Warning, /frameworks/kdelibs4support/po/gu/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Gujarati 0002 # Copyright (C) 2008 This_file_is_part_of_KDE 0003 # This file is distributed under the same license as the PACKAGE package. 0004 # 0005 # Kartik Mistry <kartik.mistry@gmail.com>, 2008. 0006 msgid "" 0007 msgstr "" 0008 "Project-Id-Version: kdelibs4\n" 0009 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0010 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0011 "PO-Revision-Date: 2009-11-22 00:01+0530\n" 0012 "Last-Translator: Kartik Mistry <kartik.mistry@gmail.com>\n" 0013 "Language-Team: Gujarati <team@utkarsh.org>\n" 0014 "Language: gu\n" 0015 "MIME-Version: 1.0\n" 0016 "Content-Type: text/plain; charset=UTF-8\n" 0017 "Content-Transfer-Encoding: 8bit\n" 0018 "Plural-Forms: nplurals=2; plural=(n!=1);\n" 0019 "X-Generator: KBabel 1.11.4\n" 0020 0021 #, kde-format 0022 msgctxt "NAME OF TRANSLATORS" 0023 msgid "Your names" 0024 msgstr "Pragnesh Radadiya" 0025 0026 #, kde-format 0027 msgctxt "EMAIL OF TRANSLATORS" 0028 msgid "Your emails" 0029 msgstr "pg.radadia@gmail.com" 0030 0031 #, kde-format 0032 msgctxt "color" 0033 msgid "AliceBlue" 0034 msgstr "એલિસવાદળી" 0035 0036 #, kde-format 0037 msgctxt "color" 0038 msgid "AntiqueWhite" 0039 msgstr "એન્ટિકસફેદ" 0040 0041 #, kde-format 0042 msgctxt "color" 0043 msgid "AntiqueWhite1" 0044 msgstr "એન્ટિકસફેદ ૧" 0045 0046 #, kde-format 0047 msgctxt "color" 0048 msgid "AntiqueWhite2" 0049 msgstr "એન્ટિકસફેદ ૨" 0050 0051 #, kde-format 0052 msgctxt "color" 0053 msgid "AntiqueWhite3" 0054 msgstr "એન્ટિકસફેદ ૩" 0055 0056 #, kde-format 0057 msgctxt "color" 0058 msgid "AntiqueWhite4" 0059 msgstr "એન્ટિકસફેદ ૪" 0060 0061 #, kde-format 0062 msgctxt "color" 0063 msgid "BlanchedAlmond" 0064 msgstr "બ્લેન્ચડઅલમોન્ડ" 0065 0066 #, kde-format 0067 msgctxt "color" 0068 msgid "BlueViolet" 0069 msgstr "વાદળીજાંબલી" 0070 0071 #, kde-format 0072 msgctxt "color" 0073 msgid "CadetBlue" 0074 msgstr "કેડેટવાદળી" 0075 0076 #, kde-format 0077 msgctxt "color" 0078 msgid "CadetBlue1" 0079 msgstr "કેડેટવાદળી ૧" 0080 0081 #, kde-format 0082 msgctxt "color" 0083 msgid "CadetBlue2" 0084 msgstr "કેડેટવાદળી ૨" 0085 0086 #, kde-format 0087 msgctxt "color" 0088 msgid "CadetBlue3" 0089 msgstr "કેડેટવાદળી ૩" 0090 0091 #, kde-format 0092 msgctxt "color" 0093 msgid "CadetBlue4" 0094 msgstr "કેડેટવાદળી ૪" 0095 0096 #, kde-format 0097 msgctxt "color" 0098 msgid "CornflowerBlue" 0099 msgstr "કોર્નફ્લાવરવાદળી" 0100 0101 #, kde-format 0102 msgctxt "color" 0103 msgid "DarkBlue" 0104 msgstr "ઘાટુંવાદળી" 0105 0106 #, kde-format 0107 msgctxt "color" 0108 msgid "DarkCyan" 0109 msgstr "ઘાટોભૂરો" 0110 0111 #, kde-format 0112 msgctxt "color" 0113 msgid "DarkGoldenrod" 0114 msgstr "ઘાટોસોનેરી" 0115 0116 #, kde-format 0117 msgctxt "color" 0118 msgid "DarkGoldenrod1" 0119 msgstr "ઘાટોસોનેરી ૧" 0120 0121 #, kde-format 0122 msgctxt "color" 0123 msgid "DarkGoldenrod2" 0124 msgstr "ઘાટોસોનેરી ૨" 0125 0126 #, kde-format 0127 msgctxt "color" 0128 msgid "DarkGoldenrod3" 0129 msgstr "ઘાટોસોનેરી ૩" 0130 0131 #, kde-format 0132 msgctxt "color" 0133 msgid "DarkGoldenrod4" 0134 msgstr "ઘાટોસોનેરી ૪" 0135 0136 #, kde-format 0137 msgctxt "color" 0138 msgid "DarkGray" 0139 msgstr "ઘાટોરાખોડી" 0140 0141 #, kde-format 0142 msgctxt "color" 0143 msgid "DarkGreen" 0144 msgstr "ઘાટોલીલો" 0145 0146 #, kde-format 0147 msgctxt "color" 0148 msgid "DarkGrey" 0149 msgstr "ઘાટોરાખોડી" 0150 0151 #, kde-format 0152 msgctxt "color" 0153 msgid "DarkKhaki" 0154 msgstr "ઘાટોખાખી" 0155 0156 #, kde-format 0157 msgctxt "color" 0158 msgid "DarkMagenta" 0159 msgstr "ઘાટોમેજેન્ટા" 0160 0161 #, kde-format 0162 msgctxt "color" 0163 msgid "DarkOliveGreen" 0164 msgstr "ઘાટોઓલિવલીલો" 0165 0166 #, kde-format 0167 msgctxt "color" 0168 msgid "DarkOliveGreen1" 0169 msgstr "ઘાટોઓલિવલીલો ૧" 0170 0171 #, kde-format 0172 msgctxt "color" 0173 msgid "DarkOliveGreen2" 0174 msgstr "ઘાટોઓલિવલીલો ૨" 0175 0176 #, kde-format 0177 msgctxt "color" 0178 msgid "DarkOliveGreen3" 0179 msgstr "ઘાટોઓલિવલીલો ૩" 0180 0181 #, kde-format 0182 msgctxt "color" 0183 msgid "DarkOliveGreen4" 0184 msgstr "ઘાટોઓલિવલીલો ૪" 0185 0186 #, kde-format 0187 msgctxt "color" 0188 msgid "DarkOrange" 0189 msgstr "ઘાટોનારંગી" 0190 0191 #, kde-format 0192 msgctxt "color" 0193 msgid "DarkOrange1" 0194 msgstr "ઘાટોનારંગી ૧" 0195 0196 #, kde-format 0197 msgctxt "color" 0198 msgid "DarkOrange2" 0199 msgstr "ઘાટોનારંગી ૨" 0200 0201 #, kde-format 0202 msgctxt "color" 0203 msgid "DarkOrange3" 0204 msgstr "ઘાટોનારંગી ૩" 0205 0206 #, kde-format 0207 msgctxt "color" 0208 msgid "DarkOrange4" 0209 msgstr "ઘાટોનારંગી ૪" 0210 0211 #, kde-format 0212 msgctxt "color" 0213 msgid "DarkOrchid" 0214 msgstr "ઘાટોઓર્કિડ" 0215 0216 #, kde-format 0217 msgctxt "color" 0218 msgid "DarkOrchid1" 0219 msgstr "ઘાટોઓર્કિડ ૧" 0220 0221 #, kde-format 0222 msgctxt "color" 0223 msgid "DarkOrchid2" 0224 msgstr "ઘાટોઓર્કિડ ૨" 0225 0226 #, kde-format 0227 msgctxt "color" 0228 msgid "DarkOrchid3" 0229 msgstr "ઘાટોઓર્કિડ ૩" 0230 0231 #, kde-format 0232 msgctxt "color" 0233 msgid "DarkOrchid4" 0234 msgstr "ઘાટોઓર્કિડ ૪" 0235 0236 #, kde-format 0237 msgctxt "color" 0238 msgid "DarkRed" 0239 msgstr "ઘાટોલાલ" 0240 0241 #, kde-format 0242 msgctxt "color" 0243 msgid "DarkSalmon" 0244 msgstr "ઘાટોસોલ્મોન" 0245 0246 #, kde-format 0247 msgctxt "color" 0248 msgid "DarkSeaGreen" 0249 msgstr "ઘાટોસમુદ્રીલીલો" 0250 0251 #, kde-format 0252 msgctxt "color" 0253 msgid "DarkSeaGreen1" 0254 msgstr "ઘાટોસમુદ્રીલીલો ૧" 0255 0256 #, kde-format 0257 msgctxt "color" 0258 msgid "DarkSeaGreen2" 0259 msgstr "ઘાટોસમુદ્રીલીલો ૨" 0260 0261 #, kde-format 0262 msgctxt "color" 0263 msgid "DarkSeaGreen3" 0264 msgstr "ઘાટોસમુદ્રીલીલો ૩" 0265 0266 #, kde-format 0267 msgctxt "color" 0268 msgid "DarkSeaGreen4" 0269 msgstr "ઘાટોસમુદ્રીલીલો ૪" 0270 0271 #, kde-format 0272 msgctxt "color" 0273 msgid "DarkSlateBlue" 0274 msgstr "ઘાટોસ્લેટવાદળી" 0275 0276 #, kde-format 0277 msgctxt "color" 0278 msgid "DarkSlateGray" 0279 msgstr "ઘાટોસ્લેટભૂખરો" 0280 0281 #, kde-format 0282 msgctxt "color" 0283 msgid "DarkSlateGray1" 0284 msgstr "ઘાટોસ્લેટભૂખરો ૧" 0285 0286 #, kde-format 0287 msgctxt "color" 0288 msgid "DarkSlateGray2" 0289 msgstr "ઘાટોસ્લેટભૂખરો ૨" 0290 0291 #, kde-format 0292 msgctxt "color" 0293 msgid "DarkSlateGray3" 0294 msgstr "ઘાટોસ્લેટભૂખરો ૩" 0295 0296 #, kde-format 0297 msgctxt "color" 0298 msgid "DarkSlateGray4" 0299 msgstr "ઘાટોસ્લેટભૂખરો ૪" 0300 0301 #, kde-format 0302 msgctxt "color" 0303 msgid "DarkSlateGrey" 0304 msgstr "ઘાટોસ્લેટભૂખરો" 0305 0306 #, kde-format 0307 msgctxt "color" 0308 msgid "DarkTurquoise" 0309 msgstr "ઘાટોભૂરોલીલો" 0310 0311 #, kde-format 0312 msgctxt "color" 0313 msgid "DarkViolet" 0314 msgstr "ઘાટોજાંબલી" 0315 0316 #, kde-format 0317 msgctxt "color" 0318 msgid "DeepPink" 0319 msgstr "ઉંડોગુલાબી" 0320 0321 #, kde-format 0322 msgctxt "color" 0323 msgid "DeepPink1" 0324 msgstr "ઉંડોગુલાબી ૧" 0325 0326 #, kde-format 0327 msgctxt "color" 0328 msgid "DeepPink2" 0329 msgstr "ઉંડોગુલાબી ૨" 0330 0331 #, kde-format 0332 msgctxt "color" 0333 msgid "DeepPink3" 0334 msgstr "ઉંડોગુલાબી ૩" 0335 0336 #, kde-format 0337 msgctxt "color" 0338 msgid "DeepPink4" 0339 msgstr "ઉંડોગુલાબી ૪" 0340 0341 #, kde-format 0342 msgctxt "color" 0343 msgid "DeepSkyBlue" 0344 msgstr "ઘાટોવાદળી" 0345 0346 #, kde-format 0347 msgctxt "color" 0348 msgid "DeepSkyBlue1" 0349 msgstr "ઘાટોવાદળી ૧" 0350 0351 #, kde-format 0352 msgctxt "color" 0353 msgid "DeepSkyBlue2" 0354 msgstr "ઘાટોવાદળી ૨" 0355 0356 #, kde-format 0357 msgctxt "color" 0358 msgid "DeepSkyBlue3" 0359 msgstr "ઘાટોવાદળી ૩" 0360 0361 #, kde-format 0362 msgctxt "color" 0363 msgid "DeepSkyBlue4" 0364 msgstr "ઘાટોવાદળી ૪" 0365 0366 #, kde-format 0367 msgctxt "color" 0368 msgid "DimGray" 0369 msgstr "આછોભૂખરો" 0370 0371 #, kde-format 0372 msgctxt "color" 0373 msgid "DimGrey" 0374 msgstr "આછોભૂખરો" 0375 0376 #, kde-format 0377 msgctxt "color" 0378 msgid "DodgerBlue" 0379 msgstr "ડોજરવાદળી" 0380 0381 #, kde-format 0382 msgctxt "color" 0383 msgid "DodgerBlue1" 0384 msgstr "ડોજરવાદળી ૧" 0385 0386 #, kde-format 0387 msgctxt "color" 0388 msgid "DodgerBlue2" 0389 msgstr "ડોજરવાદળી ૨" 0390 0391 #, kde-format 0392 msgctxt "color" 0393 msgid "DodgerBlue3" 0394 msgstr "ડોજરવાદળી ૩" 0395 0396 #, kde-format 0397 msgctxt "color" 0398 msgid "DodgerBlue4" 0399 msgstr "ડોજરવાદળી ૪" 0400 0401 #, kde-format 0402 msgctxt "color" 0403 msgid "FloralWhite" 0404 msgstr "ફ્લોરલસફેદ" 0405 0406 #, kde-format 0407 msgctxt "color" 0408 msgid "ForestGreen" 0409 msgstr "જંગલલીલો" 0410 0411 #, kde-format 0412 msgctxt "color" 0413 msgid "GhostWhite" 0414 msgstr "ઘોસ્ટસફેદ" 0415 0416 #, kde-format 0417 msgctxt "color" 0418 msgid "GreenYellow" 0419 msgstr "લીલોપીળો" 0420 0421 #, kde-format 0422 msgctxt "color" 0423 msgid "HotPink" 0424 msgstr "ઘાટોગુલાબી" 0425 0426 #, kde-format 0427 msgctxt "color" 0428 msgid "HotPink1" 0429 msgstr "ઘાટોગુલાબી ૧" 0430 0431 #, kde-format 0432 msgctxt "color" 0433 msgid "HotPink2" 0434 msgstr "ઘાટોગુલાબી ૨" 0435 0436 #, kde-format 0437 msgctxt "color" 0438 msgid "HotPink3" 0439 msgstr "ઘાટોગુલાબી ૩" 0440 0441 #, kde-format 0442 msgctxt "color" 0443 msgid "HotPink4" 0444 msgstr "ઘાટોગુલાબી ૪" 0445 0446 #, kde-format 0447 msgctxt "color" 0448 msgid "IndianRed" 0449 msgstr "ભારતીયલાલ" 0450 0451 #, kde-format 0452 msgctxt "color" 0453 msgid "IndianRed1" 0454 msgstr "ભારતીયલાલ ૧" 0455 0456 #, kde-format 0457 msgctxt "color" 0458 msgid "IndianRed2" 0459 msgstr "ભારતીયલાલ ૨" 0460 0461 #, kde-format 0462 msgctxt "color" 0463 msgid "IndianRed3" 0464 msgstr "ભારતીયલાલ ૩" 0465 0466 #, kde-format 0467 msgctxt "color" 0468 msgid "IndianRed4" 0469 msgstr "ભારતીયલાલ ૪" 0470 0471 #, kde-format 0472 msgctxt "color" 0473 msgid "LavenderBlush" 0474 msgstr "લવન્ડરબ્લુશ" 0475 0476 #, kde-format 0477 msgctxt "color" 0478 msgid "LavenderBlush1" 0479 msgstr "લવન્ડરબ્લુશ ૧" 0480 0481 #, kde-format 0482 msgctxt "color" 0483 msgid "LavenderBlush2" 0484 msgstr "લવન્ડરબ્લુશ ૨" 0485 0486 #, kde-format 0487 msgctxt "color" 0488 msgid "LavenderBlush3" 0489 msgstr "લવન્ડરબ્લુશ ૩" 0490 0491 #, kde-format 0492 msgctxt "color" 0493 msgid "LavenderBlush4" 0494 msgstr "લવન્ડરબ્લુશ ૪" 0495 0496 #, kde-format 0497 msgctxt "color" 0498 msgid "LawnGreen" 0499 msgstr "લોનલીલો" 0500 0501 #, kde-format 0502 msgctxt "color" 0503 msgid "LemonChiffon" 0504 msgstr "લેમનશિફોન" 0505 0506 #, kde-format 0507 msgctxt "color" 0508 msgid "LemonChiffon1" 0509 msgstr "લેમનશિફોન ૧" 0510 0511 #, kde-format 0512 msgctxt "color" 0513 msgid "LemonChiffon2" 0514 msgstr "લેમનશિફોન ૨" 0515 0516 #, kde-format 0517 msgctxt "color" 0518 msgid "LemonChiffon3" 0519 msgstr "લેમનશિફોન ૩" 0520 0521 #, kde-format 0522 msgctxt "color" 0523 msgid "LemonChiffon4" 0524 msgstr "લેમનશિફોન ૪" 0525 0526 #, kde-format 0527 msgctxt "color" 0528 msgid "LightBlue" 0529 msgstr "આછોભૂરો" 0530 0531 #, kde-format 0532 msgctxt "color" 0533 msgid "LightBlue1" 0534 msgstr "આછોભૂરો ૧" 0535 0536 #, kde-format 0537 msgctxt "color" 0538 msgid "LightBlue2" 0539 msgstr "આછોભૂરો ૨" 0540 0541 #, kde-format 0542 msgctxt "color" 0543 msgid "LightBlue3" 