989 msgid "Atlantic/Reykjavik" 11990 msgstr "" 11991 11992 #: kdecore/TIMEZONES:1002 11993 #, kde-format 11994 msgid "Atlantic/South_Georgia" 11995 msgstr "" 11996 11997 #: kdecore/TIMEZONES:1003 11998 #, kde-format 11999 msgid "Atlantic/St_Helena" 12000 msgstr "" 12001 12002 #: kdecore/TIMEZONES:1004 12003 #, kde-format 12004 msgid "Atlantic/Stanley" 12005 msgstr "" 12006 12007 #: kdecore/TIMEZONES:1005 12008 #, kde-format 12009 msgid "Australia/ACT" 12010 msgstr "" 12011 12012 #. i18n: comment to the previous timezone 12013 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12014 #: kdecore/TIMEZONES:1073 12015 #, kde-format 12016 msgid "New South Wales - most locations" 12017 msgstr "" 12018 12019 #: kdecore/TIMEZONES:1008 12020 #, kde-format 12021 msgid "Australia/Adelaide" 12022 msgstr "" 12023 12024 #. i18n: comment to the previous timezone 12025 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12026 #, kde-format 12027 msgid "South Australia" 12028 msgstr "" 12029 12030 #: kdecore/TIMEZONES:1011 12031 #, kde-format 12032 msgid "Australia/Brisbane" 12033 msgstr "" 12034 12035 #. i18n: comment to the previous timezone 12036 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12037 #, kde-format 12038 msgid "Queensland - most locations" 12039 msgstr "" 12040 12041 #. i18n: comment to the previous timezone 12042 #: kdecore/TIMEZONES:1015 12043 #, kde-format 12044 msgid "Queensland (most areas)" 12045 msgstr "" 12046 12047 #: kdecore/TIMEZONES:1016 12048 #, kde-format 12049 msgid "Australia/Broken_Hill" 12050 msgstr "" 12051 12052 #. i18n: comment to the previous timezone 12053 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12054 #, kde-format 12055 msgid "New South Wales - Yancowinna" 12056 msgstr "" 12057 12058 #. i18n: comment to the previous timezone 12059 #: kdecore/TIMEZONES:1020 12060 #, kde-format 12061 msgid "New South Wales (Yancowinna)" 12062 msgstr "" 12063 12064 #: kdecore/TIMEZONES:1021 12065 #, kde-format 12066 msgid "Australia/Canberra" 12067 msgstr "" 12068 12069 #: kdecore/TIMEZONES:1024 12070 #, kde-format 12071 msgid "Australia/Currie" 12072 msgstr "" 12073 12074 #. i18n: comment to the previous timezone 12075 #: kdecore/TIMEZONES:1026 12076 #, kde-format 12077 msgid "Tasmania - King Island" 12078 msgstr "" 12079 12080 #: kdecore/TIMEZONES:1027 12081 #, kde-format 12082 msgid "Australia/Darwin" 12083 msgstr "" 12084 12085 #. i18n: comment to the previous timezone 12086 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12087 #, kde-format 12088 msgid "Northern Territory" 12089 msgstr "" 12090 12091 #: kdecore/TIMEZONES:1030 12092 #, kde-format 12093 msgid "Australia/Eucla" 12094 msgstr "" 12095 12096 #. i18n: comment to the previous timezone 12097 #: kdecore/TIMEZONES:1032 12098 #, kde-format 12099 msgid "Western Australia - Eucla area" 12100 msgstr "" 12101 12102 #. i18n: comment to the previous timezone 12103 #: kdecore/TIMEZONES:1034 12104 #, kde-format 12105 msgid "Western Australia (Eucla)" 12106 msgstr "" 12107 12108 #: kdecore/TIMEZONES:1035 12109 #, kde-format 12110 msgid "Australia/Hobart" 12111 msgstr "" 12112 12113 #. i18n: comment to the previous timezone 12114 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12115 #, kde-format 12116 msgid "Tasmania - most locations" 12117 msgstr "" 12118 12119 #. i18n: comment to the previous timezone 12120 #: kdecore/TIMEZONES:1039 12121 #, kde-format 12122 msgid "Tasmania" 12123 msgstr "" 12124 12125 #: kdecore/TIMEZONES:1040 12126 #, kde-format 12127 msgid "Australia/LHI" 12128 msgstr "" 12129 12130 #. i18n: comment to the previous timezone 12131 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12132 #, kde-format 12133 msgid "Lord Howe Island" 12134 msgstr "" 12135 12136 #: kdecore/TIMEZONES:1043 12137 #, kde-format 12138 msgid "Australia/Lindeman" 12139 msgstr "" 12140 12141 #. i18n: comment to the previous timezone 12142 #: kdecore/TIMEZONES:1045 12143 #, kde-format 12144 msgid "Queensland - Holiday Islands" 12145 msgstr "" 12146 12147 #. i18n: comment to the previous timezone 12148 #: kdecore/TIMEZONES:1047 12149 #, kde-format 12150 msgid "Queensland (Whitsunday Islands)" 12151 msgstr "" 12152 12153 #: kdecore/TIMEZONES:1048 12154 #, kde-format 12155 msgid "Australia/Lord_Howe" 12156 msgstr "" 12157 12158 #: kdecore/TIMEZONES:1051 12159 #, kde-format 12160 msgid "Australia/Melbourne" 12161 msgstr "" 12162 12163 #. i18n: comment to the previous timezone 12164 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12165 #, kde-format 12166 msgid "Victoria" 12167 msgstr "" 12168 12169 #: kdecore/TIMEZONES:1054 12170 #, kde-format 12171 msgid "Australia/NSW" 12172 msgstr "" 12173 12174 #: kdecore/TIMEZONES:1057 12175 #, kde-format 12176 msgid "Australia/North" 12177 msgstr "" 12178 12179 #: kdecore/TIMEZONES:1060 12180 #, kde-format 12181 msgid "Australia/Perth" 12182 msgstr "" 12183 12184 #. i18n: comment to the previous timezone 12185 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12186 #, kde-format 12187 msgid "Western Australia - most locations" 12188 msgstr "" 12189 12190 #. i18n: comment to the previous timezone 12191 #: kdecore/TIMEZONES:1064 12192 #, kde-format 12193 msgid "Western Australia (most areas)" 12194 msgstr "" 12195 12196 #: kdecore/TIMEZONES:1065 12197 #, kde-format 12198 msgid "Australia/Queensland" 12199 msgstr "" 12200 12201 #: kdecore/TIMEZONES:1068 12202 #, kde-format 12203 msgid "Australia/South" 12204 msgstr "" 12205 12206 #: kdecore/TIMEZONES:1071 12207 #, kde-format 12208 msgid "Australia/Sydney" 12209 msgstr "" 12210 12211 #. i18n: comment to the previous timezone 12212 #: kdecore/TIMEZONES:1075 12213 #, kde-format 12214 msgid "New South Wales (most areas)" 12215 msgstr "" 12216 12217 #: kdecore/TIMEZONES:1076 12218 #, kde-format 12219 msgid "Australia/Tasmania" 12220 msgstr "" 12221 12222 #: kdecore/TIMEZONES:1079 12223 #, kde-format 12224 msgid "Australia/Victoria" 12225 msgstr "" 12226 12227 #: kdecore/TIMEZONES:1082 12228 #, kde-format 12229 msgid "Australia/West" 12230 msgstr "" 12231 12232 #: kdecore/TIMEZONES:1085 12233 #, kde-format 12234 msgid "Australia/Yancowinna" 12235 msgstr "" 12236 12237 #: kdecore/TIMEZONES:1088 12238 #, kde-format 12239 msgid "Brazil/Acre" 12240 msgstr "" 12241 12242 #: kdecore/TIMEZONES:1091 12243 #, kde-format 12244 msgid "Brazil/DeNoronha" 12245 msgstr "" 12246 12247 #: kdecore/TIMEZONES:1094 12248 #, kde-format 12249 msgid "Brazil/East" 12250 msgstr "" 12251 12252 #: kdecore/TIMEZONES:1097 12253 #, kde-format 12254 msgid "Brazil/West" 12255 msgstr "" 12256 12257 #: kdecore/TIMEZONES:1100 12258 #, kde-format 12259 msgid "Canada/Atlantic" 12260 msgstr "" 12261 12262 #: kdecore/TIMEZONES:1103 12263 #, kde-format 12264 msgid "Canada/Central" 12265 msgstr "" 12266 12267 #: kdecore/TIMEZONES:1106 12268 #, kde-format 12269 msgid "Canada/East-Saskatchewan" 12270 msgstr "" 12271 12272 #: kdecore/TIMEZONES:1109 12273 #, kde-format 12274 msgid "Canada/Eastern" 12275 msgstr "" 12276 12277 #: kdecore/TIMEZONES:1112 12278 #, kde-format 12279 msgid "Canada/Mountain" 12280 msgstr "" 12281 12282 #: kdecore/TIMEZONES:1115 12283 #, kde-format 12284 msgid "Canada/Newfoundland" 12285 msgstr "" 12286 12287 #: kdecore/TIMEZONES:1118 12288 #, kde-format 12289 msgid "Canada/Pacific" 12290 msgstr "" 12291 12292 #: kdecore/TIMEZONES:1121 12293 #, kde-format 12294 msgid "Canada/Saskatchewan" 12295 msgstr "" 12296 12297 #: kdecore/TIMEZONES:1124 12298 #, kde-format 12299 msgid "Canada/Yukon" 12300 msgstr "" 12301 12302 #: kdecore/TIMEZONES:1127 12303 #, kde-format 12304 msgid "Chile/Continental" 12305 msgstr "" 12306 12307 #: kdecore/TIMEZONES:1130 12308 #, kde-format 12309 msgid "Chile/EasterIsland" 12310 msgstr "" 12311 12312 #. i18n: comment to the previous timezone 12313 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12314 #, kde-format 12315 msgid "Easter Island & Sala y Gomez" 12316 msgstr "" 12317 12318 #: kdecore/TIMEZONES:1133 12319 #, kde-format 12320 msgid "Cuba" 12321 msgstr "" 12322 12323 #: kdecore/TIMEZONES:1134 12324 #, kde-format 12325 msgid "Egypt" 12326 msgstr "" 12327 12328 #: kdecore/TIMEZONES:1135 12329 #, kde-format 12330 msgid "Eire" 12331 msgstr "" 12332 12333 #: kdecore/TIMEZONES:1136 12334 #, kde-format 12335 msgid "Europe/Amsterdam" 12336 msgstr "" 12337 12338 #: kdecore/TIMEZONES:1137 12339 #, kde-format 12340 msgid "Europe/Andorra" 12341 msgstr "" 12342 12343 #: kdecore/TIMEZONES:1138 12344 #, kde-format 12345 msgid "Europe/Astrakhan" 12346 msgstr "" 12347 12348 #. i18n: comment to the previous timezone 12349 #: kdecore/TIMEZONES:1140 12350 #, kde-format 12351 msgid "MSK+01 - Astrakhan" 12352 msgstr "" 12353 12354 #: kdecore/TIMEZONES:1141 12355 #, kde-format 12356 msgid "Europe/Athens" 12357 msgstr "" 12358 12359 #: kdecore/TIMEZONES:1142 12360 #, kde-format 12361 msgid "Europe/Belfast" 12362 msgstr "" 12363 12364 #: kdecore/TIMEZONES:1143 12365 #, kde-format 12366 msgid "Europe/Belgrade" 12367 msgstr "" 12368 12369 #: kdecore/TIMEZONES:1144 12370 #, kde-format 12371 msgid "Europe/Berlin" 12372 msgstr "" 12373 12374 #. i18n: comment to the previous timezone 12375 #: kdecore/TIMEZONES:1146 12376 #, kde-format 12377 msgid "Germany (most areas)" 12378 msgstr "" 12379 12380 #: kdecore/TIMEZONES:1147 12381 #, kde-format 12382 msgid "Europe/Bratislava" 12383 msgstr "" 12384 12385 #: kdecore/TIMEZONES:1148 12386 #, kde-format 12387 msgid "Europe/Brussels" 12388 msgstr "" 12389 12390 #: kdecore/TIMEZONES:1149 12391 #, kde-format 12392 msgid "Europe/Bucharest" 12393 msgstr "" 12394 12395 #: kdecore/TIMEZONES:1150 12396 #, kde-format 12397 msgid "Europe/Budapest" 12398 msgstr "" 12399 12400 #: kdecore/TIMEZONES:1151 12401 #, kde-format 12402 msgid "Europe/Busingen" 12403 msgstr "" 12404 12405 #. i18n: comment to the previous timezone 12406 #: kdecore/TIMEZONES:1153 12407 #, kde-format 12408 msgid "Busingen" 12409 msgstr "" 12410 12411 #: kdecore/TIMEZONES:1154 12412 #, kde-format 12413 msgid "Europe/Chisinau" 12414 msgstr "" 12415 12416 #: kdecore/TIMEZONES:1155 12417 #, kde-format 12418 msgid "Europe/Copenhagen" 12419 msgstr "" 12420 12421 #: kdecore/TIMEZONES:1156 12422 #, kde-format 12423 msgid "Europe/Dublin" 12424 msgstr "" 12425 12426 #: kdecore/TIMEZONES:1157 12427 #, kde-format 12428 msgid "Europe/Gibraltar" 12429 msgstr "" 12430 12431 #: kdecore/TIMEZONES:1158 12432 #, kde-format 12433 msgid "Europe/Guernsey" 12434 msgstr "" 12435 12436 #: kdecore/TIMEZONES:1159 12437 #, kde-format 12438 msgid "Europe/Helsinki" 12439 msgstr "" 12440 12441 #: kdecore/TIMEZONES:1160 12442 #, kde-format 12443 msgid "Europe/Isle_of_Man" 12444 msgstr "" 12445 12446 #: kdecore/TIMEZONES:1161 12447 #, kde-format 12448 msgid "Europe/Istanbul" 12449 msgstr "" 12450 12451 #: kdecore/TIMEZONES:1162 12452 #, kde-format 12453 msgid "Europe/Jersey" 12454 msgstr "" 12455 12456 #: kdecore/TIMEZONES:1163 12457 #, kde-format 12458 msgid "Europe/Kaliningrad" 12459 msgstr "" 12460 12461 #. i18n: comment to the previous timezone 12462 #: kdecore/TIMEZONES:1165 12463 #, kde-format 12464 msgid "Moscow-01 - Kaliningrad" 12465 msgstr "" 12466 12467 #. i18n: comment to the previous timezone 12468 #: kdecore/TIMEZONES:1167 12469 #, kde-format 12470 msgid "MSK-01 - Kaliningrad" 12471 msgstr "" 12472 12473 #: kdecore/TIMEZONES:1168 12474 #, kde-format 12475 msgid "Europe/Kiev" 12476 msgstr "" 12477 12478 #. i18n: comment to the previous timezone 12479 #: kdecore/TIMEZONES:1172 12480 #, kde-format 12481 msgid "Ukraine (most areas)" 12482 msgstr "" 12483 12484 #: kdecore/TIMEZONES:1173 12485 #, kde-format 12486 msgid "Europe/Kirov" 12487 msgstr "" 12488 12489 #. i18n: comment to the previous timezone 12490 #: kdecore/TIMEZONES:1175 12491 #, kde-format 12492 msgid "MSK+00 - Kirov" 12493 msgstr "" 12494 12495 #: kdecore/TIMEZONES:1176 12496 #, kde-format 12497 msgid "Europe/Lisbon" 12498 msgstr "" 12499 12500 #. i18n: comment to the previous timezone 12501 #: kdecore/TIMEZONES:1180 12502 #, kde-format 12503 msgid "Portugal (mainland)" 12504 msgstr "" 12505 12506 #: kdecore/TIMEZONES:1181 12507 #, kde-format 12508 msgid "Europe/Ljubljana" 12509 msgstr "" 12510 12511 #: kdecore/TIMEZONES:1182 12512 #, kde-format 12513 msgid "Europe/London" 12514 msgstr "" 12515 12516 #: kdecore/TIMEZONES:1183 12517 #, kde-format 12518 msgid "Europe/Luxembourg" 12519 msgstr "" 12520 12521 #: kdecore/TIMEZONES:1184 12522 #, kde-format 12523 msgid "Europe/Madrid" 12524 msgstr "" 12525 12526 #. i18n: comment to the previous timezone 12527 #: kdecore/TIMEZONES:1188 12528 #, kde-format 12529 msgid "Spain (mainland)" 12530 msgstr "" 12531 12532 #: kdecore/TIMEZONES:1189 12533 #, kde-format 12534 msgid "Europe/Malta" 12535 msgstr "" 12536 12537 #: kdecore/TIMEZONES:1190 12538 #, kde-format 12539 msgid "Europe/Mariehamn" 12540 msgstr "" 12541 12542 #: kdecore/TIMEZONES:1191 12543 #, kde-format 12544 msgid "Europe/Minsk" 12545 msgstr "" 12546 12547 #: kdecore/TIMEZONES:1192 12548 #, kde-format 12549 msgid "Europe/Monaco" 12550 msgstr "" 12551 12552 #: kdecore/TIMEZONES:1193 12553 #, kde-format 12554 msgid "Europe/Moscow" 12555 msgstr "" 12556 12557 #. i18n: comment to the previous timezone 12558 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12559 #, kde-format 12560 msgid "Moscow+00 - west Russia" 12561 msgstr "" 12562 12563 #. i18n: comment to the previous timezone 12564 #: kdecore/TIMEZONES:1197 12565 #, kde-format 12566 msgid "MSK+00 - Moscow area" 12567 msgstr "" 12568 12569 #: kdecore/TIMEZONES:1198 12570 #, kde-format 12571 msgid "Europe/Oslo" 12572 msgstr "" 12573 12574 #: kdecore/TIMEZONES:1199 12575 #, kde-format 12576 msgid "Europe/Paris" 12577 msgstr "" 12578 12579 #: kdecore/TIMEZONES:1200 12580 #, kde-format 12581 msgid "Europe/Podgorica" 12582 msgstr "" 12583 12584 #: kdecore/TIMEZONES:1201 12585 #, kde-format 12586 msgid "Europe/Prague" 12587 msgstr "" 12588 12589 #: kdecore/TIMEZONES:1202 12590 #, kde-format 12591 msgid "Europe/Riga" 12592 msgstr "" 12593 12594 #: kdecore/TIMEZONES:1203 12595 #, kde-format 12596 msgid "Europe/Rome" 12597 msgstr "" 12598 12599 #: kdecore/TIMEZONES:1204 12600 #, kde-format 12601 msgid "Europe/Samara" 12602 msgstr "" 12603 12604 #. i18n: comment to the previous timezone 12605 #: kdecore/TIMEZONES:1206 12606 #, kde-format 12607 msgid "Moscow+01 - Samara, Udmurtia" 12608 msgstr "" 12609 12610 #. i18n: comment to the previous timezone 12611 #: kdecore/TIMEZONES:1208 12612 #, kde-format 12613 msgid "Moscow+00 - Samara, Udmurtia" 12614 msgstr "" 12615 12616 #. i18n: comment to the previous timezone 12617 #: kdecore/TIMEZONES:1210 12618 #, kde-format 12619 msgid "MSK+01 - Samara, Udmurtia" 12620 msgstr "" 12621 12622 #: kdecore/TIMEZONES:1211 12623 #, kde-format 12624 msgid "Europe/San_Marino" 12625 msgstr "" 12626 12627 #: kdecore/TIMEZONES:1212 12628 #, kde-format 12629 msgid "Europe/Sarajevo" 12630 msgstr "" 12631 12632 #: kdecore/TIMEZONES:1213 12633 #, kde-format 12634 msgid "Europe/Saratov" 12635 msgstr "" 12636 12637 #. i18n: comment to the previous timezone 12638 #: kdecore/TIMEZONES:1215 12639 #, kde-format 12640 msgid "MSK+01 - Saratov" 12641 msgstr "" 12642 12643 #: kdecore/TIMEZONES:1216 12644 #, kde-format 12645 msgid "Europe/Simferopol" 12646 msgstr "" 12647 12648 #. i18n: comment to the previous timezone 12649 #: kdecore/TIMEZONES:1218 12650 #, kde-format 12651 msgid "central Crimea" 12652 msgstr "" 12653 12654 #. i18n: comment to the previous timezone 12655 #: kdecore/TIMEZONES:1220 12656 #, fuzzy, kde-format 12657 #| msgid "Prime: " 12658 msgid "Crimea" 12659 msgstr "Primska ličba: " 12660 12661 #: kdecore/TIMEZONES:1221 12662 #, kde-format 12663 msgid "Europe/Skopje" 12664 msgstr "" 12665 12666 #: kdecore/TIMEZONES:1222 12667 #, kde-format 12668 msgid "Europe/Sofia" 12669 msgstr "" 12670 12671 #: kdecore/TIMEZONES:1223 12672 #, kde-format 12673 msgid "Europe/Stockholm" 12674 msgstr "" 12675 12676 #: kdecore/TIMEZONES:1224 12677 #, kde-format 12678 msgid "Europe/Tallinn" 12679 msgstr "" 12680 12681 #: kdecore/TIMEZONES:1225 12682 #, kde-format 12683 msgid "Europe/Tirane" 12684 msgstr "" 12685 12686 #: kdecore/TIMEZONES:1226 12687 #, kde-format 12688 msgid "Europe/Tiraspol" 12689 msgstr "" 12690 12691 #: kdecore/TIMEZONES:1227 12692 #, kde-format 12693 msgid "Europe/Ulyanovsk" 12694 msgstr "" 12695 12696 #. i18n: comment to the previous timezone 12697 #: kdecore/TIMEZONES:1229 12698 #, kde-format 12699 msgid "MSK+01 - Ulyanovsk" 12700 msgstr "" 12701 12702 #: kdecore/TIMEZONES:1230 12703 #, kde-format 12704 msgid "Europe/Uzhgorod" 12705 msgstr "" 12706 12707 #. i18n: comment to the previous timezone 12708 #: kdecore/TIMEZONES:1232 12709 #, kde-format 12710 msgid "Ruthenia" 12711 msgstr "" 12712 12713 #. i18n: comment to the previous timezone 12714 #: kdecore/TIMEZONES:1234 12715 #, kde-format 12716 msgid "Transcarpathia" 12717 msgstr "" 12718 12719 #: kdecore/TIMEZONES:1235 12720 #, kde-format 12721 msgid "Europe/Vaduz" 12722 msgstr "" 12723 12724 #: kdecore/TIMEZONES:1236 12725 #, kde-format 12726 msgid "Europe/Vatican" 12727 msgstr "" 12728 12729 #: kdecore/TIMEZONES:1237 12730 #, kde-format 12731 msgid "Europe/Vienna" 12732 msgstr "" 12733 12734 #: kdecore/TIMEZONES:1238 12735 #, kde-format 12736 msgid "Europe/Vilnius" 12737 msgstr "" 12738 12739 #: kdecore/TIMEZONES:1239 12740 #, kde-format 12741 msgid "Europe/Volgograd" 12742 msgstr "" 12743 12744 #. i18n: comment to the previous timezone 12745 #: kdecore/TIMEZONES:1241 12746 #, kde-format 12747 msgid "Moscow+00 - Caspian Sea" 12748 msgstr "" 12749 12750 #. i18n: comment to the previous timezone 12751 #: kdecore/TIMEZONES:1243 12752 #, kde-format 12753 msgid "MSK+00 - Volgograd" 12754 msgstr "" 12755 12756 #: kdecore/TIMEZONES:1244 12757 #, kde-format 12758 msgid "Europe/Warsaw" 12759 msgstr "" 12760 12761 #: kdecore/TIMEZONES:1245 12762 #, kde-format 12763 msgid "Europe/Zagreb" 12764 msgstr "" 12765 12766 #: kdecore/TIMEZONES:1246 12767 #, kde-format 12768 msgid "Europe/Zaporozhye" 12769 msgstr "" 12770 12771 #. i18n: comment to the previous timezone 12772 #: kdecore/TIMEZONES:1248 12773 #, kde-format 12774 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12775 msgstr "" 12776 12777 #. i18n: comment to the previous timezone 12778 #: kdecore/TIMEZONES:1250 12779 #, kde-format 12780 msgid "Zaporozhye and east Lugansk" 12781 msgstr "" 12782 12783 #: kdecore/TIMEZONES:1251 12784 #, kde-format 12785 msgid "Europe/Zurich" 12786 msgstr "" 12787 12788 #: kdecore/TIMEZONES:1252 12789 #, kde-format 12790 msgid "GB" 12791 msgstr "" 12792 12793 #: kdecore/TIMEZONES:1253 12794 #, kde-format 12795 msgid "GB-Eire" 12796 msgstr "" 12797 12798 #: kdecore/TIMEZONES:1254 12799 #, kde-format 12800 msgid "Hongkong" 12801 msgstr "" 12802 12803 #: kdecore/TIMEZONES:1255 12804 #, kde-format 12805 msgid "Iceland" 12806 msgstr "" 12807 12808 #: kdecore/TIMEZONES:1256 12809 #, kde-format 12810 msgid "Indian/Antananarivo" 12811 msgstr "" 12812 12813 #: kdecore/TIMEZONES:1257 12814 #, kde-format 12815 msgid "Indian/Chagos" 12816 msgstr "" 12817 12818 #: kdecore/TIMEZONES:1258 12819 #, kde-format 12820 msgid "Indian/Christmas" 12821 msgstr "" 12822 12823 #: kdecore/TIMEZONES:1259 12824 #, kde-format 12825 msgid "Indian/Cocos" 12826 msgstr "" 12827 12828 #: kdecore/TIMEZONES:1260 12829 #, kde-format 12830 msgid "Indian/Comoro" 12831 msgstr "" 12832 12833 #: kdecore/TIMEZONES:1261 12834 #, kde-format 12835 msgid "Indian/Kerguelen" 12836 msgstr "" 12837 12838 #: kdecore/TIMEZONES:1262 12839 #, kde-format 12840 msgid "Indian/Mahe" 12841 