0544 msgstr "આછોભૂરો ૩" 0545 0546 #, kde-format 0547 msgctxt "color" 0548 msgid "LightBlue4" 0549 msgstr "આછોભૂરો ૪" 0550 0551 #, kde-format 0552 msgctxt "color" 0553 msgid "LightCoral" 0554 msgstr "આછોકોરલ" 0555 0556 #, kde-format 0557 msgctxt "color" 0558 msgid "LightCyan" 0559 msgstr "આછોવાદળી" 0560 0561 #, kde-format 0562 msgctxt "color" 0563 msgid "LightCyan1" 0564 msgstr "આછોવાદળી ૧" 0565 0566 #, kde-format 0567 msgctxt "color" 0568 msgid "LightCyan2" 0569 msgstr "આછોવાદળી ૨" 0570 0571 #, kde-format 0572 msgctxt "color" 0573 msgid "LightCyan3" 0574 msgstr "આછોવાદળી ૩" 0575 0576 #, kde-format 0577 msgctxt "color" 0578 msgid "LightCyan4" 0579 msgstr "આછોવાદળી ૪" 0580 0581 #, kde-format 0582 msgctxt "color" 0583 msgid "LightGoldenrod" 0584 msgstr "આછોસોનેરી" 0585 0586 #, kde-format 0587 msgctxt "color" 0588 msgid "LightGoldenrod1" 0589 msgstr "આછોસોનેરી ૧" 0590 0591 #, kde-format 0592 msgctxt "color" 0593 msgid "LightGoldenrod2" 0594 msgstr "આછોસોનેરી ૨" 0595 0596 #, kde-format 0597 msgctxt "color" 0598 msgid "LightGoldenrod3" 0599 msgstr "આછોસોનેરી ૩" 0600 0601 #, kde-format 0602 msgctxt "color" 0603 msgid "LightGoldenrod4" 0604 msgstr "આછોસોનેરી ૪" 0605 0606 #, kde-format 0607 msgctxt "color" 0608 msgid "LightGoldenrodYellow" 0609 msgstr "આછોસોનેરીપીળો" 0610 0611 #, kde-format 0612 msgctxt "color" 0613 msgid "LightGray" 0614 msgstr "આછોભૂખરો" 0615 0616 #, kde-format 0617 msgctxt "color" 0618 msgid "LightGreen" 0619 msgstr "આછોલીલો" 0620 0621 #, kde-format 0622 msgctxt "color" 0623 msgid "LightGrey" 0624 msgstr "આછોભૂખરો" 0625 0626 #, kde-format 0627 msgctxt "color" 0628 msgid "LightPink" 0629 msgstr "આછોગુલાબી" 0630 0631 #, kde-format 0632 msgctxt "color" 0633 msgid "LightPink1" 0634 msgstr "આછોગુલાબી ૧" 0635 0636 #, kde-format 0637 msgctxt "color" 0638 msgid "LightPink2" 0639 msgstr "આછોગુલાબી ૨" 0640 0641 #, kde-format 0642 msgctxt "color" 0643 msgid "LightPink3" 0644 msgstr "આછોગુલાબી ૩" 0645 0646 #, kde-format 0647 msgctxt "color" 0648 msgid "LightPink4" 0649 msgstr "આછોગુલાબી ૪" 0650 0651 #, kde-format 0652 msgctxt "color" 0653 msgid "LightSalmon" 0654 msgstr "આછોસાલ્મોન" 0655 0656 #, kde-format 0657 msgctxt "color" 0658 msgid "LightSalmon1" 0659 msgstr "આછોસાલ્મોન ૧" 0660 0661 #, kde-format 0662 msgctxt "color" 0663 msgid "LightSalmon2" 0664 msgstr "આછોસાલ્મોન ૨" 0665 0666 #, kde-format 0667 msgctxt "color" 0668 msgid "LightSalmon3" 0669 msgstr "આછોસાલ્મોન ૩" 0670 0671 #, kde-format 0672 msgctxt "color" 0673 msgid "LightSalmon4" 0674 msgstr "આછોસાલ્મોન ૪" 0675 0676 #, kde-format 0677 msgctxt "color" 0678 msgid "LightSeaGreen" 0679 msgstr "આછોસમુદ્રીલીલો" 0680 0681 #, kde-format 0682 msgctxt "color" 0683 msgid "LightSkyBlue" 0684 msgstr "આછોઆકાશીવાદળી" 0685 0686 #, kde-format 0687 msgctxt "color" 0688 msgid "LightSkyBlue1" 0689 msgstr "આછોઆકાશીવાદળી ૧" 0690 0691 #, kde-format 0692 msgctxt "color" 0693 msgid "LightSkyBlue2" 0694 msgstr "આછોઆકાશીવાદળી ૨" 0695 0696 #, kde-format 0697 msgctxt "color" 0698 msgid "LightSkyBlue3" 0699 msgstr "આછોઆકાશીવાદળી ૩" 0700 0701 #, kde-format 0702 msgctxt "color" 0703 msgid "LightSkyBlue4" 0704 msgstr "આછોઆકાશીવાદળી ૪" 0705 0706 #, kde-format 0707 msgctxt "color" 0708 msgid "LightSlateBlue" 0709 msgstr "આછોસ્લેટવાદળી" 0710 0711 #, kde-format 0712 msgctxt "color" 0713 msgid "LightSlateGray" 0714 msgstr "આછોસ્લેટભૂખરો" 0715 0716 #, kde-format 0717 msgctxt "color" 0718 msgid "LightSlateGrey" 0719 msgstr "આછોસ્લેટભૂખરો" 0720 0721 #, kde-format 0722 msgctxt "color" 0723 msgid "LightSteelBlue" 0724 msgstr "આછોસ્ટીલવાદળી" 0725 0726 #, kde-format 0727 msgctxt "color" 0728 msgid "LightSteelBlue1" 0729 msgstr "આછોસ્ટીલવાદળી ૧" 0730 0731 #, kde-format 0732 msgctxt "color" 0733 msgid "LightSteelBlue2" 0734 msgstr "આછોસ્ટીલવાદળી ૨" 0735 0736 #, kde-format 0737 msgctxt "color" 0738 msgid "LightSteelBlue3" 0739 msgstr "આછોસ્ટીલવાદળી ૩" 0740 0741 #, kde-format 0742 msgctxt "color" 0743 msgid "LightSteelBlue4" 0744 msgstr "આછોસ્ટીલવાદળી ૪" 0745 0746 #, kde-format 0747 msgctxt "color" 0748 msgid "LightYellow" 0749 msgstr "આછોપીળો" 0750 0751 #, kde-format 0752 msgctxt "color" 0753 msgid "LightYellow1" 0754 msgstr "આછોપીળો ૧" 0755 0756 #, kde-format 0757 msgctxt "color" 0758 msgid "LightYellow2" 0759 msgstr "આછોપીળો ૨" 0760 0761 #, kde-format 0762 msgctxt "color" 0763 msgid "LightYellow3" 0764 msgstr "આછોપીળો ૩" 0765 0766 #, kde-format 0767 msgctxt "color" 0768 msgid "LightYellow4" 0769 msgstr "આછોપીળો ૪" 0770 0771 #, kde-format 0772 msgctxt "color" 0773 msgid "LimeGreen" 0774 msgstr "લાઇમલીલો" 0775 0776 #, kde-format 0777 msgctxt "color" 0778 msgid "MediumAquamarine" 0779 msgstr "મધ્યમઅક્વામરિન" 0780 0781 #, kde-format 0782 msgctxt "color" 0783 msgid "MediumBlue" 0784 msgstr "મધ્યમવાદળી" 0785 0786 #, kde-format 0787 msgctxt "color" 0788 msgid "MediumOrchid" 0789 msgstr "મધ્યમઓર્કિડ" 0790 0791 #, kde-format 0792 msgctxt "color" 0793 msgid "MediumOrchid1" 0794 msgstr "મધ્યમઓર્કિડ ૧" 0795 0796 #, kde-format 0797 msgctxt "color" 0798 msgid "MediumOrchid2" 0799 msgstr "મધ્યમઓર્કિડ ૨" 0800 0801 #, kde-format 0802 msgctxt "color" 0803 msgid "MediumOrchid3" 0804 msgstr "મધ્યમઓર્કિડ ૩" 0805 0806 #, kde-format 0807 msgctxt "color" 0808 msgid "MediumOrchid4" 0809 msgstr "મધ્યમઓર્કિડ ૪" 0810 0811 #, kde-format 0812 msgctxt "color" 0813 msgid "MediumPurple" 0814 msgstr "મધ્યમઆછોજાંબલી" 0815 0816 #, kde-format 0817 msgctxt "color" 0818 msgid "MediumPurple1" 0819 msgstr "મધ્યમઆછોજાંબલી ૧" 0820 0821 #, kde-format 0822 msgctxt "color" 0823 msgid "MediumPurple2" 0824 msgstr "મધ્યમઆછોજાંબલી ૨" 0825 0826 #, kde-format 0827 msgctxt "color" 0828 msgid "MediumPurple3" 0829 msgstr "મધ્યમઆછોજાંબલી ૩" 0830 0831 #, kde-format 0832 msgctxt "color" 0833 msgid "MediumPurple4" 0834 msgstr "મધ્યમઆછોજાંબલી ૪" 0835 0836 #, kde-format 0837 msgctxt "color" 0838 msgid "MediumSeaGreen" 0839 msgstr "મધ્યમસમુદ્રીલીલો" 0840 0841 #, kde-format 0842 msgctxt "color" 0843 msgid "MediumSlateBlue" 0844 msgstr "મધ્યમસ્લેટવાદળી" 0845 0846 #, kde-format 0847 msgctxt "color" 0848 msgid "MediumSpringGreen" 0849 msgstr "મધ્યમસ્પ્રિંગલીલો" 0850 0851 #, kde-format 0852 msgctxt "color" 0853 msgid "MediumTurquoise" 0854 msgstr "મધ્યમભૂરોલીલો" 0855 0856 #, kde-format 0857 msgctxt "color" 0858 msgid "MediumVioletRed" 0859 msgstr "મધ્યમજાંબલીલાલ" 0860 0861 #, kde-format 0862 msgctxt "color" 0863 msgid "MidnightBlue" 0864 msgstr "રાત્રિવાદળી" 0865 0866 #, kde-format 0867 msgctxt "color" 0868 msgid "MintCream" 0869 msgstr "મિન્ટક્રિમ" 0870 0871 #, kde-format 0872 msgctxt "color" 0873 msgid "MistyRose" 0874 msgstr "મિસ્ટીરોઝ" 0875 0876 #, kde-format 0877 msgctxt "color" 0878 msgid "MistyRose1" 0879 msgstr "મિસ્ટીરોઝ ૧" 0880 0881 #, kde-format 0882 msgctxt "color" 0883 msgid "MistyRose2" 0884 msgstr "મિસ્ટીરોઝ ૨" 0885 0886 #, kde-format 0887 msgctxt "color" 0888 msgid "MistyRose3" 0889 msgstr "મિસ્ટીરોઝ ૩" 0890 0891 #, kde-format 0892 msgctxt "color" 0893 msgid "MistyRose4" 0894 msgstr "મિસ્ટીરોઝ ૪" 0895 0896 #, kde-format 0897 msgctxt "color" 0898 msgid "NavajoWhite" 0899 msgstr "નવાજોસફેદ" 0900 0901 #, kde-format 0902 msgctxt "color" 0903 msgid "NavajoWhite1" 0904 msgstr "નવાજોસફેદ ૧" 0905 0906 #, kde-format 0907 msgctxt "color" 0908 msgid "NavajoWhite2" 0909 msgstr "નવાજોસફેદ ૨" 0910 0911 #, kde-format 0912 msgctxt "color" 0913 msgid "NavajoWhite3" 0914 msgstr "નવાજોસફેદ ૩" 0915 0916 #, kde-format 0917 msgctxt "color" 0918 msgid "NavajoWhite4" 0919 msgstr "નવાજોસફેદ ૪" 0920 0921 #, kde-format 0922 msgctxt "color" 0923 msgid "NavyBlue" 0924 msgstr "નેવીવાદળી" 0925 0926 #, kde-format 0927 msgctxt "color" 0928 msgid "OldLace" 0929 msgstr "ઓલ્ડલેસ" 0930 0931 #, kde-format 0932 msgctxt "color" 0933 msgid "OliveDrab" 0934 msgstr "ઓલિવડ્રેબ" 0935 0936 #, kde-format 0937 msgctxt "color" 0938 msgid "OliveDrab1" 0939 msgstr "ઓલિવડ્રેબ ૧" 0940 0941 #, kde-format 0942 msgctxt "color" 0943 msgid "OliveDrab2" 0944 msgstr "ઓલિવડ્રેબ ૨" 0945 0946 #, kde-format 0947 msgctxt "color" 0948 msgid "OliveDrab3" 0949 msgstr "ઓલિવડ્રેબ ૩" 0950 0951 #, kde-format 0952 msgctxt "color" 0953 msgid "OliveDrab4" 0954 msgstr "ઓલિવડ્રેબ ૪" 0955 0956 #, kde-format 0957 msgctxt "color" 0958 msgid "OrangeRed" 0959 msgstr "નારંગીલાલ" 0960 0961 #, kde-format 0962 msgctxt "color" 0963 msgid "OrangeRed1" 0964 msgstr "નારંગીલાલ ૧" 0965 0966 #, kde-format 0967 msgctxt "color" 0968 msgid "OrangeRed2" 0969 msgstr "નારંગીલાલ ૨" 0970 0971 #, kde-format 0972 msgctxt "color" 0973 msgid "OrangeRed3" 0974 msgstr "નારંગીલાલ ૩" 0975 0976 #, kde-format 0977 msgctxt "color" 0978 msgid "OrangeRed4" 0979 msgstr "નારંગીલાલ ૪" 0980 0981 #, kde-format 0982 msgctxt "color" 0983 msgid "PaleGoldenrod" 0984 msgstr "આછોસોનેરી" 0985 0986 #, kde-format 0987 msgctxt "color" 0988 msgid "PaleGreen" 0989 msgstr "આછોલીલો" 0990 0991 #, kde-format 0992 msgctxt "color" 0993 msgid "PaleGreen1" 0994 msgstr "આછોલીલો ૧" 0995 0996 #, kde-format 0997 msgctxt "color" 0998 msgid "PaleGreen2" 0999 msgstr "આછોલીલો ૨" 1000 1001 #, kde-format 1002 msgctxt "color" 1003 msgid "PaleGreen3" 1004 msgstr "આછોલીલો ૩" 1005 1006 #, kde-format 1007 msgctxt "color" 1008 msgid "PaleGreen4" 1009 msgstr "આછોલીલો ૪" 1010 1011 #, kde-format 1012 msgctxt "color" 1013 msgid "PaleTurquoise" 1014 msgstr "આછોભૂરોલીલો" 1015 1016 #, kde-format 1017 msgctxt "color" 1018 msgid "PaleTurquoise1" 1019 msgstr "આછોભૂરોલીલો ૧" 1020 1021 #, kde-format 1022 msgctxt "color" 1023 msgid "PaleTurquoise2" 1024 msgstr "આછોભૂરોલીલો ૨" 1025 1026 #, kde-format 1027 msgctxt "color" 1028 msgid "PaleTurquoise3" 1029 msgstr "આછોભૂરોલીલો ૩" 1030 1031 #, kde-format 1032 msgctxt "color" 1033 msgid "PaleTurquoise4" 1034 msgstr "આછોભૂરોલીલો ૪" 1035 1036 #, kde-format 1037 msgctxt "color" 1038 msgid "PaleVioletRed" 1039 msgstr "આછોજાંબલીલાલ" 1040 1041 #, kde-format 1042 msgctxt "color" 1043 msgid "PaleVioletRed1" 1044 msgstr "આછોજાંબલીલાલ ૧" 1045 1046 #, kde-format 1047 msgctxt "color" 1048 msgid "PaleVioletRed2" 1049 msgstr "આછોજાંબલીલાલ ૨" 1050 1051 #, kde-format 1052 msgctxt "color" 1053 msgid "PaleVioletRed3" 1054 msgstr "આછોજાંબલીલાલ ૩" 1055 1056 #, kde-format 1057 msgctxt "color" 1058 msgid "PaleVioletRed4" 1059 msgstr "આછોજાંબલીલાલ ૪" 1060 1061 #, kde-format 1062 msgctxt "color" 1063 msgid "PapayaWhip" 1064 msgstr "પપાયાવ્હીપ" 1065 1066 #, kde-format 1067 msgctxt "color" 1068 msgid "PeachPuff" 1069 msgstr "પીચપફ" 1070 1071 #, kde-format 1072 msgctxt "color" 1073 msgid "PeachPuff1" 1074 msgstr "પીચપફ ૧" 1075 1076 #, kde-format 1077 msgctxt "color" 1078 msgid "PeachPuff2" 1079 msgstr "પીચપફ ૨" 1080 1081 #, kde-format 1082 msgctxt "color" 1083 msgid "PeachPuff3" 1084 msgstr "પીચપફ ૩" 1085 1086 #, kde-format 1087 msgctxt "color" 1088 msgid "PeachPuff4" 1089 msgstr "પીચપફ ૪" 1090 1091 #, kde-format 1092 msgctxt "color" 1093 msgid "PowderBlue" 1094 msgstr "પાવડરવાદળી" 1095 1096 #, kde-format 1097 msgctxt "color" 1098 msgid "RosyBrown" 1099 msgstr "રોઝીભૂખરો" 1100 1101 #, kde-format 1102 msgctxt "color" 1103 msgid "RosyBrown1" 1104 msgstr "રોઝીભૂખરો ૧" 1105 1106 #, kde-format 1107 msgctxt "color" 1108 msgid "RosyBrown2" 1109 msgstr "રોઝીભૂખરો ૨" 1110 1111 #, kde-format 1112 msgctxt "color" 1113 msgid "RosyBrown3" 1114 msgstr "રોઝીભૂખરો ૩" 1115 1116 #, kde-format 1117 msgctxt "color" 1118 msgid "RosyBrown4" 1119 msgstr "રોઝીભૂખરો ૪" 1120 1121 #, kde-format 1122 msgctxt "color" 1123 msgid "RoyalBlue" 1124 msgstr "રોયલવાદળી" 1125 1126 #, kde-format 1127 msgctxt "color" 1128 msgid "RoyalBlue1" 1129 msgstr "રોયલવાદળી ૧" 1130 1131 #, kde-format 1132 msgctxt "color" 1133 msgid "RoyalBlue2" 1134 msgstr "રોયલવાદળી ૨" 1135 1136 #, kde-format 1137 msgctxt "color" 1138 msgid "RoyalBlue3" 1139 msgstr "રોયલવાદળી ૩" 1140 1141 #, kde-format 1142 msgctxt "color" 1143 msgid "RoyalBlue4" 1144 msgstr "રોયલવાદળી ૪" 1145 1146 #, kde-format 1147 msgctxt "color" 1148 msgid "SaddleBrown" 1149 msgstr "સેડલભૂખરો" 1150 1151 #, kde-format 1152 msgctxt "color" 1153 msgid "SandyBrown" 1154 msgstr "સેન્ડીભૂખરો" 1155 1156 #, kde-format 1157 msgctxt "color" 1158 msgid "SeaGreen" 1159 msgstr "સમુદ્રીલીલો" 1160 1161 #, kde-format 1162 msgctxt "color" 1163 msgid "SeaGreen1" 1164 msgstr "સમુદ્રીલીલો ૧" 1165 1166 #, kde-format 1167 msgctxt "color" 1168 msgid "SeaGreen2" 1169 msgstr "સમુદ્રીલીલો ૨" 1170 1171 #, kde-format 1172 msgctxt "color" 1173 msgid "SeaGreen3" 1174 msgstr "સમુદ્રીલીલો ૩" 1175 1176 #, kde-format 1177 msgctxt "color" 1178 msgid "SeaGreen4" 1179 msgstr "સમુદ્રીલીલો ૪" 1180 1181 #, kde-format 1182 msgctxt "color" 1183 msgid "SkyBlue" 1184 msgstr "આકાશીવાદળી" 1185 1186 #, kde-format 1187 msgctxt "color" 1188 msgid "SkyBlue1" 1189 msgstr "આકાશીવાદળી ૧" 1190 1191 #, kde-format 1192 msgctxt "color" 1193 msgid "SkyBlue2" 1194 msgstr "આકાશીવાદળી ૨" 1195 1196 #, kde-format 1197 msgctxt "color" 1198 msgid "SkyBlue3" 1199 msgstr "આકાશીવાદળી ૩" 1200 1201 #, kde-format 1202 msgctxt "color" 1203 msgid "SkyBlue4" 1204 msgstr "આકાશીવાદળી ૪" 1205 1206 #, kde-format 1207 msgctxt "color" 1208 msgid "SlateBlue" 1209 msgstr "સ્લેટવાદળી" 1210 1211 #, kde-format 1212 msgctxt "color" 1213 msgid "SlateBlue1" 1214 msgstr "સ્લેટવાદળી ૧" 1215 1216 #, kde-format 1217 msgctxt "color" 1218 msgid "SlateBlue2" 1219 msgstr "સ્લેટવાદળી ૨" 1220 1221 #, kde-format 1222 msgctxt "color" 1223 msgid "SlateBlue3" 1224 msgstr "સ્લેટવાદળી ૩" 1225 1226 #, kde-format 1227 msgctxt "color" 1228 msgid "SlateBlue4" 1229 msgstr "સ્લેટવાદળી ૪" 1230 1231 #, kde-format 1232 msgctxt "color" 1233 msgid "SlateGray" 1234 msgstr "સ્લેટભૂખરો" 1235 1236 #, kde-format 1237 msgctxt "color" 1238 msgid "SlateGray1" 1239 msgstr "સ્લેટભૂખરો ૧" 1240 1241 #, kde-format 1242 msgctxt "color" 1243 msgid "SlateGray2" 1244 msgstr "સ્લેટભૂખરો ૨" 1245 1246 #, kde-format 1247 msgctxt "color" 1248 msgid "SlateGray3" 1249 msgstr "સ્લેટભૂખરો ૩" 1250 1251 #, kde-format 1252 msgctxt "color" 1253 msgid "SlateGray4" 1254 msgstr "સ્લેટભૂખરો ૪" 1255 1256 #, kde-format 1257 msgctxt "color" 1258 msgid "SlateGrey" 1259 msgstr "સ્લેટભૂખરો" 1260 1261 #, kde-format 1262 msgctxt "color" 1263 msgid "SpringGreen" 1264 msgstr "સ્પ્રિંગલીલો" 1265 1266 #, kde-format 1267 msgctxt "color" 1268 msgid "SpringGreen1" 1269 msgstr "સ્પ્રિંગલીલો ૧" 1270 1271 #, kde-format 1272 msgctxt "color" 1273 msgid "SpringGreen2" 1274 msgstr "સ્પ્રિંગલીલો ૨" 1275 1276 #, kde-format 1277 msgctxt "color" 1278 msgid "SpringGreen3" 1279 msgstr "સ્પ્રિંગલીલો ૩" 1280 1281 #, kde-format 1282 msgctxt "color" 1283 msgid "SpringGreen4" 1284 msgstr "સ્પ્રિંગલીલો ૪" 1285 1286 #, kde-format 1287 msgctxt "color" 1288 msgid "SteelBlue" 1289 msgstr "સ્ટીલવાદળી" 1290 1291 #, kde-format 1292 msgctxt "color" 1293 msgid "SteelBlue1" 1294 msgstr "સ્ટીલવાદળી ૧" 1295 1296 #, kde-format 1297 msgctxt "color" 1298 msgid "SteelBlue2" 1299 msgstr "સ્ટીલવાદળી ૨" 1300 1301 #, kde-format 1302 msgctxt "color" 1303 msgid "SteelBlue3" 1304 msgstr "સ્ટીલવાદળી ૩" 1305 1306 #, kde-format 1307 msgctxt "color" 1308 msgid "SteelBlue4" 1309 msgstr "સ્ટીલવાદળી ૪" 1310 1311 #, kde-format 1312 msgctxt "color" 1313 msgid "VioletRed" 1314 msgstr "જાંબલીલાલ" 1315 1316 #, kde-format 1317 msgctxt "color" 1318 msgid "VioletRed1" 1319 msgstr "જાંબલીલાલ ૧" 1320 1321 #, kde-format 1322 msgctxt "color" 1323 msgid "VioletRed2" 1324 msgstr "જાંબલીલાલ ૨" 1325 1326 #, kde-format 1327 msgctxt "color" 1328 msgid "VioletRed3" 1329 msgstr "જાંબલીલાલ ૩" 1330 1331 #, kde-format 1332 msgctxt "color" 1333 msgid "VioletRed4" 1334 msgstr "જાંબલીલાલ ૪" 1335 1336 #, kde-format 1337 msgctxt "color" 1338 msgid "WhiteSmoke" 1339 msgstr "સફેદઘુમાડો" 1340 1341 #, kde-format 1342 msgctxt "color" 1343 msgid "YellowGreen" 1344 msgstr "પીળોલીલો" 1345 1346 #, kde-format 1347 msgctxt "color" 1348 msgid "aquamarine" 1349 msgstr "અક્વામરિન" 1350 1351 #, kde-format 1352 msgctxt "color" 1353 msgid "aquamarine1" 1354 msgstr "અક્વામરિન ૧" 1355 1356 #, kde-format 1357 msgctxt "color" 1358 msgid "aquamarine2" 1359 msgstr "અક્વામરિન ૨" 1360 1361 #, kde-format 1362 msgctxt "color" 1363 msgid "aquamarine3" 1364 msgstr "અક્વામરિન ૩" 1365 1366 #, kde-format 1367 msgctxt "color" 1368 msgid "aquamarine4" 1369 msgstr "અક્વામરિન ૪" 1370 1371 #, kde-format 1372 msgctxt "color" 1373 msgid "azure" 1374 msgstr "અઝ્યુર" 1375 1376 #, kde-format 1377 msgctxt "color" 1378 msgid "azure1" 1379 msgstr "અઝ્યુર ૧" 1380 1381 #, kde-format 1382 msgctxt "color" 1383 msgid "azure2" 1384 msgstr "અઝ્યુર ૨" 1385 1386 #, kde-format 1387 msgctxt "color" 1388 msgid "azure3" 1389 msgstr "અઝ્યુર ૩" 1390 1391 #, kde-format 1392 msgctxt "color" 1393 msgid "azure4" 1394 msgstr "અઝ્યુર ૪" 1395 1396 #, kde-format 1397 msgctxt "color" 1398 msgid "beige" 1399 msgstr "બિગે" 1400 1401 #, kde-format 1402 msgctxt "color" 1403 msgid "bisque" 1404 msgstr "બિસ્ક" 1405 1406 #, kde-format 1407 msgctxt "color" 1408 msgid "bisque1" 1409 msgstr "બિસ્ક ૧" 1410 1411 #, kde-format 1412 msgctxt "color" 1413 msgid "bisque2" 1414 msgstr "બિસ્ક ૨" 1415 1416 #, kde-format 1417 msgctxt "color" 1418 msgid "bisque3" 1419 msgstr "બિસ્ક ૩" 1420 1421 #, kde-format 1422 msgctxt "color" 1423 msgid "bisque4" 1424 msgstr "બિસ્ક ૪" 1425 1426 #, kde-format 1427 msgctxt "color" 1428 msgid "black" 1429 msgstr "કાળો" 1430 1431 #, kde-format 1432 msgctxt "color" 1433 msgid "blue" 1434 msgstr "વાદળી" 1435 1436 #, kde-format 1437 msgctxt "color" 1438 msgid "blue1" 1439 msgstr "વાદળી ૧" 1440 1441 #, kde-format 1442 msgctxt "color" 1443 msgid "blue2" 1444 msgstr "વાદળી ૨" 1445 1446 #, kde-format 1447 msgctxt "color" 1448 msgid "blue3" 1449 msgstr "વાદળી ૩" 1450 1451 #, kde-format 1452 msgctxt "color" 1453 msgid "blue4" 1454 msgstr "વાદળી ૪" 1455 1456 #, kde-format 1457 msgctxt "color" 1458 msgid "brown" 1459 msgstr "ભૂખરો" 1460 1461 #, kde-format 1462 msgctxt "color" 1463 msgid "brown1" 1464 msgstr "ભૂખરો ૧" 1465 1466 #, kde-format 1467 msgctxt "color" 1468 msgid "brown2" 1469 msgstr "ભૂખરો ૨" 1470 1471 #, kde-format 1472 msgctxt "color" 1473 msgid "brown3" 1474 msgstr "ભૂખરો ૩" 1475 1476 #, kde-format 1477 msgctxt "color" 1478 msgid "brown4" 1479 msgstr "ભૂખરો ૪" 1480 1481 #, kde-format 1482 msgctxt "color" 1483 msgid "burlywood" 1484 msgstr "બર્લિવુડ" 1485 1486 #, kde-format 1487 msgctxt "color" 1488 msgid "burlywood1" 1489 msgstr "બર્લિવુડ ૧" 1490 1491 #, kde-format 1492 msgctxt "color" 1493 msgid "burlywood2" 1494 msgstr "બર્લિવુડ ૨" 1495 1496 #, kde-format 1497 msgctxt "color" 1498 msgid "burlywood3" 1499 msgstr "બર્લિવુડ ૩" 1500 1501 #, kde-format 1502 msgctxt "color" 1503 msgid "burlywood4" 1504 msgstr "બર્લિવુડ ૪" 1505 1506 #, kde-format 1507 msgctxt "color" 1508 msgid "chartreuse" 1509 msgstr "ચાર્ટરુઝ" 1510 1511 #, kde-format 1512 msgctxt "color" 1513 msgid "chartreuse1" 1514 msgstr "ચાર્ટરુઝ ૧" 1515 1516 #, kde-format 1517 msgctxt "color" 1518 msgid "chartreuse2" 1519 msgstr "ચાર્ટરુઝ ૨" 1520 1521 #, kde-format 1522 msgctxt "color" 1523 msgid "chartreuse3" 1524 msgstr "ચાર્ટરુઝ ૩" 1525 1526 #, kde-format 1527 msgctxt "color" 1528 msgid "chartreuse4" 1529 msgstr "ચાર્ટરુઝ ૪" 1530 1531 #, kde-format 1532 msgctxt "color" 1533 msgid "chocolate" 1534 msgstr "ચોકલેટ" 1535 1536 #, kde-format 1537 msgctxt "color" 1538 msgid "chocolate1" 1539 msgstr "ચોકલેટ ૧" 1540 1541 #, kde-format 1542 msgctxt "color" 1543 msgid "chocolate2" 1544 msgstr "ચોકલેટ ૨" 1545 1546 #, kde-format 1547 msgctxt "color" 1548 msgid "chocolate3" 1549 msgstr "ચોકલેટ ૩" 1550 1551 #, kde-format 1552 msgctxt "color" 1553 msgid "chocolate4" 1554 msgstr "ચોકલેટ ૪" 1555 1556 #, kde-format 1557 msgctxt "color" 1558 msgid "coral" 1559 msgstr "કોરલ" 1560 1561 #, kde-format 1562 msgctxt "color" 1563 msgid "coral1" 1564 msgstr "કોરલ ૧" 1565 1566 #, kde-format 1567 msgctxt "color" 1568 msgid "coral2" 1569 msgstr "કોરલ ૨" 1570 1571 #, kde-format 1572 msgctxt "color" 1573 msgid "coral3" 1574 msgstr "કોરલ ૩" 1575 1576 #, kde-format 1577 msgctxt "color" 1578 msgid "coral4" 1579 msgstr "કોરલ ૪" 1580 1581 #, kde-format 1582 msgctxt "color" 1583 msgid "cornsilk" 1584 msgstr "કોર્નસિલ્ક" 1585 1586 #, kde-format 1587 msgctxt "color" 1588 msgid "cornsilk1" 1589 msgstr "કોર્નસિલ્ક ૧" 1590 1591 #, kde-format 1592 msgctxt "color" 1593 msgid "cornsilk2" 1594 msgstr "કોર્નસિલ્ક ૨" 1595 1596 #, kde-format 1597 msgctxt "color" 1598 msgid "cornsilk3" 1599 msgstr "કોર્નસિલ્ક ૩" 1600 1601 #, kde-format 1602 msgctxt "color" 1603 msgid "cornsilk4" 1604 msgstr "કોર્નસિલ્ક ૪" 1605 1606 #, kde-format 1607 msgctxt "color" 1608 msgid "cyan" 1609 msgstr "વાદળી" 1610 1611 #, kde-format 1612 msgctxt "color" 1613 msgid "cyan1" 1614 msgstr "વાદળી ૧" 1615 1616 #, kde-format 1617 msgctxt "color" 1618 msgid "cyan2" 1619 msgstr "વાદળી ૨" 1620 1621 #, kde-format 1622 msgctxt "color" 1623 msgid "cyan3" 1624 msgstr "વાદળી ૩" 1625 1626 #, kde-format 1627 msgctxt "color" 1628 msgid "cyan4" 1629 msgstr "વાદળી ૪" 1630 1631 #, kde-format 1632 msgctxt "color" 1633 msgid "firebrick" 1634 msgstr "ફાયરબ્રિક" 1635 1636 #, kde-format 1637 msgctxt "color" 1638 msgid "firebrick1" 1639 msgstr "ફાયરબ્રિક ૧" 1640 1641 #, kde-format 1642 msgctxt "color" 1643 msgid "firebrick2" 1644 msgstr "ફાયરબ્રિક ૨" 1645 1646 #, kde-format 1647 msgctxt "color" 1648 msgid "firebrick3" 1649 msgstr "ફાયરબ્રિક ૩" 1650 1651 #, kde-format 1652 msgctxt "color" 1653 msgid "firebrick4" 1654 msgstr "ફાયરબ્રિક ૪" 1655 1656 #, kde-format 1657 msgctxt "color" 1658 msgid "gainsboro" 1659 msgstr "ગેઇન્સબોરો" 1660 1661 #, kde-format 1662 msgctxt "color" 1663 msgid "gold" 1664 msgstr "સોનેરી" 1665 1666 #, kde-format 1667 msgctxt "color" 1668 msgid "gold1" 1669 msgstr "સોનેરી ૧" 1670 1671 #, kde-format 1672 msgctxt "color" 1673 msgid "gold2" 1674 msgstr "સોનેરી ૨" 1675 1676 #, kde-format 1677 msgctxt "color" 1678 msgid "gold3" 1679 msgstr "સોનેરી ૩" 1680 1681 #, kde-format 1682 msgctxt "color" 1683 msgid "gold4" 1684 msgstr "સોનેરી ૪" 1685 1686 #, kde-format 1687 msgctxt "color" 1688 msgid "goldenrod" 1689 msgstr "સોનેરીરોડ" 1690 1691 #, kde-format 1692 msgctxt "color" 1693 msgid "goldenrod1" 1694 msgstr "સોનેરીરોડ ૧" 1695 1696 #, kde-format 1697 msgctxt "color" 1698 msgid "goldenrod2" 1699 msgstr "સોનેરીરોડ ૨" 1700 1701 #, kde-format 1702 msgctxt "color" 1703 msgid "goldenrod3" 1704 msgstr "સોનેરીરોડ ૩" 1705 1706 #, kde-format 1707 msgctxt "color" 1708 msgid "goldenrod4" 1709 msgstr "સોનેરીરોડ ૪" 1710 1711 #, kde-format 1712 msgctxt "color" 1713 msgid "green" 