msgstr "" 12842 12843 #: kdecore/TIMEZONES:1263 12844 #, kde-format 12845 msgid "Indian/Maldives" 12846 msgstr "" 12847 12848 #: kdecore/TIMEZONES:1264 12849 #, kde-format 12850 msgid "Indian/Mauritius" 12851 msgstr "" 12852 12853 #: kdecore/TIMEZONES:1265 12854 #, kde-format 12855 msgid "Indian/Mayotte" 12856 msgstr "" 12857 12858 #: kdecore/TIMEZONES:1266 12859 #, kde-format 12860 msgid "Indian/Reunion" 12861 msgstr "" 12862 12863 #: kdecore/TIMEZONES:1267 12864 #, kde-format 12865 msgid "Iran" 12866 msgstr "" 12867 12868 #: kdecore/TIMEZONES:1268 12869 #, kde-format 12870 msgid "Israel" 12871 msgstr "" 12872 12873 #: kdecore/TIMEZONES:1269 12874 #, kde-format 12875 msgid "Jamaica" 12876 msgstr "" 12877 12878 #: kdecore/TIMEZONES:1270 12879 #, kde-format 12880 msgid "Japan" 12881 msgstr "" 12882 12883 #. i18n: comment to the previous timezone 12884 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12885 #, kde-format 12886 msgid "Kwajalein" 12887 msgstr "" 12888 12889 #: kdecore/TIMEZONES:1274 12890 #, kde-format 12891 msgid "Libya" 12892 msgstr "" 12893 12894 #: kdecore/TIMEZONES:1275 12895 #, kde-format 12896 msgid "Mexico/BajaNorte" 12897 msgstr "" 12898 12899 #: kdecore/TIMEZONES:1278 12900 #, kde-format 12901 msgid "Mexico/BajaSur" 12902 msgstr "" 12903 12904 #: kdecore/TIMEZONES:1281 12905 #, kde-format 12906 msgid "Mexico/General" 12907 msgstr "" 12908 12909 #: kdecore/TIMEZONES:1284 12910 #, kde-format 12911 msgid "NZ" 12912 msgstr "" 12913 12914 #: kdecore/TIMEZONES:1287 12915 #, kde-format 12916 msgid "NZ-CHAT" 12917 msgstr "" 12918 12919 #. i18n: comment to the previous timezone 12920 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12921 #, kde-format 12922 msgid "Chatham Islands" 12923 msgstr "" 12924 12925 #: kdecore/TIMEZONES:1290 12926 #, kde-format 12927 msgid "Navajo" 12928 msgstr "" 12929 12930 #: kdecore/TIMEZONES:1293 12931 #, kde-format 12932 msgid "PRC" 12933 msgstr "" 12934 12935 #: kdecore/TIMEZONES:1296 12936 #, kde-format 12937 msgid "Pacific/Apia" 12938 msgstr "" 12939 12940 #: kdecore/TIMEZONES:1297 12941 #, kde-format 12942 msgid "Pacific/Auckland" 12943 msgstr "" 12944 12945 #. i18n: comment to the previous timezone 12946 #: kdecore/TIMEZONES:1301 12947 #, kde-format 12948 msgid "New Zealand (most areas)" 12949 msgstr "" 12950 12951 #: kdecore/TIMEZONES:1302 12952 #, kde-format 12953 msgid "Pacific/Bougainville" 12954 msgstr "" 12955 12956 #. i18n: comment to the previous timezone 12957 #: kdecore/TIMEZONES:1304 12958 #, kde-format 12959 msgid "Bougainville" 12960 msgstr "" 12961 12962 #: kdecore/TIMEZONES:1305 12963 #, kde-format 12964 msgid "Pacific/Chatham" 12965 msgstr "" 12966 12967 #: kdecore/TIMEZONES:1308 12968 #, kde-format 12969 msgid "Pacific/Chuuk" 12970 msgstr "" 12971 12972 #. i18n: comment to the previous timezone 12973 #: kdecore/TIMEZONES:1310 12974 #, kde-format 12975 msgid "Chuuk (Truk) and Yap" 12976 msgstr "" 12977 12978 #. i18n: comment to the previous timezone 12979 #: kdecore/TIMEZONES:1312 12980 #, kde-format 12981 msgid "Chuuk/Truk, Yap" 12982 msgstr "" 12983 12984 #: kdecore/TIMEZONES:1313 12985 #, kde-format 12986 msgid "Pacific/Easter" 12987 msgstr "" 12988 12989 #. i18n: comment to the previous timezone 12990 #: kdecore/TIMEZONES:1317 12991 #, kde-format 12992 msgid "Easter Island" 12993 msgstr "" 12994 12995 #: kdecore/TIMEZONES:1318 12996 #, kde-format 12997 msgid "Pacific/Efate" 12998 msgstr "" 12999 13000 #: kdecore/TIMEZONES:1319 13001 #, kde-format 13002 msgid "Pacific/Enderbury" 13003 msgstr "" 13004 13005 #. i18n: comment to the previous timezone 13006 #: kdecore/TIMEZONES:1321 13007 #, kde-format 13008 msgid "Phoenix Islands" 13009 msgstr "" 13010 13011 #: kdecore/TIMEZONES:1322 13012 #, kde-format 13013 msgid "Pacific/Fakaofo" 13014 msgstr "" 13015 13016 #: kdecore/TIMEZONES:1323 13017 #, kde-format 13018 msgid "Pacific/Fiji" 13019 msgstr "" 13020 13021 #: kdecore/TIMEZONES:1324 13022 #, kde-format 13023 msgid "Pacific/Funafuti" 13024 msgstr "" 13025 13026 #: kdecore/TIMEZONES:1325 13027 #, kde-format 13028 msgid "Pacific/Galapagos" 13029 msgstr "" 13030 13031 #. i18n: comment to the previous timezone 13032 #: kdecore/TIMEZONES:1327 13033 #, kde-format 13034 msgid "Galapagos Islands" 13035 msgstr "" 13036 13037 #: kdecore/TIMEZONES:1328 13038 #, kde-format 13039 msgid "Pacific/Gambier" 13040 msgstr "" 13041 13042 #. i18n: comment to the previous timezone 13043 #: kdecore/TIMEZONES:1330 13044 #, kde-format 13045 msgid "Gambier Islands" 13046 msgstr "" 13047 13048 #: kdecore/TIMEZONES:1331 13049 #, kde-format 13050 msgid "Pacific/Guadalcanal" 13051 msgstr "" 13052 13053 #: kdecore/TIMEZONES:1332 13054 #, kde-format 13055 msgid "Pacific/Guam" 13056 msgstr "" 13057 13058 #: kdecore/TIMEZONES:1333 13059 #, kde-format 13060 msgid "Pacific/Honolulu" 13061 msgstr "" 13062 13063 #. i18n: comment to the previous timezone 13064 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13065 #, kde-format 13066 msgid "Hawaii" 13067 msgstr "" 13068 13069 #: kdecore/TIMEZONES:1336 13070 #, kde-format 13071 msgid "Pacific/Johnston" 13072 msgstr "" 13073 13074 #. i18n: comment to the previous timezone 13075 #: kdecore/TIMEZONES:1338 13076 #, kde-format 13077 msgid "Johnston Atoll" 13078 msgstr "" 13079 13080 #: kdecore/TIMEZONES:1339 13081 #, kde-format 13082 msgid "Pacific/Kiritimati" 13083 msgstr "" 13084 13085 #. i18n: comment to the previous timezone 13086 #: kdecore/TIMEZONES:1341 13087 #, kde-format 13088 msgid "Line Islands" 13089 msgstr "" 13090 13091 #: kdecore/TIMEZONES:1342 13092 #, kde-format 13093 msgid "Pacific/Kosrae" 13094 msgstr "" 13095 13096 #. i18n: comment to the previous timezone 13097 #: kdecore/TIMEZONES:1344 13098 #, kde-format 13099 msgid "Kosrae" 13100 msgstr "" 13101 13102 #: kdecore/TIMEZONES:1345 13103 #, kde-format 13104 msgid "Pacific/Kwajalein" 13105 msgstr "" 13106 13107 #: kdecore/TIMEZONES:1348 13108 #, kde-format 13109 msgid "Pacific/Majuro" 13110 msgstr "" 13111 13112 #. i18n: comment to the previous timezone 13113 #: kdecore/TIMEZONES:1352 13114 #, kde-format 13115 msgid "Marshall Islands (most areas)" 13116 msgstr "" 13117 13118 #: kdecore/TIMEZONES:1353 13119 #, kde-format 13120 msgid "Pacific/Marquesas" 13121 msgstr "" 13122 13123 #. i18n: comment to the previous timezone 13124 #: kdecore/TIMEZONES:1355 13125 #, kde-format 13126 msgid "Marquesas Islands" 13127 msgstr "" 13128 13129 #: kdecore/TIMEZONES:1356 13130 #, kde-format 13131 msgid "Pacific/Midway" 13132 msgstr "" 13133 13134 #. i18n: comment to the previous timezone 13135 #: kdecore/TIMEZONES:1358 13136 #, kde-format 13137 msgid "Midway Islands" 13138 msgstr "" 13139 13140 #: kdecore/TIMEZONES:1359 13141 #, kde-format 13142 msgid "Pacific/Nauru" 13143 msgstr "" 13144 13145 #: kdecore/TIMEZONES:1360 13146 #, kde-format 13147 msgid "Pacific/Niue" 13148 msgstr "" 13149 13150 #: kdecore/TIMEZONES:1361 13151 #, kde-format 13152 msgid "Pacific/Norfolk" 13153 msgstr "" 13154 13155 #: kdecore/TIMEZONES:1362 13156 #, kde-format 13157 msgid "Pacific/Noumea" 13158 msgstr "" 13159 13160 #: kdecore/TIMEZONES:1363 13161 #, kde-format 13162 msgid "Pacific/Pago_Pago" 13163 msgstr "" 13164 13165 #: kdecore/TIMEZONES:1364 13166 #, kde-format 13167 msgid "Pacific/Palau" 13168 msgstr "" 13169 13170 #: kdecore/TIMEZONES:1365 13171 #, kde-format 13172 msgid "Pacific/Pitcairn" 13173 msgstr "" 13174 13175 #: kdecore/TIMEZONES:1366 13176 #, kde-format 13177 msgid "Pacific/Pohnpei" 13178 msgstr "" 13179 13180 #. i18n: comment to the previous timezone 13181 #: kdecore/TIMEZONES:1368 13182 #, kde-format 13183 msgid "Pohnpei (Ponape)" 13184 msgstr "" 13185 13186 #. i18n: comment to the previous timezone 13187 #: kdecore/TIMEZONES:1370 13188 #, kde-format 13189 msgid "Pohnpei/Ponape" 13190 msgstr "" 13191 13192 #: kdecore/TIMEZONES:1371 13193 #, kde-format 13194 msgid "Pacific/Ponape" 13195 msgstr "" 13196 13197 #. i18n: comment to the previous timezone 13198 #: kdecore/TIMEZONES:1373 13199 #, kde-format 13200 msgid "Ponape (Pohnpei)" 13201 msgstr "" 13202 13203 #: kdecore/TIMEZONES:1374 13204 #, kde-format 13205 msgid "Pacific/Port_Moresby" 13206 msgstr "" 13207 13208 #. i18n: comment to the previous timezone 13209 #: kdecore/TIMEZONES:1376 13210 #, kde-format 13211 msgid "Papua New Guinea (most areas)" 13212 msgstr "" 13213 13214 #: kdecore/TIMEZONES:1377 13215 #, kde-format 13216 msgid "Pacific/Rarotonga" 13217 msgstr "" 13218 13219 #: kdecore/TIMEZONES:1378 13220 #, kde-format 13221 msgid "Pacific/Saipan" 13222 msgstr "" 13223 13224 #: kdecore/TIMEZONES:1379 13225 #, kde-format 13226 msgid "Pacific/Samoa" 13227 msgstr "" 13228 13229 #: kdecore/TIMEZONES:1380 13230 #, kde-format 13231 msgid "Pacific/Tahiti" 13232 msgstr "" 13233 13234 #. i18n: comment to the previous timezone 13235 #: kdecore/TIMEZONES:1382 13236 #, kde-format 13237 msgid "Society Islands" 13238 msgstr "" 13239 13240 #: kdecore/TIMEZONES:1383 13241 #, kde-format 13242 msgid "Pacific/Tarawa" 13243 msgstr "" 13244 13245 #. i18n: comment to the previous timezone 13246 #: kdecore/TIMEZONES:1385 13247 #, kde-format 13248 msgid "Gilbert Islands" 13249 msgstr "" 13250 13251 #: kdecore/TIMEZONES:1386 13252 #, kde-format 13253 msgid "Pacific/Tongatapu" 13254 msgstr "" 13255 13256 #: kdecore/TIMEZONES:1387 13257 #, kde-format 13258 msgid "Pacific/Truk" 13259 msgstr "" 13260 13261 #. i18n: comment to the previous timezone 13262 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13263 #, kde-format 13264 msgid "Truk (Chuuk) and Yap" 13265 msgstr "" 13266 13267 #: kdecore/TIMEZONES:1390 13268 #, kde-format 13269 msgid "Pacific/Wake" 13270 msgstr "" 13271 13272 #. i18n: comment to the previous timezone 13273 #: kdecore/TIMEZONES:1392 13274 #, kde-format 13275 msgid "Wake Island" 