1714 msgstr "લીલો" 1715 1716 #, kde-format 1717 msgctxt "color" 1718 msgid "green1" 1719 msgstr "લીલો ૧" 1720 1721 #, kde-format 1722 msgctxt "color" 1723 msgid "green2" 1724 msgstr "લીલો ૨" 1725 1726 #, kde-format 1727 msgctxt "color" 1728 msgid "green3" 1729 msgstr "લીલો ૩" 1730 1731 #, kde-format 1732 msgctxt "color" 1733 msgid "green4" 1734 msgstr "લીલો ૪" 1735 1736 #, kde-format 1737 msgctxt "color" 1738 msgid "honeydew" 1739 msgstr "મધટીપું" 1740 1741 #, kde-format 1742 msgctxt "color" 1743 msgid "honeydew1" 1744 msgstr "મધટીપું ૧" 1745 1746 #, kde-format 1747 msgctxt "color" 1748 msgid "honeydew2" 1749 msgstr "મધટીપું ૨" 1750 1751 #, kde-format 1752 msgctxt "color" 1753 msgid "honeydew3" 1754 msgstr "મધટીપું ૩" 1755 1756 #, kde-format 1757 msgctxt "color" 1758 msgid "honeydew4" 1759 msgstr "મધટીપું ૪" 1760 1761 #, kde-format 1762 msgctxt "color" 1763 msgid "ivory" 1764 msgstr "આઇવરી" 1765 1766 #, kde-format 1767 msgctxt "color" 1768 msgid "ivory1" 1769 msgstr "આઇવરી ૧" 1770 1771 #, kde-format 1772 msgctxt "color" 1773 msgid "ivory2" 1774 msgstr "આઇવરી ૨" 1775 1776 #, kde-format 1777 msgctxt "color" 1778 msgid "ivory3" 1779 msgstr "આઇવરી ૩" 1780 1781 #, kde-format 1782 msgctxt "color" 1783 msgid "ivory4" 1784 msgstr "આઇવરી ૪" 1785 1786 #, kde-format 1787 msgctxt "color" 1788 msgid "khaki" 1789 msgstr "ખાખી" 1790 1791 #, kde-format 1792 msgctxt "color" 1793 msgid "khaki1" 1794 msgstr "ખાખી ૧" 1795 1796 #, kde-format 1797 msgctxt "color" 1798 msgid "khaki2" 1799 msgstr "ખાખી ૨" 1800 1801 #, kde-format 1802 msgctxt "color" 1803 msgid "khaki3" 1804 msgstr "ખાખી ૩" 1805 1806 #, kde-format 1807 msgctxt "color" 1808 msgid "khaki4" 1809 msgstr "ખાખી ૪" 1810 1811 #, kde-format 1812 msgctxt "color" 1813 msgid "lavender" 1814 msgstr "લવન્ડર" 1815 1816 #, kde-format 1817 msgctxt "color" 1818 msgid "linen" 1819 msgstr "લિનન" 1820 1821 #, kde-format 1822 msgctxt "color" 1823 msgid "magenta" 1824 msgstr "મેજેન્ટા" 1825 1826 #, kde-format 1827 msgctxt "color" 1828 msgid "magenta1" 1829 msgstr "મેજેન્ટા ૧" 1830 1831 #, kde-format 1832 msgctxt "color" 1833 msgid "magenta2" 1834 msgstr "મેજેન્ટા ૨" 1835 1836 #, kde-format 1837 msgctxt "color" 1838 msgid "magenta3" 1839 msgstr "મેજેન્ટા ૩" 1840 1841 #, kde-format 1842 msgctxt "color" 1843 msgid "magenta4" 1844 msgstr "મેજેન્ટા ૪" 1845 1846 #, kde-format 1847 msgctxt "color" 1848 msgid "maroon" 1849 msgstr "મરૂન" 1850 1851 #, kde-format 1852 msgctxt "color" 1853 msgid "maroon1" 1854 msgstr "મરૂન ૧" 1855 1856 #, kde-format 1857 msgctxt "color" 1858 msgid "maroon2" 1859 msgstr "મરૂન ૨" 1860 1861 #, kde-format 1862 msgctxt "color" 1863 msgid "maroon3" 1864 msgstr "મરૂન ૩" 1865 1866 #, kde-format 1867 msgctxt "color" 1868 msgid "maroon4" 1869 msgstr "મરૂન ૪" 1870 1871 #, kde-format 1872 msgctxt "color" 1873 msgid "moccasin" 1874 msgstr "મોક્કેસિન" 1875 1876 #, kde-format 1877 msgctxt "color" 1878 msgid "navy" 1879 msgstr "નેવી" 1880 1881 #, kde-format 1882 msgctxt "color" 1883 msgid "orange" 1884 msgstr "નારંગી" 1885 1886 #, kde-format 1887 msgctxt "color" 1888 msgid "orange1" 1889 msgstr "નારંગી ૧" 1890 1891 #, kde-format 1892 msgctxt "color" 1893 msgid "orange2" 1894 msgstr "નારંગી ૨" 1895 1896 #, kde-format 1897 msgctxt "color" 1898 msgid "orange3" 1899 msgstr "નારંગી ૩" 1900 1901 #, kde-format 1902 msgctxt "color" 1903 msgid "orange4" 1904 msgstr "નારંગી ૪" 1905 1906 #, kde-format 1907 msgctxt "color" 1908 msgid "orchid" 1909 msgstr "ઓર્કિડ" 1910 1911 #, kde-format 1912 msgctxt "color" 1913 msgid "orchid1" 1914 msgstr "ઓર્કિડ ૧" 1915 1916 #, kde-format 1917 msgctxt "color" 1918 msgid "orchid2" 1919 msgstr "ઓર્કિડ ૨" 1920 1921 #, kde-format 1922 msgctxt "color" 1923 msgid "orchid3" 1924 msgstr "ઓર્કિડ ૩" 1925 1926 #, kde-format 1927 msgctxt "color" 1928 msgid "orchid4" 1929 msgstr "ઓર્કિડ ૪" 1930 1931 #, kde-format 1932 msgctxt "color" 1933 msgid "peru" 1934 msgstr "પેરૂ" 1935 1936 #, kde-format 1937 msgctxt "color" 1938 msgid "pink" 1939 msgstr "ગુલાબી" 1940 1941 #, kde-format 1942 msgctxt "color" 1943 msgid "pink1" 1944 msgstr "ગુલાબી ૧" 1945 1946 #, kde-format 1947 msgctxt "color" 1948 msgid "pink2" 1949 msgstr "ગુલાબી ૨" 1950 1951 #, kde-format 1952 msgctxt "color" 1953 msgid "pink3" 1954 msgstr "ગુલાબી ૩" 1955 1956 #, kde-format 1957 msgctxt "color" 1958 msgid "pink4" 1959 msgstr "ગુલાબી ૪" 1960 1961 #, kde-format 1962 msgctxt "color" 1963 msgid "plum" 1964 msgstr "પ્લમ" 1965 1966 #, kde-format 1967 msgctxt "color" 1968 msgid "plum1" 1969 msgstr "પ્લમ ૧" 1970 1971 #, kde-format 1972 msgctxt "color" 1973 msgid "plum2" 1974 msgstr "પ્લમ ૨" 1975 1976 #, kde-format 1977 msgctxt "color" 1978 msgid "plum3" 1979 msgstr "પ્લમ ૩" 1980 1981 #, kde-format 1982 msgctxt "color" 1983 msgid "plum4" 1984 msgstr "પ્લમ ૪" 1985 1986 #, kde-format 1987 msgctxt "color" 1988 msgid "purple" 1989 msgstr "આછો જાંબલી" 1990 1991 #, kde-format 1992 msgctxt "color" 1993 msgid "purple1" 1994 msgstr "આછો જાંબલી ૧" 1995 1996 #, kde-format 1997 msgctxt "color" 1998 msgid "purple2" 1999 msgstr "આછો જાંબલી ૨" 2000 2001 #, kde-format 2002 msgctxt "color" 2003 msgid "purple3" 2004 msgstr "આછો જાંબલી ૩" 2005 2006 #, kde-format 2007 msgctxt "color" 2008 msgid "purple4" 2009 msgstr "આછો જાંબલી ૪" 2010 2011 #, fuzzy, kde-format 2012 #| msgctxt "Ethiopian month 3 - ShortName" 2013 #| msgid "Hed" 2014 msgctxt "color" 2015 msgid "red" 2016 msgstr "હેડ" 2017 2018 #, kde-format 2019 msgctxt "color" 2020 msgid "red1" 2021 msgstr "લાલ ૧" 2022 2023 #, kde-format 2024 msgctxt "color" 2025 msgid "red2" 2026 msgstr "લાલ ૨" 2027 2028 #, kde-format 2029 msgctxt "color" 2030 msgid "red3" 2031 msgstr "લાલ ૩" 2032 2033 #, kde-format 2034 msgctxt "color" 2035 msgid "red4" 2036 msgstr "લાલ ૪" 2037 2038 #, kde-format 2039 msgctxt "color" 2040 msgid "salmon" 2041 msgstr "સાલ્મોન" 2042 2043 #, kde-format 2044 msgctxt "color" 2045 msgid "salmon1" 2046 msgstr "સાલ્મોન ૧" 2047 2048 #, kde-format 2049 msgctxt "color" 2050 msgid "salmon2" 2051 msgstr "સાલ્મોન ૨" 2052 2053 #, kde-format 2054 msgctxt "color" 2055 msgid "salmon3" 2056 msgstr "સાલ્મોન ૩" 2057 2058 #, kde-format 2059 msgctxt "color" 2060 msgid "salmon4" 2061 msgstr "સાલ્મોન ૪" 2062 2063 #, kde-format 2064 msgctxt "color" 2065 msgid "seashell" 2066 msgstr "સમુદ્રશંખ" 2067 2068 #, kde-format 2069 msgctxt "color" 2070 msgid "seashell1" 2071 msgstr "સમુદ્રશંખ ૧" 2072 2073 #, kde-format 2074 msgctxt "color" 2075 msgid "seashell2" 2076 msgstr "સમુદ્રશંખ ૨" 2077 2078 #, kde-format 2079 msgctxt "color" 2080 msgid "seashell3" 2081 msgstr "સમુદ્રશંખ ૩" 2082 2083 #, kde-format 2084 msgctxt "color" 2085 msgid "seashell4" 2086 msgstr "સમુદ્રશંખ ૪" 2087 2088 #, kde-format 2089 msgctxt "color" 2090 msgid "sienna" 2091 msgstr "સિન્ના" 2092 2093 #, kde-format 2094 msgctxt "color" 2095 msgid "sienna1" 2096 msgstr "સિન્ના ૧" 2097 2098 #, kde-format 2099 msgctxt "color" 2100 msgid "sienna2" 2101 msgstr "સિન્ના ૨" 2102 2103 #, kde-format 2104 msgctxt "color" 2105 msgid "sienna3" 2106 msgstr "સિન્ના ૩" 2107 2108 #, kde-format 2109 msgctxt "color" 2110 msgid "sienna4" 2111 msgstr "સિન્ના ૪" 2112 2113 #, kde-format 2114 msgctxt "color" 2115 msgid "snow" 2116 msgstr "બરફ" 2117 2118 #, kde-format 2119 msgctxt "color" 2120 msgid "snow1" 2121 msgstr "બરફ ૧" 2122 2123 #, kde-format 2124 msgctxt "color" 2125 msgid "snow2" 2126 msgstr "બરફ ૨" 2127 2128 #, kde-format 2129 msgctxt "color" 2130 msgid "snow3" 2131 msgstr "બરફ ૩" 2132 2133 #, kde-format 2134 msgctxt "color" 2135 msgid "snow4" 2136 msgstr "બરફ ૪" 2137 2138 #, fuzzy, kde-format 2139 #| msgctxt "Coptic month 10 - ShortName" 2140 #| msgid "Pan" 2141 msgctxt "color" 2142 msgid "tan" 2143 msgstr "પાન" 2144 2145 #, kde-format 2146 msgctxt "color" 2147 msgid "tan1" 2148 msgstr "ટાન ૧" 2149 2150 #, kde-format 2151 msgctxt "color" 2152 msgid "tan2" 2153 msgstr "ટાન ૨" 2154 2155 #, kde-format 2156 msgctxt "color" 2157 msgid "tan3" 2158 msgstr "ટાન ૩" 2159 2160 #, kde-format 2161 msgctxt "color" 2162 msgid "tan4" 2163 msgstr "ટાન ૪" 2164 2165 #, kde-format 2166 msgctxt "color" 2167 msgid "thistle" 2168 msgstr "થીસલ" 2169 2170 #, kde-format 2171 msgctxt "color" 2172 msgid "thistle1" 2173 msgstr "થીસલ ૧" 2174 2175 #, kde-format 2176 msgctxt "color" 2177 msgid "thistle2" 2178 msgstr "થીસલ ૨" 2179 2180 #, kde-format 2181 msgctxt "color" 2182 msgid "thistle3" 2183 msgstr "થીસલ ૩" 2184 2185 #, kde-format 2186 msgctxt "color" 2187 msgid "thistle4" 2188 msgstr "થીસલ ૪" 2189 2190 #, kde-format 2191 msgctxt "color" 2192 msgid "tomato" 2193 msgstr "ટોમેટો" 2194 2195 #, kde-format 2196 msgctxt "color" 2197 msgid "tomato1" 2198 msgstr "ટોમેટો ૧" 2199 2200 #, kde-format 2201 msgctxt "color" 2202 msgid "tomato2" 2203 msgstr "ટોમેટો ૨" 2204 2205 #, kde-format 2206 msgctxt "color" 2207 msgid "tomato3" 2208 msgstr "ટોમેટો ૩" 2209 2210 #, kde-format 2211 msgctxt "color" 2212 msgid "tomato4" 2213 msgstr "ટોમેટો ૪" 2214 2215 #, kde-format 2216 msgctxt "color" 2217 msgid "turquoise" 2218 msgstr "ભૂરોલીલો" 2219 2220 #, kde-format 2221 msgctxt "color" 2222 msgid "turquoise1" 2223 msgstr "ભૂરોલીલો ૧" 2224 2225 #, kde-format 2226 msgctxt "color" 2227 msgid "turquoise2" 2228 msgstr "ભૂરોલીલો ૨" 2229 2230 #, kde-format 2231 msgctxt "color" 2232 msgid "turquoise3" 2233 msgstr "ભૂરોલીલો ૩" 2234 2235 #, kde-format 2236 msgctxt "color" 2237 msgid "turquoise4" 2238 msgstr "ભૂરોલીલો ૪" 2239 2240 #, kde-format 2241 msgctxt "color" 2242 msgid "violet" 2243 msgstr "જાંબલી" 2244 2245 #, kde-format 2246 msgctxt "color" 2247 msgid "wheat" 2248 msgstr "ઘઉંવર્ણ" 2249 2250 #, kde-format 2251 msgctxt "color" 2252 msgid "wheat1" 2253 msgstr "ઘઉંવર્ણ ૧" 2254 2255 #, kde-format 2256 msgctxt "color" 2257 msgid "wheat2" 2258 msgstr "ઘઉંવર્ણ ૨" 2259 2260 #, kde-format 2261 msgctxt "color" 2262 msgid "wheat3" 2263 msgstr "ઘઉંવર્ણ ૩" 2264 2265 #, kde-format 2266 msgctxt "color" 2267 msgid "wheat4" 2268 msgstr "ઘઉંવર્ણ ૪" 2269 2270 #, kde-format 2271 msgctxt "color" 2272 msgid "white" 2273 msgstr "સફેદ" 2274 2275 #, kde-format 2276 msgctxt "color" 2277 msgid "yellow" 2278 msgstr "પીળો" 2279 2280 #, kde-format 2281 msgctxt "color" 2282 msgid "yellow1" 2283 msgstr "પીળો ૧" 2284 2285 #, kde-format 2286 msgctxt "color" 2287 msgid "yellow2" 2288 msgstr "પીળો ૨" 2289 2290 #, kde-format 2291 msgctxt "color" 2292 msgid "yellow3" 2293 msgstr "પીળો ૩" 2294 2295 #, kde-format 2296 msgctxt "color" 2297 msgid "yellow4" 2298 msgstr "પીળો ૪" 2299 2300 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2301 #, kde-format 2302 msgid "Debug Settings" 2303 msgstr "ભૂલચકાસણી(Debug) ગોઠવણીઓ" 2304 2305 #: kdebugdialog/kdebugdialog.cpp:59 2306 #, kde-format 2307 msgid "File" 2308 msgstr "ફાઇલ" 2309 2310 #: kdebugdialog/kdebugdialog.cpp:60 2311 #, kde-format 2312 msgid "Message Box" 2313 msgstr "સંદેશા સંવાદ પેટી" 2314 2315 #: kdebugdialog/kdebugdialog.cpp:61 2316 #, kde-format 2317 msgid "Shell" 2318 msgstr "શેલ" 2319 2320 #: kdebugdialog/kdebugdialog.cpp:62 2321 #, kde-format 2322 msgid "Syslog" 2323 msgstr "Syslog" 2324 2325 #: kdebugdialog/kdebugdialog.cpp:63 2326 #, kde-format 2327 msgid "None" 2328 msgstr "કંઇ નહી" 2329 2330 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2331 #: kdebugdialog/kdebugdialog.ui:48 2332 #, kde-format 2333 msgid "Information" 2334 msgstr "માહિતી" 2335 2336 #. i18n: ectx: property (text), widget (QLabel, label_2) 2337 #. i18n: ectx: property (text), widget (QLabel, label_8) 2338 #. i18n: ectx: property (text), widget (QLabel, label_4) 2339 #. i18n: ectx: property (text), widget (QLabel, label_6) 2340 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2341 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2342 #, kde-format 2343 msgid "Output to:" 2344 msgstr "માં ઉત્પાદન:" 2345 2346 #. i18n: ectx: property (text), widget (QLabel, label_3) 2347 #. i18n: ectx: property (text), widget (QLabel, label_9) 2348 #. i18n: ectx: property (text), widget (QLabel, label_5) 2349 #. i18n: ectx: property (text), widget (QLabel, label_7) 2350 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2351 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2352 #, kde-format 2353 msgid "Filename:" 2354 msgstr "ફાઇલનામ:" 2355 2356 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2357 #: kdebugdialog/kdebugdialog.ui:83 2358 #, kde-format 2359 msgid "Error" 2360 msgstr "ક્ષતિ" 2361 2362 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2363 #: kdebugdialog/kdebugdialog.ui:118 2364 #, kde-format 2365 msgid "Abort on fatal errors" 2366 msgstr "ઘાતક ક્ષતિ વખતે તરછોડો" 2367 2368 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2369 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2370 #, kde-format 2371 msgid "Disable all debug output" 2372 msgstr "બધા ડિબટ આઉટપુટને નિષ્ક્રિય કરો" 2373 2374 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2375 #: kdebugdialog/kdebugdialog.ui:145 2376 #, kde-format 2377 msgid "Warning" 2378 msgstr "ચેતવણી" 2379 2380 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2381 #: kdebugdialog/kdebugdialog.ui:180 2382 #, kde-format 2383 msgid "Fatal Error" 2384 msgstr "ઘાતક ક્ષતિ" 2385 2386 #: kdebugdialog/klistdebugdialog.cpp:69 2387 #, kde-format 2388 msgid "&Select All" 2389 msgstr "બધુ પસન્દ કરો (&S)" 2390 2391 #: kdebugdialog/klistdebugdialog.cpp:70 2392 #, kde-format 2393 msgid "&Deselect All" 2394 msgstr "બધું નાપસંદ કરો (&D)" 2395 2396 #: kdebugdialog/main.cpp:100 2397 #, kde-format 2398 msgid "KDebugDialog" 2399 msgstr "KDebugDialog" 2400 2401 #: kdebugdialog/main.cpp:101 2402 #, kde-format 2403 msgid "A dialog box for setting preferences for debug output" 2404 msgstr "" 2405 "ભૂલચકાસણી(debug) ઉત્પાદન(output) માટેની પ્રાથમિકતા નક્કી કરવા માટેનો સંવાદ પેટી" 2406 2407 #: kdebugdialog/main.cpp:102 2408 #, fuzzy, kde-format 2409 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2410 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2411 msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2412 2413 #: kdebugdialog/main.cpp:103 2414 #, kde-format 2415 msgid "David Faure" 2416 msgstr "ડેવિડ ફોર" 2417 2418 #: kdebugdialog/main.cpp:103 2419 #, kde-format 2420 msgid "Maintainer" 2421 msgstr "જાળવનાર" 2422 2423 #: kdebugdialog/main.cpp:108 2424 #, kde-format 2425 msgid "Show the fully-fledged dialog instead of the default list dialog" 2426 msgstr "મૂળભૂત સંવાદ યાદીને બદલે પૂરેપૂરો સંવાદ બતાવો" 2427 2428 #: kdebugdialog/main.cpp:109 2429 #, kde-format 2430 msgid "Turn area on" 2431 msgstr "ક્ષેત્રને ચાલુ કરો" 2432 2433 #: kdebugdialog/main.cpp:110 2434 #, kde-format 2435 msgid "Turn area off" 2436 msgstr "ક્ષેત્રને બંધ કરો" 2437 2438 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2439 #, kde-format 2440 msgid "no error" 2441 msgstr "કોઇ ક્ષતિ નથી" 2442 2443 #: kdecore/k3resolver.cpp:534 2444 #, kde-format 2445 msgid "requested family not supported for this host name" 2446 msgstr "વિનંતી કરેલ કુળ આ યજમાન નામ માટે આધારિત નથી" 2447 2448 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2449 #, kde-format 2450 msgid "temporary failure in name resolution" 2451 msgstr "નામ ઉકેલવામાં કામચલાઉ નિષ્ફળતા" 2452 2453 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2454 #, kde-format 2455 msgid "non-recoverable failure in name resolution" 2456 msgstr "નામ ઉકેલવામાં પાછી હલ કરી શકાય નહી તેવી નિષ્ફળતા" 2457 2458 #: kdecore/k3resolver.cpp:537 2459 #, kde-format 2460 msgid "invalid flags" 2461 msgstr "અયોગ્ય ફ્લેગો" 2462 2463 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2464 #, kde-format 2465 msgid "memory allocation failure" 2466 msgstr "મેમરી સોંપણી નિષ્ફળ" 2467 2468 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2469 #, kde-format 2470 msgid "name or service not known" 2471 msgstr "નામ અથવા સેવા જાણીતી નથી" 2472 2473 #: kdecore/k3resolver.cpp:540 2474 #, kde-format 2475 msgid "requested family not supported" 2476 msgstr "વિનંતી કરેલ કુળ આધારિત નથી" 2477 2478 #: kdecore/k3resolver.cpp:541 2479 #, kde-format 2480 msgid "requested service not supported for this socket type" 2481 msgstr "આ સોકેટ પ્રકાર માટે વિનંતી કરેલ સેવા આધારિત નથી" 2482 2483 #: kdecore/k3resolver.cpp:542 2484 #, kde-format 2485 msgid "requested socket type not supported" 2486 msgstr "વિનંતી કરેલ સોકેટ પ્રકાર આધારભૂત નથી" 2487 2488 #: kdecore/k3resolver.cpp:543 2489 #, kde-format 2490 msgid "unknown error" 2491 msgstr "અજ્ઞાત ક્ષતિ" 2492 2493 #: kdecore/k3resolver.cpp:545 2494 #, kde-format 2495 msgctxt "1: the i18n'ed system error code, from errno" 2496 msgid "system error: %1" 2497 msgstr "સિસ્ટમ ક્ષતિ: %1" 2498 2499 #: kdecore/k3resolver.cpp:556 2500 #, kde-format 2501 msgid "request was canceled" 2502 msgstr "વિનંતી રદ થઈ હતી" 2503 2504 #: kdecore/k3socketaddress.cpp:631 2505 #, kde-format 2506 msgctxt "1: the unknown socket address family number" 2507 msgid "Unknown family %1" 2508 msgstr "અજ્ઞાત કુળ %1" 2509 2510 #: kdecore/k3socketbase.cpp:215 2511 #, kde-format 2512 msgctxt "Socket error code NoError" 2513 msgid "no error" 2514 msgstr "કોઇ ક્ષતિ નથી" 2515 2516 #: kdecore/k3socketbase.cpp:220 2517 #, kde-format 2518 msgctxt "Socket error code LookupFailure" 2519 msgid "name lookup has failed" 2520 msgstr "નામ શોધવાનું નિષ્ફળ ગયેલ છે" 2521 2522 #: kdecore/k3socketbase.cpp:225 2523 #, kde-format 2524 msgctxt "Socket error code AddressInUse" 2525 msgid "address already in use" 2526 msgstr "સરનામું પહેલેથી ઉપયોગમાં છે" 2527 2528 #: kdecore/k3socketbase.cpp:230 2529 #, kde-format 2530 msgctxt "Socket error code AlreadyBound" 2531 msgid "socket is already bound" 2532 msgstr "સોકેટ પહેલેથી બંધાયેલ છે" 2533 2534 #: kdecore/k3socketbase.cpp:235 2535 #, kde-format 2536 msgctxt "Socket error code AlreadyCreated" 2537 msgid "socket is already created" 2538 msgstr "સોકેટ પહેલેથી બનાવેલ છે" 2539 2540 #: kdecore/k3socketbase.cpp:240 2541 #, kde-format 2542 msgctxt "Socket error code NotBound" 2543 msgid "socket is not bound" 2544 msgstr "સોકેટ બંધાયેલ નથી" 2545 2546 #: kdecore/k3socketbase.cpp:245 2547 #, kde-format 2548 msgctxt "Socket error code NotCreated" 2549 msgid "socket has not been created" 2550 msgstr "સોકેટ પહેલેથી બનાવેલ નથી" 2551 2552 #: kdecore/k3socketbase.cpp:250 2553 #, kde-format 2554 msgctxt "Socket error code WouldBlock" 2555 msgid "operation would block" 2556 msgstr "ક્રિયા રોકી રખાશે" 2557 2558 #: kdecore/k3socketbase.cpp:255 2559 #, kde-format 2560 msgctxt "Socket error code ConnectionRefused" 2561 msgid "connection actively refused" 2562 msgstr "જોડાણ સક્રિય રીતે નકારવામાં આવ્યું" 2563 2564 #: kdecore/k3socketbase.cpp:260 2565 #, kde-format 2566 msgctxt "Socket error code ConnectionTimedOut" 2567 msgid "connection timed out" 2568 msgstr "જોડાણ સમય સમાપ્તિ" 2569 2570 #: kdecore/k3socketbase.cpp:265 2571 #, kde-format 2572 msgctxt "Socket error code InProgress" 2573 msgid "operation is already in progress" 2574 msgstr "ક્રિયા હાલમાં પ્રગતિ પર છે" 2575 2576 #: kdecore/k3socketbase.cpp:270 2577 #, kde-format 2578 msgctxt "Socket error code NetFailure" 2579 msgid "network failure occurred" 2580 msgstr "નેટવર્ક નિષ્ફળ થયું" 2581 2582 #: kdecore/k3socketbase.cpp:275 2583 #, kde-format 2584 msgctxt "Socket error code NotSupported" 2585 msgid "operation is not supported" 2586 msgstr "ક્રિયા આધારિત નથી" 2587 2588 #: kdecore/k3socketbase.cpp:280 2589 #, kde-format 2590 msgctxt "Socket error code Timeout" 2591 msgid "timed operation timed out" 2592 msgstr "સમય ક્રિયા સમાપ્ત થઇ ગઇ" 2593 2594 #: kdecore/k3socketbase.cpp:285 2595 #, kde-format 2596 msgctxt "Socket error code UnknownError" 2597 msgid "an unknown/unexpected error has happened" 2598 msgstr "અજાણી/ન ધારેલી ક્ષતિ ઉદ્ભવી છે" 2599 2600 #: kdecore/k3socketbase.cpp:290 2601 #, kde-format 2602 msgctxt "Socket error code RemotelyDisconnected" 2603 msgid "remote host closed connection" 2604 msgstr "દૂરસ્થ યજમાને જોડાણ બંધ કર્યું" 2605 2606 #: kdecore/k4aboutdata.cpp:267 2607 #, kde-format 2608 msgid "" 2609 "No licensing terms for this program have been specified.\n" 2610 "Please check the documentation or the source for any\n" 2611 "licensing terms.\n" 2612 msgstr "" 2613 2614 #: kdecore/k4aboutdata.cpp:273 2615 #, kde-format 2616 msgid "This program is distributed under the terms of the %1." 2617 msgstr "" 2618 2619 #: kdecore/k4aboutdata.cpp:297 2620 #, kde-format 2621 msgctxt "@item license (short name)" 2622 msgid "GPL v2" 2623 msgstr "GPL v૨" 2624 2625 #: kdecore/k4aboutdata.cpp:298 2626 #, kde-format 2627 msgctxt "@item license" 2628 msgid "GNU General Public License Version 2" 2629 msgstr "GNU જનરલ પબ્લિક લાઈસન્સ આવૃત્તિ ૨" 2630 2631 #: kdecore/k4aboutdata.cpp:301 2632 #, kde-format 2633 msgctxt "@item license (short name)" 2634 msgid "LGPL v2" 2635 msgstr "LGPL v૨" 2636 2637 #: kdecore/k4aboutdata.cpp:302 2638 #, kde-format 2639 msgctxt "@item license" 2640 msgid "GNU Lesser General Public License Version 2" 2641 msgstr "GNU લેસર જનરલ પબ્લિક લાઈસન્સ આવૃત્તિ ૨" 2642 2643 #: kdecore/k4aboutdata.cpp:305 2644 #, kde-format 2645 msgctxt "@item license (short name)" 2646 msgid "BSD License" 2647 msgstr "BSD લાઈસન્સ" 2648 2649 #: kdecore/k4aboutdata.cpp:306 2650 #, kde-format 2651 msgctxt "@item license" 2652 msgid "BSD License" 2653 msgstr "BSD લાઈસન્સ" 2654 2655 #: kdecore/k4aboutdata.cpp:309 2656 #, kde-format 2657 msgctxt "@item license (short name)" 2658 msgid "Artistic License" 2659 msgstr "આર્ટિસ્ટિક લાઈસન્સ" 2660 2661 #: kdecore/k4aboutdata.cpp:310 2662 #, kde-format 2663 msgctxt "@item license" 2664 msgid "Artistic License" 2665 msgstr "આર્ટિસ્ટિક લાઈસન્સ" 2666 2667 #: kdecore/k4aboutdata.cpp:313 2668 #, kde-format 2669 msgctxt "@item license (short name)" 2670 msgid "QPL v1.0" 2671 msgstr "QPL v૧.