13276 msgstr "" 13277 13278 #: kdecore/TIMEZONES:1393 13279 #, kde-format 13280 msgid "Pacific/Wallis" 13281 msgstr "" 13282 13283 #: kdecore/TIMEZONES:1394 13284 #, kde-format 13285 msgid "Pacific/Yap" 13286 msgstr "" 13287 13288 #: kdecore/TIMEZONES:1397 13289 #, kde-format 13290 msgid "Poland" 13291 msgstr "" 13292 13293 #: kdecore/TIMEZONES:1398 13294 #, kde-format 13295 msgid "Portugal" 13296 msgstr "" 13297 13298 #: kdecore/TIMEZONES:1401 13299 #, kde-format 13300 msgid "ROC" 13301 msgstr "" 13302 13303 #: kdecore/TIMEZONES:1402 13304 #, kde-format 13305 msgid "ROK" 13306 msgstr "" 13307 13308 #: kdecore/TIMEZONES:1403 13309 #, kde-format 13310 msgid "Singapore" 13311 msgstr "" 13312 13313 #: kdecore/TIMEZONES:1404 13314 #, kde-format 13315 msgid "Turkey" 13316 msgstr "" 13317 13318 #: kdecore/TIMEZONES:1405 13319 #, kde-format 13320 msgid "US/Alaska" 13321 msgstr "" 13322 13323 #: kdecore/TIMEZONES:1408 13324 #, kde-format 13325 msgid "US/Aleutian" 13326 msgstr "" 13327 13328 #: kdecore/TIMEZONES:1411 13329 #, kde-format 13330 msgid "US/Arizona" 13331 msgstr "" 13332 13333 #: kdecore/TIMEZONES:1414 13334 #, kde-format 13335 msgid "US/Central" 13336 msgstr "" 13337 13338 #: kdecore/TIMEZONES:1417 13339 #, kde-format 13340 msgid "US/East-Indiana" 13341 msgstr "" 13342 13343 #: kdecore/TIMEZONES:1420 13344 #, kde-format 13345 msgid "US/Eastern" 13346 msgstr "" 13347 13348 #: kdecore/TIMEZONES:1423 13349 #, kde-format 13350 msgid "US/Hawaii" 13351 msgstr "" 13352 13353 #: kdecore/TIMEZONES:1426 13354 #, kde-format 13355 msgid "US/Indiana-Starke" 13356 msgstr "" 13357 13358 #: kdecore/TIMEZONES:1429 13359 #, kde-format 13360 msgid "US/Michigan" 13361 msgstr "" 13362 13363 #: kdecore/TIMEZONES:1432 13364 #, kde-format 13365 msgid "US/Mountain" 13366 msgstr "" 13367 13368 #: kdecore/TIMEZONES:1435 13369 #, kde-format 13370 msgid "US/Pacific" 13371 msgstr "" 13372 13373 #: kdecore/TIMEZONES:1438 13374 #, kde-format 13375 msgid "US/Samoa" 13376 msgstr "" 13377 13378 #: kdecore/TIMEZONES:1439 13379 #, kde-format 13380 msgid "W-SU" 13381 msgstr "" 13382 13383 #. i18n: Generic sans serif font presented in font choosers. When selected, 13384 #. the system will choose a real font, mandated by distro settings. 13385 #: kdeui/fonthelpers.cpp:29 13386 #, kde-format 13387 msgctxt "@item Font name" 13388 msgid "Sans Serif" 13389 msgstr "Sans Serif" 13390 13391 #. i18n: Generic serif font presented in font choosers. When selected, 13392 #. the system will choose a real font, mandated by distro settings. 13393 #: kdeui/fonthelpers.cpp:32 13394 #, kde-format 13395 msgctxt "@item Font name" 13396 msgid "Serif" 13397 msgstr "Serif" 13398 13399 #. i18n: Generic monospace font presented in font choosers. When selected, 13400 #. the system will choose a real font, mandated by distro settings. 13401 #: kdeui/fonthelpers.cpp:35 13402 #, kde-format 13403 msgctxt "@item Font name" 13404 msgid "Monospace" 13405 msgstr "Monospace" 13406 13407 #: kdeui/k4timezonewidget.cpp:62 13408 #, kde-format 13409 msgctxt "Define an area in the time zone, like a town area" 13410 msgid "Area" 13411 msgstr "Pasmo" 13412 13413 #: kdeui/k4timezonewidget.cpp:62 13414 #, kde-format 13415 msgctxt "Time zone" 13416 msgid "Region" 13417 msgstr "Kónčina" 13418 13419 #: kdeui/k4timezonewidget.cpp:62 13420 #, fuzzy, kde-format 13421 msgid "Comment" 13422 msgstr "Komentar" 13423 13424 #: kdeui/kapplication.cpp:741 13425 #, kde-format 13426 msgid "The style '%1' was not found" 13427 msgstr "Stil %1 njejsym namakał" 13428 13429 #: kdeui/kcolordialog.cpp:102 13430 #, kde-format 13431 msgctxt "palette name" 13432 msgid "* Recent Colors *" 13433 msgstr "* Njedawno wuběrane barby *" 13434 13435 #: kdeui/kcolordialog.cpp:103 13436 #, kde-format 13437 msgctxt "palette name" 13438 msgid "* Custom Colors *" 13439 msgstr "* Nastajene barby *" 13440 13441 #: kdeui/kcolordialog.cpp:104 13442 #, kde-format 13443 msgctxt "palette name" 13444 msgid "Forty Colors" 13445 msgstr "Fortyjowe barby" 13446 13447 #: kdeui/kcolordialog.cpp:105 13448 #, kde-format 13449 msgctxt "palette name" 13450 msgid "Oxygen Colors" 13451 msgstr "Oxygenowe barby" 13452 13453 #: kdeui/kcolordialog.cpp:106 13454 #, kde-format 13455 msgctxt "palette name" 13456 msgid "Rainbow Colors" 13457 msgstr "Rainbowowe barby" 13458 13459 #: kdeui/kcolordialog.cpp:107 13460 #, kde-format 13461 msgctxt "palette name" 13462 msgid "Royal Colors" 13463 msgstr "Kralowne barby" 13464 13465 #: kdeui/kcolordialog.cpp:108 13466 #, kde-format 13467 msgctxt "palette name" 13468 msgid "Web Colors" 13469 msgstr "Webowe barby" 13470 13471 #: kdeui/kcolordialog.cpp:572 13472 #, kde-format 13473 msgid "Named Colors" 13474 msgstr "Pomjenowane barby" 13475 13476 #: kdeui/kcolordialog.cpp:746 13477 #, kde-format 13478 msgctxt "" 13479 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13480 "them)" 13481 msgid "" 13482 "Unable to read X11 RGB color strings. The following file location was " 13483 "examined:\n" 13484 "%2" 13485 msgid_plural "" 13486 "Unable to read X11 RGB color strings. The following file locations were " 13487 "examined:\n" 13488 "%2" 13489 msgstr[0] "" 13490 msgstr[1] "" 13491 msgstr[2] "" 13492 msgstr[3] "" 13493 13494 #: kdeui/kcolordialog.cpp:997 13495 #, kde-format 13496 msgid "Select Color" 13497 msgstr "Barbu wubrać" 13498 13499 #: kdeui/kcolordialog.cpp:1077 13500 #, kde-format 13501 msgid "Hue:" 13502 msgstr "Wotsćin:" 13503 13504 #: kdeui/kcolordialog.cpp:1083 13505 #, kde-format 13506 msgctxt "The angular degree unit (for hue)" 13507 msgid "°" 13508 msgstr "" 13509 13510 #: kdeui/kcolordialog.cpp:1088 13511 #, fuzzy, kde-format 13512 #| msgid "Saturday" 13513 msgid "Saturation:" 13514 msgstr "Sobota" 13515 13516 #: kdeui/kcolordialog.cpp:1098 13517 #, kde-format 13518 msgctxt "This is the V of HSV" 13519 msgid "Value:" 13520 msgstr "Hódnota:" 13521 13522 #: kdeui/kcolordialog.cpp:1111 13523 #, kde-format 13524 msgid "Red:" 13525 msgstr "Čerwjeń:" 13526 13527 #: kdeui/kcolordialog.cpp:1121 13528 #, kde-format 13529 msgid "Green:" 13530 msgstr "Zeleń:" 13531 13532 #: kdeui/kcolordialog.cpp:1131 13533 #, kde-format 13534 msgid "Blue:" 13535 msgstr "Módrosć:" 13536 13537 #: kdeui/kcolordialog.cpp:1152 13538 #, kde-format 13539 msgid "Alpha:" 13540 msgstr "" 13541 13542 #: kdeui/kcolordialog.cpp:1206 13543 #, kde-format 13544 msgid "&Add to Custom Colors" 13545 msgstr "K samodefinowanym barbam dod&ać" 13546 13547 #: kdeui/kcolordialog.cpp:1234 13548 #, kde-format 13549 msgid "Name:" 13550 msgstr "Mjeno:" 13551 13552 #: kdeui/kcolordialog.cpp:1241 13553 #, kde-format 13554 msgid "HTML:" 13555 msgstr "HTML:" 13556 13557 #: kdeui/kcolordialog.cpp:1328 13558 #, kde-format 13559 msgid "Default color" 13560 msgstr "Standardna barba" 13561 13562 #: kdeui/kcolordialog.cpp:1393 13563 #, kde-format 13564 msgid "-default-" 13565 msgstr "-standard-" 13566 13567 #: kdeui/kcolordialog.cpp:1668 13568 #, kde-format 13569 msgid "-unnamed-" 13570 msgstr "-bjez mjena-" 13571 13572 #: kdeui/kdeprintdialog.cpp:40 13573 #, kde-format 13574 msgctxt "@title:window" 13575 msgid "Print" 13576 msgstr "Ćišćeć" 13577 13578 #: kdeui/kdialog.cpp:271 13579 #, kde-format 13580 msgid "&Try" 13581 msgstr "&Spytaj" 13582 13583 #: kdeui/kdialog.cpp:484 13584 #, kde-format 13585 msgid "modified" 13586 msgstr "změnjene" 13587 13588 #: kdeui/kdialog.cpp:495 13589 #, kde-format 13590 msgctxt "Document/application separator in titlebar" 13591 msgid " – " 13592 msgstr "" 13593 13594 #: kdeui/kdialog.cpp:896 13595 #, kde-format 13596 msgid "&Details" 13597 msgstr "&Detajle" 13598 13599 #: kdeui/kdialog.cpp:1054 13600 #, kde-format 13601 msgid "Get help..." 13602 msgstr "Na pomoc ..." 13603 13604 #: kdeui/keditlistbox.cpp:324 13605 #, kde-format 13606 msgid "&Add" 13607 msgstr "Dod&aj" 13608 13609 #: kdeui/keditlistbox.cpp:336 13610 #, kde-format 13611 msgid "&Remove" 13612 msgstr "Wotst&ronić" 13613 13614 #: kdeui/keditlistbox.cpp:348 13615 #, kde-format 13616 msgid "Move &Up" 13617 msgstr "&Horje sunyć" 13618 13619 #: kdeui/keditlistbox.cpp:353 13620 #, kde-format 13621 msgid "Move &Down" 13622 msgstr "&Dele sunyć" 13623 13624 #. i18n: A shorter version of the alphabet test phrase translated in 13625 #. another message. It is displayed in the dropdown list of font previews 13626 #. (the font selection combo box), so keep it under the length equivalent 13627 #. to 60 or so proportional Latin characters. 13628 #: kdeui/kfontcombobox.cpp:48 13629 #, kde-format 13630 msgctxt "short" 13631 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13632 msgstr "The Quick Brown Fox Jumps Over The Lazy Dog ČčĆćDźdźĚ죳ŃńÓóŘřŔ੹ŚśŽž" 13633 13634 #. i18n: Integer which indicates the script you used in the sample text 13635 #. for font previews in your language. For the possible values, see 13636 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13637 #. If the sample text contains several scripts, their IDs can be given 13638 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13639 #: kdeui/kfontcombobox.cpp:119 13640 #, kde-format 13641 msgctxt "Numeric IDs of scripts for font previews" 13642 msgid "1" 13643 msgstr "1" 13644 13645 #: kdeui/kfontdialog.cpp:51 13646 #, kde-format 13647 msgid "Select Font" 13648 msgstr "Pismo wubrać" 13649 13650 #: kdeui/kprintpreview.cpp:118 13651 #, kde-format 13652 msgid "Could not load print preview part" 13653 msgstr "Njemóžach dźěl přehladki ćišćeć" 13654 13655 #: kdeui/kprintpreview.cpp:135 13656 #, kde-format 13657 msgid "Print Preview" 13658 msgstr "Ćišćowa přehladka" 13659 13660 #: kdeui/ksystemtrayicon.cpp:153 13661 #, kde-format 13662 msgid "Minimize" 13663 msgstr "Minimalizować" 13664 13665 #: kdeui/ksystemtrayicon.cpp:205 13666 #, kde-format 13667 msgid "&Minimize" 13668 msgstr "&Minimalizować" 13669 13670 #: kdeui/ksystemtrayicon.cpp:207 13671 #, kde-format 13672 msgid "&Restore" 13673 msgstr "&Prěnjotny staw" 13674 13675 #: kdeui/ksystemtrayicon.cpp:226 13676 #, kde-format 13677 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13678 msgstr "<qt>Chceće woprawdźe <b>%1</b> wopušćić?</qt>" 13679 13680 #: kdeui/ksystemtrayicon.cpp:229 13681 #, kde-format 13682 msgid "Confirm Quit From System Tray" 13683 msgstr "Confirm Quit From System Tray" 13684 13685 #: kdeui/kundostack.cpp:47 13686 #, kde-format 13687 msgid "Redo" 13688 msgstr "Znowa činić" 13689 13690 #: kdeui/kundostack.cpp:66 13691 #, kde-format 13692 msgid "Undo" 13693 msgstr "Wróćo" 13694 13695 #: kdeui/kuniqueapplication.cpp:79 13696 #, kde-format 13697 msgid "Do not run in the background." 13698 msgstr "Njeběži w pozadku." 13699 13700 #: kdeui/kuniqueapplication.cpp:81 13701 #, kde-format 13702 msgid "Internally added if launched from Finder" 13703 msgstr "So internje doda, hdyž so wot Findera startowa" 13704 13705 #: kio/kcommentwidget.cpp:68 13706 #, fuzzy, kde-format 13707 #| msgid "Add Entry..." 13708 msgctxt "@label" 13709 msgid "Add Comment..." 13710 msgstr "Zapis dodać ..." 13711 13712 #: kio/kcommentwidget.cpp:74 13713 #, fuzzy, kde-format 13714 #| msgid "Change &Icon..." 13715 msgctxt "@label" 13716 msgid "Change..." 13717 msgstr "&Piktogram změnić..." 13718 13719 #: kio/kcommentwidget.cpp:128 13720 #, fuzzy, kde-format 13721 #| msgid "Comment" 13722 msgctxt "@title:window" 13723 msgid "Change Comment" 13724 msgstr "Komentar" 13725 13726 #: kio/kcommentwidget.cpp:129 13727 #, fuzzy, kde-format 13728 #| msgid "Comment" 13729 msgctxt "@title:window" 13730 msgid "Add Comment" 13731 msgstr "Komentar" 13732 13733 #: kio/kdevicelistmodel.cpp:115 13734 #, kde-format 13735 msgid "Device name" 13736 msgstr "Mjeno grata" 13737 13738 #: kio/kdirselectdialog.cpp:136 13739 #, fuzzy, kde-format 13740 msgctxt "folder name" 13741 msgid "New Folder" 13742 msgstr "Nowy zapisk..." 13743 13744 #: kio/kdirselectdialog.cpp:141 13745 #, kde-format 13746 msgctxt "@title:window" 13747 msgid "New Folder" 13748 msgstr "Nowy zapisk" 13749 13750 #: kio/kdirselectdialog.cpp:142 13751 #, fuzzy, kde-format 13752 msgctxt "@label:textbox" 13753 msgid "" 13754 "Create new folder in:\n" 13755 "%1" 13756 msgstr "Nowy zapisk stworić w:" 13757 13758 #: kio/kdirselectdialog.cpp:172 13759 #, fuzzy, kde-format 13760 msgid "A file or folder named %1 already exists." 13761 msgstr "Dataja %1 hižo eksistuje." 13762 13763 #: kio/kdirselectdialog.cpp:175 13764 #, fuzzy, kde-format 13765 msgid "You do not have permission to create that folder." 13766 msgstr "Nimaće prawa tutón zapisk stworić." 13767 13768 #: kio/kdirselectdialog.cpp:290 13769 #, kde-format 13770 msgctxt "@title:window" 13771 msgid "Select Folder" 13772 msgstr "Zapisk wubrać" 13773 13774 #: kio/kdirselectdialog.cpp:299 13775 #, fuzzy, kde-format 13776 #| msgid "New Folder..." 13777 msgctxt "@action:button" 13778 msgid "New Folder..." 13779 msgstr "Nowy zapisk..." 13780 13781 #: kio/kdirselectdialog.cpp:345 13782 #, fuzzy, kde-format 13783 #| msgid "New Folder..." 13784 msgctxt "@action:inmenu" 13785 msgid "New Folder..." 13786 msgstr "Nowy zapisk..." 13787 13788 #: kio/kdirselectdialog.cpp:352 13789 #, fuzzy, kde-format 13790 #| msgid "Move to Trash" 13791 msgctxt "@action:inmenu" 13792 msgid "Move to Trash" 13793 msgstr "do papjernika sunyć" 13794 13795 #: kio/kdirselectdialog.cpp:359 13796 #, fuzzy, kde-format 13797 msgctxt "@action:inmenu" 13798 msgid "Delete" 13799 msgstr "Niču" 13800 13801 #: kio/kdirselectdialog.cpp:368 13802 #, fuzzy, kde-format 13803 msgctxt "@option:check" 13804 msgid "Show Hidden Folders" 13805 msgstr "chowane dataje pokazować" 13806 13807 #: kio/kdirselectdialog.cpp:375 13808 #, fuzzy, kde-format 13809 #| msgid "Properties" 13810 msgctxt "@action:inmenu" 13811 msgid "Properties" 13812 msgstr "Swójstwa" 13813 13814 #: kio/kfiledialog.cpp:132 13815 #, kde-format 13816 msgid "*|All files" 13817 msgstr "*|Wšitke dataje" 13818 13819 #: kio/kfiledialog.cpp:332 13820 #, fuzzy, kde-format 13821 msgid "All Supported Files" 13822 msgstr "Wšitke podpěrowane dataje" 13823 13824 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13825 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13826 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13827 #, kde-format 13828 msgid "Open" 13829 msgstr "Wočinić" 13830 13831 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13832 #: kio/kfiledialog.cpp:838 13833 #, kde-format 13834 msgid "Save As" 13835 msgstr "Zawěsćić jako" 13836 13837 #: kio/kfilemetadataprovider.cpp:245 13838 #, kde-format 13839 msgctxt "@item:intable" 13840 msgid "%1 item" 13841 msgid_plural "%1 items" 13842 msgstr[0] "" 13843 msgstr[1] "" 13844 msgstr[2] "" 13845 msgstr[3] "" 13846 13847 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13848 #, fuzzy, kde-format 13849 msgctxt "@label" 13850 msgid "Comment" 13851 msgstr "Komentar" 13852 13853 #: kio/kfilemetadataprovider.cpp:447 13854 #, fuzzy, kde-format 13855 #| msgid "Modified:" 13856 msgctxt "@label" 13857 msgid "Modified" 13858 msgstr "Změnjeny:" 13859 13860 #: kio/kfilemetadataprovider.cpp:448 13861 #, fuzzy, kde-format 13862 #| msgid "Owner" 13863 msgctxt "@label" 13864 msgid "Owner" 13865 msgstr "Wobsydnik" 13866 13867 #: kio/kfilemetadataprovider.cpp:449 13868 #, fuzzy, kde-format 13869 #| msgctxt "@title:column" 13870 #| msgid "Permissions" 13871 msgctxt "@label" 13872 msgid "Permissions" 13873 msgstr "Prawa" 13874 13875 #: kio/kfilemetadataprovider.cpp:450 13876 #, fuzzy, kde-format 13877 #| msgid "Sorting" 13878 msgctxt "@label" 13879 msgid "Rating" 13880 msgstr "Rjadowanje" 13881 13882 #: kio/kfilemetadataprovider.cpp:451 13883 #, fuzzy, kde-format 13884 #| msgctxt "@title:column" 13885 #| msgid "Size" 13886 msgctxt "@label" 13887 msgid "Size" 13888 msgstr "Wulkosć" 13889 13890 #: kio/kfilemetadataprovider.cpp:452 13891 #, fuzzy, kde-format 13892 msgctxt "@label" 13893 msgid "Tags" 13894 msgstr "Papjernik" 13895 13896 #: kio/kfilemetadataprovider.cpp:453 13897 #, fuzzy, kde-format 13898 #| msgid "Size:" 13899 msgctxt "@label" 13900 msgid "Total Size" 13901 msgstr "Wulkosć:" 13902 13903 #: kio/kfilemetadataprovider.cpp:454 13904 #, fuzzy, kde-format 13905 #| msgid "Type" 13906 msgctxt "@label" 13907 msgid "Type" 13908 msgstr "Družina" 13909 13910 #: kio/kfilemetadatareaderprocess.cpp:234 13911 #, kde-format 13912 msgid "KFileMetaDataReader" 13913 msgstr "" 13914 13915 #: kio/kfilemetadatareaderprocess.cpp:236 13916 #, kde-format 13917 msgid "KFileMetaDataReader can be used to read metadata from a file" 13918 msgstr "" 13919 13920 #: kio/kfilemetadatareaderprocess.cpp:238 13921 #, kde-format 13922 msgid "(C) 2011, Peter Penz" 13923 msgstr "" 13924 13925 #: kio/kfilemetadatareaderprocess.cpp:239 13926 #, kde-format 13927 msgid "Peter Penz" 13928 msgstr "" 13929 13930 #: kio/kfilemetadatareaderprocess.cpp:239 13931 #, kde-format 13932 msgid "Current maintainer" 13933 msgstr "" 13934 13935 #: kio/kfilemetadatareaderprocess.cpp:244 13936 #, kde-format 13937 msgid "Only the meta data that is part of the file is read" 13938 msgstr "" 13939 13940 #: kio/kfilemetadatareaderprocess.cpp:245 13941 #, kde-format 13942 msgid "List of URLs where the meta-data should be read from" 13943 msgstr "" 13944 13945 #: kio/kfilemetainfowidget.cpp:161 13946 #, kde-format 13947 msgid "<Error>" 13948 msgstr "<Zmylk>" 13949 13950 #: kio/kfiletreeview.cpp:192 13951 #, fuzzy, kde-format 13952 msgid "Show Hidden Folders" 13953 msgstr "chowane dataje pokazować" 13954 13955 #: kio/kimageio.cpp:46 13956 #, kde-format 13957 msgid "All Pictures" 13958 msgstr "Wšitke wobrazy" 13959 13960 #: kio/kmetaprops.cpp:57 13961 #, kde-format 13962 msgctxt "@title:window" 13963 msgid "Configure Shown Data" 13964 msgstr "" 13965 13966 #: kio/kmetaprops.cpp:60 13967 #, kde-format 13968 msgctxt "@label::textbox" 13969 msgid "Select which data should be shown:" 13970 msgstr "" 13971 13972 #: kio/kmetaprops.cpp:123 13973 #, fuzzy, kde-format 13974 #| msgid "Calculating..." 13975 msgctxt "@action:button" 13976 msgid "Configure..." 13977 msgstr "Wobličuju ..." 13978 13979 #: kio/kmetaprops.cpp:133 13980 #, fuzzy, kde-format 13981 #| msgid "Information" 13982 msgctxt "@title:tab" 13983 msgid "Information" 13984 msgstr "informacija" 13985 13986 #: kio/knfotranslator.cpp:40 13987 #, fuzzy, kde-format 13988 #| msgid "Created:" 13989 msgctxt "@label creation date" 13990 msgid "Created" 13991 msgstr "Stworjene:" 13992 13993 #: kio/knfotranslator.cpp:41 13994 #, fuzzy, kde-format 13995 #| msgctxt "@title:column" 13996 #| msgid "Size" 13997 msgctxt "@label file content size" 13998 msgid "Size" 13999 msgstr "Wulkosć" 14000 14001 #: kio/knfotranslator.cpp:42 14002 #, kde-format 14003 msgctxt "@label file depends from" 14004 msgid "Depends" 14005 msgstr "" 14006 14007 #: kio/knfotranslator.cpp:43 14008 #, fuzzy, kde-format 14009 #| msgid "Description" 14010 msgctxt "@label" 14011 msgid "Description" 14012 msgstr "Wopisanje" 14013 14014 #: kio/knfotranslator.cpp:44 14015 #, fuzzy, kde-format 14016 #| msgid "&General" 14017 msgctxt "@label Software used to generate content" 14018 msgid "Generator" 14019 msgstr "&Powšitkownje" 14020 14021 #: kio/knfotranslator.cpp:45 14022 #, kde-format 14023 msgctxt "" 14024 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14025 msgid "Has Part" 14026 msgstr "" 14027 14028 #: kio/knfotranslator.cpp:46 14029 #, kde-format 14030 msgctxt "" 14031 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14032 "nie#hasLogicalPart" 14033 msgid "Has Logical Part" 14034 msgstr "" 14035 14036 #: kio/knfotranslator.cpp:47 14037 #, fuzzy, kde-format 14038 msgctxt "@label parent directory" 14039 msgid "Part of" 14040 msgstr "Zapisk zničić" 14041 14042 #: kio/knfotranslator.cpp:48 14043 #, kde-format 14044 msgctxt "@label" 14045 msgid "Keyword" 14046 msgstr "" 14047 14048 #: kio/knfotranslator.cpp:49 14049 #, fuzzy, kde-format 14050 #| msgid "Modified:" 14051 msgctxt "@label modified date of file" 14052 msgid "Modified" 14053 msgstr "Změnjeny:" 14054 14055 #: kio/knfotranslator.cpp:50 14056 #, fuzzy, kde-format 14057 #| msgid "Mime Type" 14058 msgctxt "@label" 14059 msgid "MIME Type" 14060 msgstr "MIME-družina" 14061 14062 #: kio/knfotranslator.cpp:51 14063 #, fuzzy, kde-format 14064 #| msgid "Contents:" 14065 msgctxt "@label" 14066 msgid "Content" 14067 msgstr "Wobsah:" 14068 14069 #: kio/knfotranslator.cpp:52 14070 #, fuzzy, kde-format 14071 #| msgid "created on %1" 14072 msgctxt "@label" 14073 msgid "Related To" 14074 msgstr "stworjene %1" 14075 14076 #: kio/knfotranslator.cpp:53 14077 #, fuzzy, kde-format 14078 #| msgid "Subject" 14079 msgctxt "@label" 14080 msgid "Subject" 14081 msgstr "Tema" 14082 14083 #: kio/knfotranslator.cpp:54 14084 #, fuzzy, kde-format 14085 #| msgid "File" 14086 msgctxt "@label music title" 14087 msgid "Title" 14088 msgstr "Dataja" 14089 14090 #: kio/knfotranslator.cpp:55 14091 #, kde-format 14092 msgctxt "@label file URL" 14093 msgid "File Location" 14094 msgstr "" 14095 14096 #: kio/knfotranslator.cpp:56 14097 #, fuzzy, kde-format 14098 #| msgid "Created:" 14099 msgctxt "@label" 14100 msgid "Creator" 14101 msgstr "Stworjene:" 14102 14103 #: kio/knfotranslator.cpp:57 14104 #, kde-format 14105 msgctxt "@label" 14106 msgid "Average Bitrate" 14107 msgstr "" 14108 14109 #: kio/knfotranslator.cpp:58 14110 #, kde-format 14111 msgctxt "@label" 14112 msgid "Channels" 14113 msgstr "" 14114 14115 #: kio/knfotranslator.cpp:59 14116 #, fuzzy, kde-format 14117 #| msgid "Categories" 14118 msgctxt "@label number of characters" 14119 msgid "Characters" 14120 msgstr "Kategorije" 14121 14122 #: kio/knfotranslator.cpp:60 14123 #, fuzzy, kde-format 14124 #| msgid "C&onnect" 14125 msgctxt "@label" 14126 msgid "Codec" 14127 msgstr "&Zwjazać" 14128 14129 #: kio/knfotranslator.cpp:61 14130 #, kde-format 14131 msgctxt "@label" 14132 msgid "Color Depth" 14133 msgstr "" 14134 14135 #: kio/knfotranslator.cpp:62 14136 #, fuzzy, kde-format 14137 #| msgctxt "The destination of a file operation" 14138 #| msgid "Destination" 14139 msgctxt "@label" 14140 msgid "Duration" 14141 msgstr "Cil" 14142 14143 #: kio/knfotranslator.cpp:63 14144 #, fuzzy, kde-format 14145 #| msgid "Device name" 14146 msgctxt "@label" 14147 msgid "Filename" 14148 msgstr "Mjeno grata" 14149 14150 #: kio/knfotranslator.cpp:64 14151 #, kde-format 14152 msgctxt "@label" 14153 msgid "Hash" 14154 msgstr "" 14155 14156 #: kio/knfotranslator.cpp:65 14157 #, kde-format 14158 msgctxt "@label" 14159 msgid "Height" 14160 msgstr "" 14161 14162 #: kio/knfotranslator.cpp:66 14163 #, kde-format 14164 msgctxt "@label" 14165 msgid "Interlace Mode" 14166 msgstr "" 14167 14168 #: kio/knfotranslator.cpp:67 14169 #, fuzzy, kde-format 14170 #| msgid "Link" 14171 msgctxt "@label number of lines" 14172 msgid "Lines" 14173 msgstr "Wotkaz" 14174 14175 #: kio/knfotranslator.cpp:68 14176 #, kde-format 14177 msgctxt "@label" 14178 msgid "Programming Language" 14179 msgstr "" 14180 14181 #: kio/knfotranslator.cpp:69 14182 #, kde-format 14183 msgctxt "@label" 14184 msgid "Sample Rate" 14185 msgstr "" 14186 14187 #: kio/knfotranslator.cpp:70 14188 #, fuzzy, kde-format 14189 #| msgid "Write" 14190 msgctxt "@label" 14191 msgid "Width" 14192 msgstr "Pisać" 14193 14194 #: kio/knfotranslator.cpp:71 14195 #, kde-format 14196 msgctxt "@label number of words" 14197 msgid "Words" 14198 msgstr "" 14199 14200 #: kio/knfotranslator.cpp:72 14201 #, kde-format 14202 msgctxt "@label EXIF aperture value" 14203 msgid "Aperture" 14204 msgstr "" 14205 14206 #: kio/knfotranslator.cpp:73 14207 #, kde-format 14208 msgctxt "@label EXIF" 14209 msgid "Exposure Bias Value" 14210 msgstr "" 14211 14212 #: kio/knfotranslator.cpp:74 14213 #, fuzzy, kde-format 14214 #| msgid "Exposure:" 14215 msgctxt "@label EXIF" 14216 msgid "Exposure Time" 14217 msgstr "Płaćiwy hač do:" 14218 14219 #: kio/knfotranslator.cpp:75 14220 #, fuzzy, kde-format 14221 #| msgid "Class" 14222 msgctxt "@label EXIF" 14223 msgid "Flash" 14224 msgstr "Klasa" 14225 14226 #: kio/knfotranslator.cpp:76 14227 #, kde-format 14228 msgctxt "@label EXIF" 14229 msgid "Focal Length" 14230 msgstr "" 14231 14232 #: kio/knfotranslator.cpp:77 14233 #, kde-format 14234 msgctxt "@label EXIF" 14235 msgid "Focal Length 35 mm" 14236 msgstr "" 14237 14238 #: kio/knfotranslator.cpp:78 14239 #, kde-format 14240 msgctxt "@label EXIF" 14241 msgid "ISO Speed Ratings" 14242 msgstr "" 14243 14244 #: kio/knfotranslator.cpp:79 14245 #, fuzzy, kde-format 14246 #| msgid "Mask" 14247 msgctxt "@label EXIF" 14248 msgid "Make" 14249 msgstr "Maska" 14250 14251 #: kio/knfotranslator.cpp:80 14252 #, kde-format 14253 msgctxt "@label EXIF" 14254 msgid "Metering Mode" 14255 msgstr "" 14256 14257 #: kio/knfotranslator.cpp:81 14258 #, kde-format 14259 msgctxt "@label EXIF" 14260 msgid "Model" 14261 msgstr "" 14262 14263 #: kio/knfotranslator.cpp:82 14264 #, fuzzy, kde-format 14265 #| msgid "Organization:" 14266 msgctxt "@label EXIF" 14267 msgid "Orientation" 14268 msgstr "Organizacija:" 14269 14270 #: kio/knfotranslator.cpp:83 14271 #, kde-format 14272 msgctxt "@label EXIF" 14273 msgid "White Balance" 14274 msgstr "" 14275 14276 #: kio/knfotranslator.cpp:84 14277 #, fuzzy, kde-format 14278 #| msgid "Directory" 14279 msgctxt "@label video director" 14280 msgid "Director" 14281 msgstr "Zapisk" 14282 14283 #: kio/knfotranslator.cpp:85 14284 #, fuzzy, kde-format 14285 #| msgid "&General" 14286 msgctxt "@label music genre" 14287 msgid "Genre" 14288 msgstr "&Powšitkownje" 14289 14290 #: kio/knfotranslator.cpp:86 14291 #, kde-format 14292 msgctxt "@label music album" 14293 msgid "Album" 14294 msgstr "" 14295 14296 #: kio/knfotranslator.cpp:87 14297 #, kde-format 14298 msgctxt "@label" 14299 msgid "Performer" 14300 msgstr "" 14301 14302 #: kio/knfotranslator.cpp:88 14303 #, fuzzy, kde-format 14304 msgctxt "@label" 14305 msgid "Release Date" 14306 msgstr "Z&ničić" 14307 14308 #: kio/knfotranslator.cpp:89 14309 #, kde-format 14310 msgctxt "@label music track number" 14311 msgid "Track" 14312 msgstr "" 14313 14314 #: kio/knfotranslator.cpp:90 14315 #, fuzzy, kde-format 14316 #| msgid "URL Resource Invalid" 14317 msgctxt "@label resource created time" 14318 msgid "Resource Created" 14319 msgstr "Njekorektna URL-resursa." 14320 14321 #: kio/knfotranslator.cpp:91 14322 #, fuzzy, kde-format 14323 #| msgctxt "The source of a file operation" 14324 #| msgid "Source" 14325 msgctxt "@label" 14326 msgid "Sub Resource" 14327 msgstr "Žórło" 14328 14329 #: kio/knfotranslator.cpp:92 14330 #, fuzzy, kde-format 14331 #| msgid "Modified:" 14332 msgctxt "@label resource last modified" 14333 msgid "Resource Modified" 14334 msgstr "Změnjeny:" 14335 14336 #: kio/knfotranslator.cpp:93 14337 #, fuzzy, kde-format 14338 #| msgid "Sorting" 14339 msgctxt "@label" 14340 msgid "Numeric Rating" 14341 msgstr "Rjadowanje" 14342 14343 #: kio/knfotranslator.cpp:94 14344 #, kde-format 14345 msgctxt "@label" 14346 msgid "Copied From" 14347 msgstr "" 14348 14349 #: kio/knfotranslator.cpp:95 14350 #, kde-format 14351 msgctxt "@label" 14352 msgid "First Usage" 14353 msgstr "" 14354 14355 #: kio/knfotranslator.cpp:96 14356 #, kde-format 14357 msgctxt "@label" 14358 msgid "Last Usage" 14359 msgstr "" 14360 14361 #: kio/knfotranslator.cpp:97 14362 #, fuzzy, kde-format 14363 #| msgid "Comment" 14364 msgctxt "@label" 14365 msgid "Usage Count" 14366 msgstr "Komentar" 14367 14368 #: kio/knfotranslator.cpp:98 14369 #, kde-format 14370 msgctxt "@label" 14371 msgid "Unix File Group" 14372 msgstr "" 14373 14374 #: kio/knfotranslator.cpp:99 14375 #, kde-format 14376 msgctxt "@label" 14377 msgid "Unix File Mode" 14378 msgstr "" 14379 14380 #: kio/knfotranslator.cpp:100 14381 #, fuzzy, kde-format 14382 #| msgid "Open file dialog" 14383 msgctxt "@label" 14384 msgid "Unix File Owner" 14385 msgstr "Dialog za wočinjenje dataje" 14386 14387 #: kio/knfotranslator.cpp:101 14388 #, fuzzy, kde-format 14389 #| msgid "Type" 14390 msgctxt "@label file type" 14391 msgid "Type" 14392 msgstr "Družina" 14393 14394 #: kio/knfotranslator.cpp:102 14395 #, kde-format 14396 msgctxt "@label Number of fuzzy translations" 14397 msgid "Fuzzy Translations" 14398 msgstr "" 14399 14400 #: kio/knfotranslator.cpp:103 14401 #, kde-format 14402 msgctxt "@label Name of last translator" 14403 msgid "Last Translator" 14404 msgstr "" 14405 14406 #: kio/knfotranslator.cpp:104 14407 #, kde-format 14408 msgctxt "@label Number of obsolete translations" 14409 msgid "Obsolete Translations" 14410 msgstr "" 14411 14412 #: kio/knfotranslator.cpp:105 14413 #, kde-format 14414 msgctxt "@label" 14415 msgid "Translation Source Date" 14416 msgstr "" 14417 14418 #: kio/knfotranslator.cpp:106 14419 #, kde-format 14420 msgctxt "@label Number of total translations" 14421 msgid "Total Translations" 14422 msgstr "" 14423 14424 #: kio/knfotranslator.cpp:107 14425 #, fuzzy, kde-format 14426 #| msgid "Created:" 14427 msgctxt "@label Number of translated strings" 14428 msgid "Translated" 14429 msgstr "Stworjene:" 14430 14431 #: kio/knfotranslator.cpp:108 14432 #, kde-format 14433 msgctxt "@label" 14434 msgid "Translation Date" 14435 msgstr "" 14436 14437 #: kio/knfotranslator.cpp:109 14438 #, kde-format 14439 msgctxt "@label Number of untranslated strings" 14440 msgid "Untranslated" 14441 msgstr "" 14442 14443 #: kio/kpreviewprops.cpp:51 14444 #, kde-format 14445 msgid "P&review" 14446 msgstr "Pře&hladka" 14447 14448 #: kio/kscan.cpp:49 14449 #, kde-format 14450 msgid "Acquire Image" 14451 msgstr "Wobraz wobstarać" 14452 14453 #: kio/kscan.cpp:97 14454 #, kde-format 14455 msgid "OCR Image" 14456 msgstr "OCR-wobraz" 14457 14458 #: kio/netaccess.cpp:102 14459 #, kde-format 14460 msgid "File '%1' is not readable" 14461 msgstr "Dataja '%1' njehodźi so čitać" 14462 14463 #: kio/netaccess.cpp:435 14464 #, kde-format 14465 msgid "ERROR: Unknown protocol '%1'" 14466 msgstr "ZMYLK: Njeznaty protokol '%1'" 14467 14468 #: kio/passworddialog.cpp:56 14469 #, kde-format 14470 msgid "Authorization Dialog" 14471 msgstr "Awtorizaciski dialog" 14472 14473 #: kioslave/metainfo/metainfo.cpp:98 14474 #, kde-format 14475 msgid "No metainfo for %1" 14476 msgstr "Žana metainformacija za %1" 14477 14478 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14479 #: kssl/kcm/cacertificates.ui:24 14480 #, fuzzy, kde-format 14481 #| msgid "Organization:" 14482 msgid "Organization / Common Name" 14483 msgstr "Organizacija:" 14484 14485 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14486 #: kssl/kcm/cacertificates.ui:29 14487 #, fuzzy, kde-format 14488 #| msgid "Organizational unit:" 14489 msgid "Organizational Unit" 14490 msgstr "Dźěl organizacije:" 14491 14492 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14493 #: kssl/kcm/cacertificates.ui:42 14494 #, kde-format 14495 msgid "Display..." 14496 msgstr "" 14497 14498 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14499 #: kssl/kcm/cacertificates.ui:68 14500 #, fuzzy, kde-format 14501 #| msgid "disable XIM" 14502 msgid "Disable" 14503 msgstr "hasnje XIM." 14504 14505 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14506 #: kssl/kcm/cacertificates.ui:78 14507 #, fuzzy, kde-format 14508 #| msgid "Emblems" 14509 msgid "Enable" 14510 msgstr "Emblemy" 14511 14512 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14513 #: kssl/kcm/cacertificates.ui:104 14514 #, kde-format 14515 msgid "Remove" 14516 msgstr "Wotstronić" 14517 14518 #. i18n: ectx: property (text), widget (QPushButton, add) 14519 #: kssl/kcm/cacertificates.ui:111 14520 #, kde-format 14521 msgid "Add..." 14522 msgstr "Dodać..." 14523 14524 #: kssl/kcm/cacertificatespage.cpp:140 14525 #, fuzzy, kde-format 14526 #| msgid "Send certificate" 14527 msgid "System certificates" 14528 msgstr "Certifikat pósłać" 14529 14530 #: kssl/kcm/cacertificatespage.cpp:147 14531 #, fuzzy, kde-format 14532 #| msgid "Send certificate" 14533 msgid "User-added certificates" 14534 msgstr "Certifikat pósłać" 14535 14536 #: kssl/kcm/cacertificatespage.cpp:302 14537 #, fuzzy, kde-format 14538 #| msgid "Certificate" 14539 msgid "Pick Certificates" 14540 msgstr "Certifikat" 14541 14542 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14543 #: kssl/kcm/displaycert.ui:23 14544 #, fuzzy, kde-format 14545 #| msgid "Security Information" 14546 msgid "<b>Subject Information</b>" 14547 msgstr "Informacija wo wěstosći" 14548 14549 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14550 #: kssl/kcm/displaycert.ui:39 14551 #, fuzzy, kde-format 14552 #| msgid " <b>[Cross Domain]</b>" 14553 msgid "<b>Issuer Information</b>" 14554 msgstr " <b>[Mjezydomainowy]</b>" 14555 14556 #. i18n: ectx: property (text), widget (QLabel, label) 14557 #: kssl/kcm/displaycert.ui:55 14558 #, fuzzy, kde-format 14559 #| msgid "<b>%1</b>" 14560 msgid "<b>Other</b>" 14561 msgstr "<b>%1</b>" 14562 14563 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14564 #: kssl/kcm/displaycert.ui:64 14565 #, fuzzy, kde-format 14566 #| msgid "Valid from:" 14567 msgid "Validity period" 14568 msgstr "Płaći wot:" 14569 14570 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14571 #: kssl/kcm/displaycert.ui:78 14572 #, fuzzy, kde-format 14573 #| msgid "Serial number:" 14574 msgid "Serial number" 14575 msgstr "Čisło serije" 14576 14577 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14578 #: kssl/kcm/displaycert.ui:92 14579 #, fuzzy, kde-format 14580 #| msgid "MD5 digest:" 14581 msgid "MD5 digest" 14582 msgstr "MD5 digest:" 14583 14584 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14585 #: kssl/kcm/displaycert.ui:106 14586 #, fuzzy, kde-format 14587 #| msgid "MD5 digest:" 14588 msgid "SHA1 digest" 14589 msgstr "MD5 digest:" 14590 14591 #: kssl/kcm/displaycertdialog.cpp:73 14592 #, fuzzy, kde-format 14593 #| msgctxt "folders, files" 14594 #| msgid "%1, %2" 14595 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14596 msgid "%1 to %2" 14597 msgstr "%1, %2" 14598 14599 #: kssl/kcm/kcmssl.cpp:37 14600 #, fuzzy, kde-format 14601 #| msgid "Reload configuration file" 14602 msgid "SSL Configuration Module" 14603 msgstr "Konfiguracisku dataju nowa začitać." 14604 14605 #: kssl/kcm/kcmssl.cpp:39 14606 #, kde-format 14607 msgid "Copyright 2010 Andreas Hartmetz" 14608 msgstr "" 14609 14610 #: kssl/kcm/kcmssl.cpp:40 14611 #, kde-format 14612 msgid "Andreas Hartmetz" 14613 msgstr "" 14614 14615 #: kssl/kcm/kcmssl.cpp:52 14616 #, fuzzy, kde-format 14617 #| msgid "Link" 14618 msgid "SSL Signers" 14619 msgstr "Wotkaz" 14620 14621 #: kssl/ksslcertificate.cpp:202 14622 #, kde-format 14623 msgid "Signature Algorithm: " 14624 msgstr "signaturowy algoritmus:" 14625 14626 #: kssl/ksslcertificate.cpp:203 14627 #, kde-format 14628 msgid "Unknown" 14629 msgstr "njeznate" 14630 14631 #: kssl/ksslcertificate.cpp:206 14632 #, kde-format 14633 msgid "Signature Contents:" 14634 msgstr "Wobsah signatury:" 14635 14636 #: kssl/ksslcertificate.cpp:341 14637 #, kde-format 14638 msgctxt "Unknown" 14639 msgid "Unknown key algorithm" 14640 msgstr "Njeznaty algoritmus za kluč" 14641 14642 #: kssl/ksslcertificate.cpp:347 14643 #, kde-format 14644 msgid "Key type: RSA (%1 bit)" 14645 msgstr "Družina kluča: RSA (%1 bit)" 14646 14647 #: kssl/ksslcertificate.cpp:349 14648 #, kde-format 14649 msgid "Modulus: " 14650 msgstr "Modulus:" 14651 14652 #: kssl/ksslcertificate.cpp:362 14653 #, kde-format 14654 msgid "Exponent: 0x" 14655 msgstr "Eksponent: 0x" 14656 14657 #: kssl/ksslcertificate.cpp:374 14658 #, kde-format 14659 msgid "Key type: DSA (%1 bit)" 14660 msgstr "Družina kluča: DSA (%1 bit)" 14661 14662 #: kssl/ksslcertificate.cpp:376 14663 #, kde-format 14664 msgid "Prime: " 14665 msgstr "Primska ličba: " 14666 14667 #: kssl/ksslcertificate.cpp:389 14668 #, kde-format 14669 msgid "160 bit prime factor: " 14670 msgstr "160-bitowy primski faktor:" 14671 14672 #: kssl/ksslcertificate.cpp:417 14673 #, kde-format 14674 msgid "Public key: " 14675 msgstr "Zjawny kluč:" 14676 14677 #: kssl/ksslcertificate.cpp:1065 14678 #, kde-format 14679 msgid "The certificate is valid." 14680 msgstr "Certifikat je walidny." 14681 14682 #: kssl/ksslcertificate.cpp:1067 14683 #, kde-format 14684 msgid "" 14685 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14686 "Authority) certificate can not be found." 14687 msgstr "" 14688 "Certifikat wupisowarja njehodźi so wobstarać. To rěka, zo so certifikat CA " 14689 "(Certificate Authority) njehodźi namakać. " 14690 14691 #: kssl/ksslcertificate.cpp:1069 14692 #, kde-format 14693 msgid "" 14694 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14695 "CA's (Certificate Authority) CRL can not be found." 14696 msgstr "" 14697 "Certificate Revocation List njehodźi so wobstarać. To rěka, zo so CRL tuteje " 14698 "CA (Certificate Authority) njehodźi namakać. " 14699 14700 #: kssl/ksslcertificate.cpp:1071 14701 #, kde-format 14702 msgid "" 14703 "The decryption of the certificate's signature failed. This means it could " 14704 "not even be calculated as opposed to just not matching the expected result." 14705 msgstr "" 14706 "Podpismo certifikata njehodźi so dešifrować. To rěka, zo so ani wobličić " 14707 "njehodźi, nic jehož, zo wuslědk njetrjechi." 14708 14709 #: kssl/ksslcertificate.cpp:1073 14710 #, kde-format 14711 msgid "" 14712 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14713 "This means it could not even be calculated as opposed to just not matching " 14714 "the expected result." 14715 msgstr "" 14716 "Podpismo CRL (Certificate Revocation List) njehodźi so dešifrować. To rěka, " 14717 "zo so ani wobličić njehodźi, nic jehož, zo wuslědk njetrjechi." 14718 14719 #: kssl/ksslcertificate.cpp:1075 14720 #, kde-format 14721 msgid "" 14722 "The decoding of the public key of the issuer failed. This means that the " 14723 "CA's (Certificate Authority) certificate can not be used to verify the " 14724 "certificate you wanted to use." 14725 msgstr "" 14726 "Zjawny kluč wupisowarja njehodźi so dekodować. To rěka, zo so certifikat CA " 14727 "(Certificate Authority) njehodźi wužiwać za wopodstatnjenje certifikata, " 14728 "kotryž chceće wužić." 14729 14730 #: kssl/ksslcertificate.cpp:1077 14731 #, kde-format 14732 msgid "" 14733 "The certificate's signature is invalid. This means that the certificate can " 14734 "not be verified." 14735 msgstr "" 14736 "Podpismo certifikata njetrjechi. To rěka, zo tutón certifikat so njehodźi " 14737 "werifikować." 14738 14739 #: kssl/ksslcertificate.cpp:1079 14740 #, fuzzy, kde-format 14741 #| msgid "" 14742 #| "Certificate signing authority root files could not be found so the " 14743 #| "certificate is not verified." 14744 msgid "" 14745 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14746 "that the CRL can not be verified." 14747 msgstr "" 14748 "Zakładne dataje za přepruwowanje certifikata njehodźachu so namakać, tak zo " 14749 "tutón certifikat njeje werifikowany." 14750 14751 #: kssl/ksslcertificate.cpp:1081 14752 #, kde-format 14753 msgid "The certificate is not valid, yet." 14754 msgstr "Certifikat njeje hišće walidny." 14755 14756 #: kssl/ksslcertificate.cpp:1083 14757 #, kde-format 14758 msgid "The certificate is not valid, any more." 14759 msgstr "Certifikat hižo njeje walidny." 14760 14761 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14762 #, kde-format 14763 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14764 msgstr "CRL (Certificate Revocation List) njeje hišće walidny." 14765 14766 #: kssl/ksslcertificate.cpp:1089 14767 #, kde-format 14768 msgid "The time format of the certificate's 'notBefore' field is invalid." 14769 msgstr "Časowy format (hódnota za 'notBefore') certifikata njetrjechi." 14770 14771 #: kssl/ksslcertificate.cpp:1091 14772 #, kde-format 14773 msgid "The time format of the certificate's 'notAfter' field is invalid." 14774 msgstr "Časowy format (hódnota za 'notAfter') certifikata njetrjechi." 14775 14776 #: kssl/ksslcertificate.cpp:1093 14777 #, kde-format 14778 msgid "" 14779 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14780 "field is invalid." 14781 msgstr "" 14782 "Časowy format (hódnota za 'lastUpdate') CRL (Certificate Revocation List) " 14783 "njetrjechi." 14784 14785 #: kssl/ksslcertificate.cpp:1095 14786 #, kde-format 14787 msgid "" 14788 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14789 "field is invalid." 14790 msgstr "" 14791 "Časowy format (hódnota za 'nextUpdate') CRL (Certificate Revocation List) " 14792 "njetrjechi." 14793 14794 #: kssl/ksslcertificate.cpp:1097 14795 #, kde-format 14796 msgid "The OpenSSL process ran out of memory." 14797 msgstr "OpenSSL-procesej pomjatk njedosaha." 14798 14799 #: kssl/ksslcertificate.cpp:1099 14800 #, kde-format 14801 msgid "" 14802 "The certificate is self-signed and not in the list of trusted certificates. " 14803 "If you want to accept this certificate, import it into the list of trusted " 14804 "certificates." 14805 msgstr "" 14806 "Certifikat je wot wobsydnika wupisany a njeje w lisćinje dowěryhódnych " 14807 "certifikatow. Jeli chceće jón akceptować, importujće jón do tuteje lisćiny." 14808 14809 #: kssl/ksslcertificate.cpp:1102 14810 #, kde-format 14811 msgid "" 14812 "The certificate is self-signed. While the trust chain could be built up, the " 14813 "root CA's (Certificate Authority) certificate can not be found." 14814 msgstr "" 14815 14816 #: kssl/ksslcertificate.cpp:1104 14817 #, kde-format 14818 msgid "" 14819 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14820 "your trust chain is broken." 14821 msgstr "" 14822 14823 #: kssl/ksslcertificate.cpp:1106 14824 #, kde-format 14825 msgid "" 14826 "The certificate can not be verified as it is the only certificate in the " 14827 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14828 "to import it into the list of trusted certificates." 14829 msgstr "" 14830 14831 #: kssl/ksslcertificate.cpp:1108 14832 #, kde-format 14833 msgid "The certificate chain is longer than the maximum depth specified." 14834 msgstr "" 14835 14836 #: kssl/ksslcertificate.cpp:1111 14837 #, kde-format 14838 msgid "The certificate has been revoked." 14839 msgstr "Certifikat je zběhnjeny." 14840 14841 #: kssl/ksslcertificate.cpp:1113 14842 #, fuzzy, kde-format 14843 #| msgid "The certificate is invalid." 14844 msgid "The certificate's CA (Certificate Authority) is invalid." 14845 msgstr "Certifikat njeje walidny." 14846 14847 #: kssl/ksslcertificate.cpp:1115 14848 #, kde-format 14849 msgid "" 14850 "The length of the trust chain exceeded one of the CA's (Certificate " 14851 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14852 msgstr "" 14853 14854 #: kssl/ksslcertificate.cpp:1117 14855 #, kde-format 14856 msgid "" 14857 "The certificate has not been signed for the purpose you tried to use it for. " 14858 "This means the CA (Certificate Authority) does not allow this usage." 14859 msgstr "" 14860 14861 #: kssl/ksslcertificate.cpp:1120 14862 #, kde-format 14863 msgid "" 14864 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14865 "to use this certificate for." 14866 msgstr "" 14867 14868 #: kssl/ksslcertificate.cpp:1123 14869 #, kde-format 14870 msgid "" 14871 "The root CA (Certificate Authority) has been marked to be rejected for the " 14872 "purpose you tried to use it for." 14873 msgstr "" 14874 14875 #: kssl/ksslcertificate.cpp:1125 14876 #, fuzzy, kde-format 14877 #| msgid "" 14878 #| "The IP address of the host %1 does not match the one the certificate was " 14879 #| "issued to." 14880 msgid "" 14881 "The certificate's CA (Certificate Authority) does not match the CA name of " 14882 "the certificate." 14883 msgstr "" 14884 "IP-adresa hosta %1 so njekryje z adresu, za kotruž bu certifikat wupisany." 14885 14886 #: kssl/ksslcertificate.cpp:1127 14887 #, fuzzy, kde-format 14888 #| msgid "" 14889 #| "The IP address of the host %1 does not match the one the certificate was " 14890 #| "issued to." 14891 msgid "" 14892 "The CA (Certificate Authority) certificate's key ID does not match the key " 14893 "ID in the 'Issuer' section of the certificate you are trying to use." 14894 msgstr "" 14895 "IP-adresa hosta %1 so njekryje z adresu, za kotruž bu certifikat wupisany." 14896 14897 #: kssl/ksslcertificate.cpp:1129 14898 #, kde-format 14899 msgid "" 14900 "The CA (Certificate Authority) certificate's key ID and name do not match " 14901 "the key ID and name in the 'Issuer' section of the certificate you are " 14902 "trying to use." 14903 msgstr "" 14904 14905 #: kssl/ksslcertificate.cpp:1131 14906 #, kde-format 14907 msgid "" 14908 "The certificate's CA (Certificate Authority) is not allowed to sign " 14909 "certificates." 14910 msgstr "" 14911 14912 #: kssl/ksslcertificate.cpp:1133 14913 #, kde-format 14914 msgid "OpenSSL could not be verified." 14915 msgstr "OpenSSL njehodźeše so werifikować." 14916 14917 #: kssl/ksslcertificate.cpp:1137 14918 #, kde-format 14919 msgid "" 14920 "The signature test for this certificate failed. This could mean that the " 14921 "signature of this certificate or any in its trust path are invalid, could " 14922 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14923 "verified. If you see this message, please let the author of the software you " 14924 "are using know that he or she should use the new, more specific error " 14925 "messages." 14926 msgstr "" 14927 14928 #: kssl/ksslcertificate.cpp:1139 14929 #, kde-format 14930 msgid "" 14931 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14932 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14933 "valid yet or not valid any more. If you see this message, please let the " 14934 "author of the software you are using know that he or she should use the new, " 14935 "more specific error messages." 14936 msgstr "" 14937 14938 #: kssl/ksslcertificate.cpp:1145 14939 #, kde-format 14940 msgid "" 14941 "Certificate signing authority root files could not be found so the " 14942 "certificate is not verified." 14943 msgstr "" 14944 "Zakładne dataje za přepruwowanje certifikata njehodźachu so namakać, tak zo " 14945 "tutón certifikat njeje werifikowany." 14946 14947 #: kssl/ksslcertificate.cpp:1147 14948 #, kde-format 14949 msgid "SSL support was not found." 14950 msgstr "Njemóžach SSL-podpěru zwěsćić." 14951 14952 #: kssl/ksslcertificate.cpp:1149 14953 #, kde-format 14954 msgid "Private key test failed." 14955 msgstr "Přepruwowanje priwatneho kluča je so zwrěšćiło." 14956 14957 #: kssl/ksslcertificate.cpp:1151 14958 #, kde-format 14959 msgid "The certificate has not been issued for this host." 14960 msgstr "Certifikat njebu za tutón server wupisany." 14961 14962 #: kssl/ksslcertificate.cpp:1153 14963 #, kde-format 14964 msgid "This certificate is not relevant." 14965 msgstr "Certifikat njeje relewantny." 14966 14967 #: kssl/ksslcertificate.cpp:1158 14968 #, kde-format 14969 msgid "The certificate is invalid." 14970 msgstr "Certifikat njeje walidny." 14971 14972 #: kssl/ksslutils.cpp:90 14973 #, kde-format 14974 msgid "GMT" 14975 msgstr "GMT" 14976 14977 #, fuzzy 14978 #~ msgctxt "color" 14979 #~ msgid "hot" 14980 #~ msgstr "Thl" 14981 14982 #, fuzzy 14983 #~ msgctxt "color" 14984 #~ msgid "sea" 14985 #~ msgstr "Zastajić" 14986 14987 #, fuzzy 14988 #~ msgctxt "@item Calendar system" 14989 #~ msgid "Gregorian (Proleptic)" 14990 #~ msgstr "gregoriansce" 14991 14992 #, fuzzy 14993 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 14994 #~ msgid "of Mes" 14995 #~ msgstr "wot Meh" 14996 14997 #, fuzzy 14998 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 14999 #~ msgid "of Ter" 15000 #~ msgstr "wot Tira" 15001 15002 #, fuzzy 15003 #~ msgctxt "Ethiopian month 1 - ShortName" 15004 #~ msgid "Mes" 15005 #~ msgstr "Haj" 15006 15007 #, fuzzy 15008 #~ msgctxt "Ethiopian month 5 - LongName" 15009 #~ msgid "Ter" 15010 #~ msgstr "Wu" 15011 15012 #, fuzzy 15013 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15014 #~ msgid "Ham" 15015 #~ msgstr "rano" 15016 15017 #, fuzzy 15018 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15019 #~ msgid "Arb" 15020 #~ msgstr "Arb" 15021 15022 #, fuzzy 15023 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15024 #~ msgid "Rob" 15025 #~ msgstr "Nadawk" 15026 15027 #, fuzzy 15028 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15029 #~ msgid "Arb" 15030 #~ msgstr "Arb" 15031 15032 #~ msgctxt "of May long" 15033 #~ msgid "of May" 15034 #~ msgstr "meje" 15035 15036 #~ msgctxt "May long" 15037 #~ msgid "May" 15038 #~ msgstr "meja" 15039 15040 #~ msgid "R. Thaani" 15041 #~ msgstr "R. Thaani" 15042 15043 #~ msgid "J. Thaani" 15044 #~ msgstr "J. Thaani" 15045 15046 #~ msgid "Hijjah" 15047 #~ msgstr "Hijjah" 15048 15049 #~ msgctxt "of Tir long" 15050 #~ msgid "of Tir" 15051 #~ msgstr "wot Tir" 15052 15053 #~ msgctxt "of Dei long" 15054 #~ msgid "of Dei" 15055 #~ msgstr "wot Dei" 15056 15057 #~ msgctxt "Tir long" 15058 #~ msgid "Tir" 15059 #~ msgstr "Tir" 15060 15061 #~ msgctxt "Dei long" 15062 #~ msgid "Dei" 15063 #~ msgstr "Dei" 15064 15065 #~ msgctxt "Shanbe short" 15066 #~ msgid "shn" 15067 #~ msgstr "shn"