૦" 2672 2673 #: kdecore/k4aboutdata.cpp:314 2674 #, kde-format 2675 msgctxt "@item license" 2676 msgid "Q Public License" 2677 msgstr "Q પબ્લિક લાઈસન્સ" 2678 2679 #: kdecore/k4aboutdata.cpp:317 2680 #, kde-format 2681 msgctxt "@item license (short name)" 2682 msgid "GPL v3" 2683 msgstr "GPL v૩" 2684 2685 #: kdecore/k4aboutdata.cpp:318 2686 #, kde-format 2687 msgctxt "@item license" 2688 msgid "GNU General Public License Version 3" 2689 msgstr "GNU જનરલ પબ્લિક લાઈસન્સ આવૃત્તિ ૩" 2690 2691 #: kdecore/k4aboutdata.cpp:321 2692 #, kde-format 2693 msgctxt "@item license (short name)" 2694 msgid "LGPL v3" 2695 msgstr "LGPL v૩" 2696 2697 #: kdecore/k4aboutdata.cpp:322 2698 #, kde-format 2699 msgctxt "@item license" 2700 msgid "GNU Lesser General Public License Version 3" 2701 msgstr "GNU લેસર જનરલ પબ્લિક લાઈસન્સ આવૃત્તિ ૩" 2702 2703 #: kdecore/k4aboutdata.cpp:326 2704 #, kde-format 2705 msgctxt "@item license" 2706 msgid "Custom" 2707 msgstr "પોતાનું" 2708 2709 #: kdecore/k4aboutdata.cpp:329 2710 #, kde-format 2711 msgctxt "@item license" 2712 msgid "Not specified" 2713 msgstr "સ્પષ્ટ થયેલ નથી" 2714 2715 #: kdecore/k4aboutdata.cpp:891 2716 #, kde-format 2717 msgctxt "replace this with information about your translation team" 2718 msgid "" 2719 "<p>KDE is translated into many languages thanks to the work of the " 2720 "translation teams all over the world.</p><p>For more information on KDE " 2721 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2722 "org</a></p>" 2723 msgstr "" 2724 "<p>KDE ઘણી બધી ભાષાઓમાં ભાષાંતરિત થયેલ છે જે સમગ્ર વિશ્વની ભાષાંતર ટીમોને આભારી છે.</" 2725 "p><p>વધુ માહિતી માટે KDE આંતરરાષ્ટ્રિયકરણની મુલાકાત લો <a href=\"http://l10n.kde." 2726 "org\">http://l10n.kde.org</a></p>" 2727 2728 #: kdecore/kcalendarsystem.cpp:108 2729 #, kde-format 2730 msgctxt "@item Calendar system" 2731 msgid "Gregorian" 2732 msgstr "જ્યોર્જિયન" 2733 2734 #: kdecore/kcalendarsystem.cpp:110 2735 #, kde-format 2736 msgctxt "@item Calendar system" 2737 msgid "Coptic" 2738 msgstr "કોપ્ટીક" 2739 2740 #: kdecore/kcalendarsystem.cpp:112 2741 #, kde-format 2742 msgctxt "@item Calendar system" 2743 msgid "Ethiopian" 2744 msgstr "ઈથીઓપીઅન" 2745 2746 #: kdecore/kcalendarsystem.cpp:114 2747 #, kde-format 2748 msgctxt "@item Calendar system" 2749 msgid "Hebrew" 2750 msgstr "હિબ્રુ" 2751 2752 #: kdecore/kcalendarsystem.cpp:116 2753 #, kde-format 2754 msgctxt "@item Calendar system" 2755 msgid "Islamic / Hijri (Civil)" 2756 msgstr "" 2757 2758 #: kdecore/kcalendarsystem.cpp:118 2759 #, kde-format 2760 msgctxt "@item Calendar system" 2761 msgid "Indian National" 2762 msgstr "ભારતીય રાષ્ટ્રીય" 2763 2764 #: kdecore/kcalendarsystem.cpp:120 2765 #, kde-format 2766 msgctxt "@item Calendar system" 2767 msgid "Jalali" 2768 msgstr "જલાલી" 2769 2770 #: kdecore/kcalendarsystem.cpp:122 2771 #, kde-format 2772 msgctxt "@item Calendar system" 2773 msgid "Japanese" 2774 msgstr "" 2775 2776 #: kdecore/kcalendarsystem.cpp:124 2777 #, kde-format 2778 msgctxt "@item Calendar system" 2779 msgid "Julian" 2780 msgstr "જુલિયન" 2781 2782 #: kdecore/kcalendarsystem.cpp:126 2783 #, kde-format 2784 msgctxt "@item Calendar system" 2785 msgid "Taiwanese" 2786 msgstr "" 2787 2788 #: kdecore/kcalendarsystem.cpp:128 2789 #, fuzzy, kde-format 2790 #| msgid "R. Thaani" 2791 msgctxt "@item Calendar system" 2792 msgid "Thai" 2793 msgstr "ર. થાની" 2794 2795 #: kdecore/kcalendarsystem.cpp:131 2796 #, kde-format 2797 msgctxt "@item Calendar system" 2798 msgid "Invalid Calendar Type" 2799 msgstr "અયોગ્ય કેલેન્ડર પ્રકાર" 2800 2801 #: kdecore/kcalendarsystem.cpp:1495 2802 #, kde-format 2803 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2804 msgid "-" 2805 msgstr "" 2806 2807 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2808 #: kio/kfilemetadataprovider.cpp:199 2809 #, kde-format 2810 msgid "Today" 2811 msgstr "આજે" 2812 2813 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2814 #: kio/kfilemetadataprovider.cpp:202 2815 #, kde-format 2816 msgid "Yesterday" 2817 msgstr "ગઇકાલે" 2818 2819 #: kdecore/kcalendarsystemcoptic.cpp:45 2820 #, kde-format 2821 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2822 msgid "Anno Martyrum" 2823 msgstr "" 2824 2825 #: kdecore/kcalendarsystemcoptic.cpp:46 2826 #, kde-format 2827 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2828 msgid "AM" 2829 msgstr "" 2830 2831 #: kdecore/kcalendarsystemcoptic.cpp:47 2832 #, kde-format 2833 msgctxt "" 2834 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2835 msgid "%Ey %EC" 2836 msgstr "" 2837 2838 #: kdecore/kcalendarsystemcoptic.cpp:153 2839 #, kde-format 2840 msgctxt "Coptic month 1 - KLocale::NarrowName" 2841 msgid "T" 2842 msgstr "" 2843 2844 #: kdecore/kcalendarsystemcoptic.cpp:155 2845 #, kde-format 2846 msgctxt "Coptic month 2 - KLocale::NarrowName" 2847 msgid "P" 2848 msgstr "" 2849 2850 #: kdecore/kcalendarsystemcoptic.cpp:157 2851 #, kde-format 2852 msgctxt "Coptic month 3 - KLocale::NarrowName" 2853 msgid "H" 2854 msgstr "" 2855 2856 #: kdecore/kcalendarsystemcoptic.cpp:159 2857 #, kde-format 2858 msgctxt "Coptic month 4 - KLocale::NarrowName" 2859 msgid "K" 2860 msgstr "" 2861 2862 #: kdecore/kcalendarsystemcoptic.cpp:161 2863 #, kde-format 2864 msgctxt "Coptic month 5 - KLocale::NarrowName" 2865 msgid "T" 2866 msgstr "" 2867 2868 #: kdecore/kcalendarsystemcoptic.cpp:163 2869 #, kde-format 2870 msgctxt "Coptic month 6 - KLocale::NarrowName" 2871 msgid "M" 2872 msgstr "" 2873 2874 #: kdecore/kcalendarsystemcoptic.cpp:165 2875 #, kde-format 2876 msgctxt "Coptic month 7 - KLocale::NarrowName" 2877 msgid "P" 2878 msgstr "" 2879 2880 #: kdecore/kcalendarsystemcoptic.cpp:167 2881 #, kde-format 2882 msgctxt "Coptic month 8 - KLocale::NarrowName" 2883 msgid "P" 2884 msgstr "" 2885 2886 #: kdecore/kcalendarsystemcoptic.cpp:169 2887 #, kde-format 2888 msgctxt "Coptic month 9 - KLocale::NarrowName" 2889 msgid "P" 2890 msgstr "" 2891 2892 #: kdecore/kcalendarsystemcoptic.cpp:171 2893 #, kde-format 2894 msgctxt "Coptic month 10 - KLocale::NarrowName" 2895 msgid "P" 2896 msgstr "" 2897 2898 #: kdecore/kcalendarsystemcoptic.cpp:173 2899 #, kde-format 2900 msgctxt "Coptic month 11 - KLocale::NarrowName" 2901 msgid "E" 2902 msgstr "" 2903 2904 #: kdecore/kcalendarsystemcoptic.cpp:175 2905 #, kde-format 2906 msgctxt "Coptic month 12 - KLocale::NarrowName" 2907 msgid "M" 2908 msgstr "" 2909 2910 #: kdecore/kcalendarsystemcoptic.cpp:177 2911 #, kde-format 2912 msgctxt "Coptic month 13 - KLocale::NarrowName" 2913 msgid "K" 2914 msgstr "" 2915 2916 #: kdecore/kcalendarsystemcoptic.cpp:186 2917 #, fuzzy, kde-format 2918 #| msgctxt "Coptic month 1 - ShortNamePossessive" 2919 #| msgid "of Tho" 2920 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2921 msgid "of Tho" 2922 msgstr "થો નું" 2923 2924 #: kdecore/kcalendarsystemcoptic.cpp:188 2925 #, fuzzy, kde-format 2926 #| msgctxt "Coptic month 2 - ShortNamePossessive" 2927 #| msgid "of Pao" 2928 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2929 msgid "of Pao" 2930 msgstr "પાઓ નું" 2931 2932 #: kdecore/kcalendarsystemcoptic.cpp:190 2933 #, fuzzy, kde-format 2934 #| msgctxt "Coptic month 3 - ShortNamePossessive" 2935 #| msgid "of Hat" 2936 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2937 msgid "of Hat" 2938 msgstr "હાત નું" 2939 2940 #: kdecore/kcalendarsystemcoptic.cpp:192 2941 #, fuzzy, kde-format 2942 #| msgctxt "Coptic month 4 - ShortNamePossessive" 2943 #| msgid "of Kia" 2944 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2945 msgid "of Kia" 2946 msgstr "કિઆ નું" 2947 2948 #: kdecore/kcalendarsystemcoptic.cpp:194 2949 #, fuzzy, kde-format 2950 #| msgctxt "Coptic month 5 - ShortNamePossessive" 2951 #| msgid "of Tob" 2952 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2953 msgid "of Tob" 2954 msgstr "તોબ નું" 2955 2956 #: kdecore/kcalendarsystemcoptic.cpp:196 2957 #, fuzzy, kde-format 2958 #| msgctxt "Coptic month 6 - ShortNamePossessive" 2959 #| msgid "of Mes" 2960 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2961 msgid "of Mes" 2962 msgstr "મેસ નું" 2963 2964 #: kdecore/kcalendarsystemcoptic.cpp:198 2965 #, fuzzy, kde-format 2966 #| msgctxt "Coptic month 7 - ShortNamePossessive" 2967 #| msgid "of Par" 2968 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2969 msgid "of Par" 2970 msgstr "પાર નું" 2971 2972 #: kdecore/kcalendarsystemcoptic.cpp:200 2973 #, fuzzy, kde-format 2974 #| msgctxt "Coptic month 8 - ShortNamePossessive" 2975 #| msgid "of Pam" 2976 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2977 msgid "of Pam" 2978 msgstr "પામ નું" 2979 2980 #: kdecore/kcalendarsystemcoptic.cpp:202 2981 #, fuzzy, kde-format 2982 #| msgctxt "Coptic month 9 - ShortNamePossessive" 2983 #| msgid "of Pas" 2984 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2985 msgid "of Pas" 2986 msgstr "પાસ નું" 2987 2988 #: kdecore/kcalendarsystemcoptic.cpp:204 2989 #, fuzzy, kde-format 2990 #| msgctxt "Coptic month 10 - ShortNamePossessive" 2991 #| msgid "of Pan" 2992 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2993 msgid "of Pan" 2994 msgstr "પાન નું" 2995 2996 #: kdecore/kcalendarsystemcoptic.cpp:206 2997 #, fuzzy, kde-format 2998 #| msgctxt "Coptic month 11 - ShortNamePossessive" 2999 #| msgid "of Epe" 3000 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 3001 msgid "of Epe" 3002 msgstr "એપ નું" 3003 3004 #: kdecore/kcalendarsystemcoptic.cpp:208 3005 #, fuzzy, kde-format 3006 #| msgctxt "Coptic month 12 - ShortNamePossessive" 3007 #| msgid "of Meo" 3008 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 3009 msgid "of Meo" 3010 msgstr "મિઓ નું" 3011 3012 #: kdecore/kcalendarsystemcoptic.cpp:210 3013 #, fuzzy, kde-format 3014 #| msgctxt "Coptic month 13 - ShortNamePossessive" 3015 #| msgid "of Kou" 3016 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3017 msgid "of Kou" 3018 msgstr "કાઉ નું" 3019 3020 #: kdecore/kcalendarsystemcoptic.cpp:219 3021 #, fuzzy, kde-format 3022 #| msgctxt "Coptic month 1 - ShortName" 3023 #| msgid "Tho" 3024 msgctxt "Coptic month 1 - KLocale::ShortName" 3025 msgid "Tho" 3026 msgstr "થો" 3027 3028 #: kdecore/kcalendarsystemcoptic.cpp:221 3029 #, fuzzy, kde-format 3030 #| msgctxt "Coptic month 2 - ShortName" 3031 #| msgid "Pao" 3032 msgctxt "Coptic month 2 - KLocale::ShortName" 3033 msgid "Pao" 3034 msgstr "પાઓ" 3035 3036 #: kdecore/kcalendarsystemcoptic.cpp:223 3037 #, fuzzy, kde-format 3038 #| msgctxt "Coptic month 3 - ShortName" 3039 #| msgid "Hat" 3040 msgctxt "Coptic month 3 - KLocale::ShortName" 3041 msgid "Hat" 3042 msgstr "હાત" 3043 3044 #: kdecore/kcalendarsystemcoptic.cpp:225 3045 #, fuzzy, kde-format 3046 #| msgctxt "Coptic month 4 - ShortName" 3047 #| msgid "Kia" 3048 msgctxt "Coptic month 4 - KLocale::ShortName" 3049 msgid "Kia" 3050 msgstr "કિઆ" 3051 3052 #: kdecore/kcalendarsystemcoptic.cpp:227 3053 #, fuzzy, kde-format 3054 #| msgctxt "Coptic month 5 - ShortName" 3055 #| msgid "Tob" 3056 msgctxt "Coptic month 5 - KLocale::ShortName" 3057 msgid "Tob" 3058 msgstr "તોબ" 3059 3060 #: kdecore/kcalendarsystemcoptic.cpp:229 3061 #, fuzzy, kde-format 3062 #| msgctxt "Coptic month 6 - ShortName" 3063 #| msgid "Mes" 3064 msgctxt "Coptic month 6 - KLocale::ShortName" 3065 msgid "Mes" 3066 msgstr "મેસ" 3067 3068 #: kdecore/kcalendarsystemcoptic.cpp:231 3069 #, fuzzy, kde-format 3070 #| msgctxt "Coptic month 7 - ShortName" 3071 #| msgid "Par" 3072 msgctxt "Coptic month 7 - KLocale::ShortName" 3073 msgid "Par" 3074 msgstr "પાર" 3075 3076 #: kdecore/kcalendarsystemcoptic.cpp:233 3077 #, fuzzy, kde-format 3078 #| msgctxt "Coptic month 8 - ShortName" 3079 #| msgid "Pam" 3080 msgctxt "Coptic month 8 - KLocale::ShortName" 3081 msgid "Pam" 3082 msgstr "પામ" 3083 3084 #: kdecore/kcalendarsystemcoptic.cpp:235 3085 #, fuzzy, kde-format 3086 #| msgctxt "Coptic month 9 - ShortName" 3087 #| msgid "Pas" 3088 msgctxt "Coptic month 9 - KLocale::ShortName" 3089 msgid "Pas" 3090 msgstr "પાસ" 3091 3092 #: kdecore/kcalendarsystemcoptic.cpp:237 3093 #, fuzzy, kde-format 3094 #| msgctxt "Coptic month 10 - ShortName" 3095 #| msgid "Pan" 3096 msgctxt "Coptic month 10 - KLocale::ShortName" 3097 msgid "Pan" 3098 msgstr "પાન" 3099 3100 #: kdecore/kcalendarsystemcoptic.cpp:239 3101 #, fuzzy, kde-format 3102 #| msgctxt "Coptic month 11 - ShortName" 3103 #| msgid "Epe" 3104 msgctxt "Coptic month 11 - KLocale::ShortName" 3105 msgid "Epe" 3106 msgstr "એપ" 3107 3108 #: kdecore/kcalendarsystemcoptic.cpp:241 3109 #, fuzzy, kde-format 3110 #| msgctxt "Coptic month 12 - ShortName" 3111 #| msgid "Meo" 3112 msgctxt "Coptic month 12 - KLocale::ShortName" 3113 msgid "Meo" 3114 msgstr "મેઓ" 3115 3116 #: kdecore/kcalendarsystemcoptic.cpp:243 3117 #, fuzzy, kde-format 3118 #| msgctxt "Coptic month 13 - ShortName" 3119 #| msgid "Kou" 3120 msgctxt "Coptic month 12 - KLocale::ShortName" 3121 msgid "Kou" 3122 msgstr "કાઉ" 3123 3124 #: kdecore/kcalendarsystemcoptic.cpp:252 3125 #, fuzzy, kde-format 3126 #| msgctxt "Coptic month 1 - LongNamePossessive" 3127 #| msgid "of Thoout" 3128 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3129 msgid "of Thoout" 3130 msgstr "ખો નું" 3131 3132 #: kdecore/kcalendarsystemcoptic.cpp:254 3133 #, fuzzy, kde-format 3134 #| msgctxt "Coptic month 2 - LongNamePossessive" 3135 #| msgid "of Paope" 3136 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3137 msgid "of Paope" 3138 msgstr "પાઓપે નું" 3139 3140 #: kdecore/kcalendarsystemcoptic.cpp:256 3141 #, fuzzy, kde-format 3142 #| msgctxt "Coptic month 3 - LongNamePossessive" 3143 #| msgid "of Hathor" 3144 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3145 msgid "of Hathor" 3146 msgstr "હેથોર નું" 3147 3148 #: kdecore/kcalendarsystemcoptic.cpp:258 3149 #, fuzzy, kde-format 3150 #| msgctxt "Coptic month 4 - LongNamePossessive" 3151 #| msgid "of Kiahk" 3152 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3153 msgid "of Kiahk" 3154 msgstr "કિઆહ્ક નું" 3155 3156 #: kdecore/kcalendarsystemcoptic.cpp:260 3157 #, fuzzy, kde-format 3158 #| msgctxt "Coptic month 5 - LongNamePossessive" 3159 #| msgid "of Tobe" 3160 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3161 msgid "of Tobe" 3162 msgstr "તોબે નું" 3163 3164 #: kdecore/kcalendarsystemcoptic.cpp:262 3165 #, fuzzy, kde-format 3166 #| msgctxt "Coptic month 6 - LongNamePossessive" 3167 #| msgid "of Meshir" 3168 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3169 msgid "of Meshir" 3170 msgstr "મેહ્શિર નું" 3171 3172 #: kdecore/kcalendarsystemcoptic.cpp:264 3173 #, fuzzy, kde-format 3174 #| msgctxt "Coptic month 7 - LongNamePossessive" 3175 #| msgid "of Paremhotep" 3176 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3177 msgid "of Paremhotep" 3178 msgstr "પારેમ્હોતેપ નું" 3179 3180 #: kdecore/kcalendarsystemcoptic.cpp:266 3181 #, fuzzy, kde-format 3182 #| msgctxt "Coptic month 8 - LongNamePossessive" 3183 #| msgid "of Parmoute" 3184 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3185 msgid "of Parmoute" 3186 msgstr "પારમોઉત નું" 3187 3188 #: kdecore/kcalendarsystemcoptic.cpp:268 3189 #, fuzzy, kde-format 3190 #| msgctxt "Coptic month 9 - LongNamePossessive" 3191 #| msgid "of Pashons" 3192 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3193 msgid "of Pashons" 3194 msgstr "પાશોન્સ નું" 3195 3196 #: kdecore/kcalendarsystemcoptic.cpp:270 3197 #, fuzzy, kde-format 3198 #| msgctxt "Coptic month 10 - LongNamePossessive" 3199 #| msgid "of Paone" 3200 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3201 msgid "of Paone" 3202 msgstr "પાઓનેનું" 3203 3204 #: kdecore/kcalendarsystemcoptic.cpp:272 3205 #, fuzzy, kde-format 3206 #| msgctxt "Coptic month 11 - LongNamePossessive" 3207 #| msgid "of Epep" 3208 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3209 msgid "of Epep" 3210 msgstr "ઇપેપનું" 3211 3212 #: kdecore/kcalendarsystemcoptic.cpp:274 3213 #, fuzzy, kde-format 3214 #| msgctxt "Coptic month 12 - LongNamePossessive" 3215 #| msgid "of Mesore" 3216 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3217 msgid "of Mesore" 3218 msgstr "મેસોરનું" 3219 3220 #: kdecore/kcalendarsystemcoptic.cpp:276 3221 #, fuzzy, kde-format 3222 #| msgctxt "Coptic month 13 - LongNamePossessive" 3223 #| msgid "of Kouji nabot" 3224 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3225 msgid "of Kouji nabot" 3226 msgstr "કોઉજી નાબોતનું" 3227 3228 #: kdecore/kcalendarsystemcoptic.cpp:285 3229 #, fuzzy, kde-format 3230 #| msgctxt "Coptic month 1 - LongName" 3231 #| msgid "Thoout" 3232 msgctxt "Coptic month 1 - KLocale::LongName" 3233 msgid "Thoout" 3234 msgstr "થોઆઉટ" 3235 3236 #: kdecore/kcalendarsystemcoptic.cpp:287 3237 #, fuzzy, kde-format 3238 #| msgctxt "Coptic month 2 - LongName" 3239 #| msgid "Paope" 3240 msgctxt "Coptic month 2 - KLocale::LongName" 3241 msgid "Paope" 3242 msgstr "પાઓપે" 3243 3244 #: kdecore/kcalendarsystemcoptic.cpp:289 3245 #, fuzzy, kde-format 3246 #| msgctxt "Coptic month 3 - LongName" 3247 #| msgid "Hathor" 3248 msgctxt "Coptic month 3 - KLocale::LongName" 3249 msgid "Hathor" 3250 msgstr "હેથોર" 3251 3252 #: kdecore/kcalendarsystemcoptic.cpp:291 3253 #, fuzzy, kde-format 3254 #| msgctxt "Coptic month 4 - LongName" 3255 #| msgid "Kiahk" 3256 msgctxt "Coptic month 4 - KLocale::LongName" 3257 msgid "Kiahk" 3258 msgstr "કિઆહ્ક" 3259 3260 #: kdecore/kcalendarsystemcoptic.cpp:293 3261 #, fuzzy, kde-format 3262 #| msgctxt "Coptic month 5 - LongName" 3263 #| msgid "Tobe" 3264 msgctxt "Coptic month 5 - KLocale::LongName" 3265 msgid "Tobe" 3266 msgstr "તોબે" 3267 3268 #: kdecore/kcalendarsystemcoptic.cpp:295 3269 #, fuzzy, kde-format 3270 #| msgctxt "Coptic month 6 - LongName" 3271 #| msgid "Meshir" 3272 msgctxt "Coptic month 6 - KLocale::LongName" 3273 msgid "Meshir" 3274 msgstr "મેહશિર" 3275 3276 #: kdecore/kcalendarsystemcoptic.cpp:297 3277 #, fuzzy, kde-format 3278 #| msgctxt "Coptic month 7 - LongName" 3279 #| msgid "Paremhotep" 3280 msgctxt "Coptic month 7 - KLocale::LongName" 3281 msgid "Paremhotep" 3282 msgstr "પારેમ્હોતેપ" 3283 3284 #: kdecore/kcalendarsystemcoptic.cpp:299 3285 #, fuzzy, kde-format 3286 #| msgctxt "Coptic month 8 - LongName" 3287 #| msgid "Parmoute" 3288 msgctxt "Coptic month 8 - KLocale::LongName" 3289 msgid "Parmoute" 3290 msgstr "પારમોઉત" 3291 3292 #: kdecore/kcalendarsystemcoptic.cpp:301 3293 #, fuzzy, kde-format 3294 #| msgctxt "Coptic month 9 - LongName" 3295 #| msgid "Pashons" 3296 msgctxt "Coptic month 9 - KLocale::LongName" 3297 msgid "Pashons" 3298 msgstr "પાશોન્સ" 3299 3300 #: kdecore/kcalendarsystemcoptic.cpp:303 3301 #, fuzzy, kde-format 3302 #| msgctxt "Coptic month 10 - LongName" 3303 #| msgid "Paone" 3304 msgctxt "Coptic month 10 - KLocale::LongName" 3305 msgid "Paone" 3306 msgstr "પાઓને" 3307 3308 #: kdecore/kcalendarsystemcoptic.cpp:305 3309 #, fuzzy, kde-format 3310 #| msgctxt "Coptic month 11 - LongName" 3311 #| msgid "Epep" 3312 msgctxt "Coptic month 11 - KLocale::LongName" 3313 msgid "Epep" 3314 msgstr "ઇપેપ" 3315 3316 #: kdecore/kcalendarsystemcoptic.cpp:307 3317 #, fuzzy, kde-format 3318 #| msgctxt "Coptic month 12 - LongName" 3319 #| msgid "Mesore" 3320 msgctxt "Coptic month 12 - KLocale::LongName" 3321 msgid "Mesore" 3322 msgstr "મેસોર" 3323 3324 #: kdecore/kcalendarsystemcoptic.cpp:309 3325 #, fuzzy, kde-format 3326 #| msgctxt "Coptic month 13 - LongName" 3327 #| msgid "Kouji nabot" 3328 msgctxt "Coptic month 12 - KLocale::LongName" 3329 msgid "Kouji nabot" 3330 msgstr "કાઉજી નાબોત" 3331 3332 #: kdecore/kcalendarsystemcoptic.cpp:324 3333 #, kde-format 3334 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3335 msgid "P" 3336 msgstr "" 3337 3338 #: kdecore/kcalendarsystemcoptic.cpp:326 3339 #, kde-format 3340 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3341 msgid "P" 3342 msgstr "" 3343 3344 #: kdecore/kcalendarsystemcoptic.cpp:328 3345 #, kde-format 3346 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3347 msgid "P" 3348 msgstr "" 3349 3350 #: kdecore/kcalendarsystemcoptic.cpp:330 3351 #, kde-format 3352 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3353 msgid "P" 3354 msgstr "" 3355 3356 #: kdecore/kcalendarsystemcoptic.cpp:332 3357 #, kde-format 3358 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3359 msgid "P" 3360 msgstr "" 3361 3362 #: kdecore/kcalendarsystemcoptic.cpp:334 3363 #, kde-format 3364 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3365 msgid "P" 3366 msgstr "" 3367 3368 #: kdecore/kcalendarsystemcoptic.cpp:336 3369 #, kde-format 3370 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3371 msgid "T" 3372 msgstr "" 3373 3374 #: kdecore/kcalendarsystemcoptic.cpp:345 3375 #, fuzzy, kde-format 3376 #| msgctxt "Coptic weekday 1 - ShortDayName" 3377 #| msgid "Pes" 3378 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3379 msgid "Pes" 3380 msgstr "પેસ" 3381 3382 #: kdecore/kcalendarsystemcoptic.cpp:347 3383 #, fuzzy, kde-format 3384 #| msgctxt "Coptic weekday 2 - ShortDayName" 3385 #| msgid "Psh" 3386 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3387 msgid "Psh" 3388 msgstr "પેશ" 3389 3390 #: kdecore/kcalendarsystemcoptic.cpp:349 3391 #, fuzzy, kde-format 3392 #| msgctxt "Coptic weekday 3 - ShortDayName" 3393 #| msgid "Pef" 3394 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3395 msgid "Pef" 3396 msgstr "પેફ" 3397 3398 #: kdecore/kcalendarsystemcoptic.cpp:351 3399 #, fuzzy, kde-format 3400 #| msgctxt "Coptic weekday 4 - ShortDayName" 3401 #| msgid "Pti" 3402 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3403 msgid "Pti" 3404 msgstr "તિ" 3405 3406 #: kdecore/kcalendarsystemcoptic.cpp:353 3407 #, fuzzy, kde-format 3408 #| msgctxt "Coptic weekday 5 - ShortDayName" 3409 #| msgid "Pso" 3410 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3411 msgid "Pso" 3412 msgstr "સો" 3413 3414 #: kdecore/kcalendarsystemcoptic.cpp:355 3415 #, fuzzy, kde-format 3416 #| msgctxt "Coptic weekday 6 - ShortDayName" 3417 #| msgid "Psa" 3418 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3419 msgid "Psa" 3420 msgstr "સા" 3421 3422 #: kdecore/kcalendarsystemcoptic.cpp:357 3423 #, fuzzy, kde-format 3424 #| msgctxt "Coptic weekday 7 - ShortDayName" 3425 #| msgid "Tky" 3426 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3427 msgid "Tky" 3428 msgstr "કિ" 3429 3430 #: kdecore/kcalendarsystemcoptic.cpp:365 3431 #, fuzzy, kde-format 3432 #| msgctxt "Coptic weekday 1 - LongDayName" 3433 #| msgid "Pesnau" 3434 msgctxt "Coptic weekday 1 - KLocale::LongName" 3435 msgid "Pesnau" 3436 msgstr "પેસ્નાઉ" 3437 3438 #: kdecore/kcalendarsystemcoptic.cpp:367 3439 #, fuzzy, kde-format 3440 #| msgctxt "Coptic weekday 2 - LongDayName" 3441 #| msgid "Pshoment" 3442 msgctxt "Coptic weekday 2 - KLocale::LongName" 3443 msgid "Pshoment" 3444 msgstr "હોમેન્ત" 3445 3446 #: kdecore/kcalendarsystemcoptic.cpp:369 3447 #, fuzzy, kde-format 3448 #| msgctxt "Coptic weekday 3 - LongDayName" 3449 #| msgid "Peftoou" 3450 msgctxt "Coptic weekday 3 - KLocale::LongName" 3451 msgid "Peftoou" 3452 msgstr "પેફતોઉ" 3453 3454 #: kdecore/kcalendarsystemcoptic.cpp:371 3455 #, fuzzy, kde-format 3456 #| msgctxt "Coptic weekday 4 - LongDayName" 3457 #| msgid "Ptiou" 3458 msgctxt "Coptic weekday 4 - KLocale::LongName" 3459 msgid "Ptiou" 3460 msgstr "તિઓઉ" 3461 3462 #: kdecore/kcalendarsystemcoptic.cpp:373 3463 #, fuzzy, kde-format 3464 #| msgctxt "Coptic weekday 5 - LongDayName" 3465 #| msgid "Psoou" 3466 msgctxt "Coptic weekday 5 - KLocale::LongName" 3467 msgid "Psoou" 3468 msgstr "સોઉ" 3469 3470 #: kdecore/kcalendarsystemcoptic.cpp:375 3471 #, fuzzy, kde-format 3472 #| msgctxt "Coptic weekday 6 - LongDayName" 3473 #| msgid "Psabbaton" 3474 msgctxt "Coptic weekday 6 - KLocale::LongName" 3475 msgid "Psabbaton" 3476 msgstr "સાબ્બાતોન" 3477 3478 #: kdecore/kcalendarsystemcoptic.cpp:377 3479 #, fuzzy, kde-format 3480 #| msgctxt "Coptic weekday 7 - LongDayName" 3481 #| msgid "Tkyriakē" 3482 msgctxt "Coptic weekday 7 - KLocale::LongName" 3483 msgid "Tkyriakē" 3484 msgstr "કિરિએક" 3485 3486 #: kdecore/kcalendarsystemethiopian.cpp:50 3487 #, kde-format 3488 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3489 msgid "Amata Mehrat" 3490 msgstr "" 3491 3492 #: kdecore/kcalendarsystemethiopian.cpp:51 3493 #, kde-format 3494 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3495 msgid "AM" 3496 msgstr "" 3497 3498 #: kdecore/kcalendarsystemethiopian.cpp:52 3499 #, kde-format 3500 msgctxt "" 3501 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3502 msgid "%Ey %EC" 3503 msgstr "" 3504 3505 #: kdecore/kcalendarsystemethiopian.cpp:66 3506 #, kde-format 3507 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3508 msgid "M" 3509 msgstr "" 3510 3511 #: kdecore/kcalendarsystemethiopian.cpp:68 3512 #, kde-format 3513 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3514 msgid "T" 3515 msgstr "" 3516 3517 #: kdecore/kcalendarsystemethiopian.cpp:70 3518 #, kde-format 3519 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3520 msgid "H" 3521 msgstr "" 3522 3523 #: kdecore/kcalendarsystemethiopian.cpp:72 3524 #, kde-format 3525 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3526 msgid "T" 3527 msgstr "" 3528 3529 #: kdecore/kcalendarsystemethiopian.cpp:74 3530 #, kde-format 3531 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3532 msgid "T" 3533 msgstr "" 3534 3535 #: kdecore/kcalendarsystemethiopian.cpp:76 3536 #, kde-format 3537 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3538 msgid "Y" 3539 msgstr "" 3540 3541 #: kdecore/kcalendarsystemethiopian.cpp:78 3542 #, kde-format 3543 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3544 msgid "M" 3545 msgstr "" 3546 3547 #: kdecore/kcalendarsystemethiopian.cpp:80 3548 #, kde-format 3549 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3550 msgid "M" 3551 msgstr "" 3552 3553 #: kdecore/kcalendarsystemethiopian.cpp:82 3554 #, kde-format 3555 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3556 msgid "G" 3557 msgstr "" 3558 3559 #: kdecore/kcalendarsystemethiopian.cpp:84 3560 #, kde-format 3561 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3562 msgid "S" 3563 msgstr "" 3564 3565 #: kdecore/kcalendarsystemethiopian.cpp:86 3566 #, kde-format 3567 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3568 msgid "H" 3569 msgstr "" 3570 3571 #: kdecore/kcalendarsystemethiopian.cpp:88 3572 #, kde-format 3573 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3574 msgid "N" 3575 msgstr "" 3576 3577 #: kdecore/kcalendarsystemethiopian.cpp:90 3578 #, kde-format 3579 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3580 msgid "P" 3581 msgstr "" 3582 3583 #: kdecore/kcalendarsystemethiopian.cpp:99 3584 #, fuzzy, kde-format 3585 #| msgctxt "Coptic month 6 - ShortNamePossessive" 3586 #| msgid "of Mes" 3587 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3588 msgid "of Mes" 3589 msgstr "મેસ નું" 3590 3591 #: kdecore/kcalendarsystemethiopian.cpp:101 3592 #, fuzzy, kde-format 3593 #| msgctxt "Ethiopian month 2 - ShortNamePossessive" 3594 #| msgid "of Teq" 3595 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3596 msgid "of Teq" 3597 msgstr "તેકનું" 3598 3599 #: kdecore/kcalendarsystemethiopian.cpp:103 3600 #, fuzzy, kde-format 3601 #| msgctxt "Ethiopian month 3 - ShortNamePossessive" 3602 #| msgid "of Hed" 3603 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3604 msgid "of Hed" 3605 msgstr "હેડનું" 3606 3607 #: kdecore/kcalendarsystemethiopian.cpp:105 3608 #, fuzzy, kde-format 3609 #| msgctxt "Ethiopian month 4 - ShortNamePossessive" 3610 #| msgid "of Tah" 3611 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3612 msgid "of Tah" 3613 msgstr "તાહનું" 3614 3615 #: kdecore/kcalendarsystemethiopian.cpp:107 3616 #, fuzzy, kde-format 3617 #| msgctxt "Ethiopian month 5 - ShortNamePossessive" 3618 #| msgid "of Ter" 3619 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3620 msgid "of Ter" 3621 msgstr "તિરનું" 3622 3623 #: kdecore/kcalendarsystemethiopian.cpp:109 3624 #, fuzzy, kde-format 3625 #| msgctxt "Ethiopian month 6 - ShortNamePossessive" 3626 #| msgid "of Yak" 3627 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3628 msgid "of Yak" 3629 msgstr "યાકનું" 3630 3631 #: kdecore/kcalendarsystemethiopian.cpp:111 3632 #, fuzzy, kde-format 3633 #| msgctxt "Ethiopian month 7 - ShortNamePossessive" 3634 #| msgid "of Mag" 3635 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3636 msgid "of Mag" 3637 msgstr "માગનું" 3638 3639 #: kdecore/kcalendarsystemethiopian.cpp:113 3640 #, fuzzy, kde-format 3641 #| msgctxt "Ethiopian month 8 - ShortNamePossessive" 3642 #| msgid "of Miy" 3643 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3644 msgid "of Miy" 3645 msgstr "મેનું" 3646 3647 #: kdecore/kcalendarsystemethiopian.cpp:115 3648 #, fuzzy, kde-format 3649 #| msgctxt "Ethiopian month 9 - ShortNamePossessive" 3650 #| msgid "of Gen" 3651 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3652 msgid "of Gen" 3653 msgstr "જેનનું" 3654 3655 #: kdecore/kcalendarsystemethiopian.cpp:117 3656 #, fuzzy, kde-format 3657 #| msgctxt "Ethiopian month 10 - ShortNamePossessive" 3658 #| msgid "of Sen" 3659 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3660 msgid "of Sen" 3661 msgstr "સેનનું" 3662 3663 #: kdecore/kcalendarsystemethiopian.cpp:119 3664 #, fuzzy, kde-format 3665 #| msgctxt "Ethiopian month 11 - ShortNamePossessive" 3666 #| msgid "of Ham" 3667 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3668 msgid "of Ham" 3669 msgstr "હેમનું" 3670 3671 #: kdecore/kcalendarsystemethiopian.cpp:121 3672 #, fuzzy, kde-format 3673 #| msgctxt "Ethiopian month 12 - ShortNamePossessive" 3674 #| msgid "of Neh" 3675 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3676 msgid "of Neh" 3677 msgstr "નેહનું" 3678 3679 #: kdecore/kcalendarsystemethiopian.cpp:123 3680 #, fuzzy, kde-format 3681 #| msgctxt "Ethiopian month 13 - ShortNamePossessive" 3682 #| msgid "of Pag" 3683 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3684 msgid "of Pag" 3685 msgstr "પેગનું" 3686 3687 #: kdecore/kcalendarsystemethiopian.cpp:132 3688 #, fuzzy, kde-format 3689 #| msgctxt "Coptic month 6 - ShortName" 3690 #| msgid "Mes" 3691 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3692 msgid "Mes" 3693 msgstr "મેસ" 3694 3695 #: kdecore/kcalendarsystemethiopian.cpp:134 3696 #, fuzzy, kde-format 3697 #| msgctxt "Ethiopian month 2 - ShortName" 3698 #| msgid "Teq" 3699 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3700 msgid "Teq" 3701 msgstr "તેક" 3702 3703 #: kdecore/kcalendarsystemethiopian.cpp:136 3704 #, fuzzy, kde-format 3705 #| msgctxt "Ethiopian month 3 - ShortName" 3706 #| msgid "Hed" 3707 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3708 msgid "Hed" 3709 msgstr "હેડ" 3710 3711 #: kdecore/kcalendarsystemethiopian.cpp:138 3712 #, fuzzy, kde-format 3713 #| msgctxt "Ethiopian month 4 - ShortName" 3714 #| msgid "Tah" 3715 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3716 msgid "Tah" 3717 msgstr "તાહ" 3718 3719 #: kdecore/kcalendarsystemethiopian.cpp:140 3720 #, fuzzy, kde-format 3721 #| msgctxt "Ethiopian month 5 - ShortName" 3722 #| msgid "Ter" 3723 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3724 msgid "Ter" 3725 msgstr "તેર" 3726 3727 #: kdecore/kcalendarsystemethiopian.cpp:142 3728 #, fuzzy, kde-format 3729 #| msgctxt "Ethiopian month 6 - ShortName" 3730 #| msgid "Yak" 3731 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3732 msgid "Yak" 3733 msgstr "યાક" 3734 3735 #: kdecore/kcalendarsystemethiopian.cpp:144 3736 #, fuzzy, kde-format 3737 #| msgctxt "Ethiopian month 7 - ShortName" 3738 #| msgid "Mag" 3739 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3740 msgid "Mag" 3741 msgstr "મેગ" 3742 3743 #: kdecore/kcalendarsystemethiopian.cpp:146 3744 #, fuzzy, kde-format 3745 #| msgctxt "Ethiopian month 8 - ShortName" 3746 #| msgid "Miy" 3747 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3748 msgid "Miy" 3749 msgstr "મિય" 3750 3751 #: kdecore/kcalendarsystemethiopian.cpp:148 3752 #, fuzzy, kde-format 3753 #| msgctxt "Ethiopian month 9 - ShortName" 3754 #| msgid "Gen" 3755 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3756 msgid "Gen" 3757 msgstr "જેન" 3758 3759 #: kdecore/kcalendarsystemethiopian.cpp:150 3760 #, fuzzy, kde-format 3761 #| msgctxt "Ethiopian month 10 - ShortName" 3762 #| msgid "Sen" 3763 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3764 msgid "Sen" 3765 msgstr "સેન" 3766 3767 #: kdecore/kcalendarsystemethiopian.cpp:152 3768 #, fuzzy, kde-format 3769 #| msgctxt "Ethiopian month 11 - ShortName" 3770 #| msgid "Ham" 3771 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3772 msgid "Ham" 3773 msgstr "હેમ" 3774 3775 #: kdecore/kcalendarsystemethiopian.cpp:154 3776 #, fuzzy, kde-format 3777 #| msgctxt "Ethiopian month 12 - ShortName" 3778 #| msgid "Neh" 3779 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3780 msgid "Neh" 3781 msgstr "નેહ" 3782 3783 #: kdecore/kcalendarsystemethiopian.cpp:156 3784 #, fuzzy, kde-format 3785 #| msgctxt "Ethiopian month 13 - ShortName" 3786 #| msgid "Pag" 3787 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3788 msgid "Pag" 3789 msgstr "પેગ" 3790 3791 #: kdecore/kcalendarsystemethiopian.cpp:165 3792 #, fuzzy, kde-format 3793 #| msgctxt "Ethiopian month 1 - LongNamePossessive" 3794 #| msgid "of Meskerem" 3795 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3796 msgid "of Meskerem" 3797 msgstr "મેસ્ક્રેમનું" 3798 3799 #: kdecore/kcalendarsystemethiopian.cpp:167 3800 #, fuzzy, kde-format 3801 #| msgctxt "Ethiopian month 2 - LongNamePossessive" 3802 #| msgid "of Tequemt" 3803 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3804 msgid "of Tequemt" 3805 msgstr "તેક્મ્તનું" 3806 3807 #: kdecore/kcalendarsystemethiopian.cpp:169 3808 #, fuzzy, kde-format 3809 #| msgctxt "Ethiopian month 3 - LongNamePossessive" 3810 #| msgid "of Hedar" 3811 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3812 msgid "of Hedar" 3813 msgstr "હેડારનું" 3814 3815 #: kdecore/kcalendarsystemethiopian.cpp:171 3816 #, fuzzy, kde-format 3817 #| msgctxt "Ethiopian month 4 - LongNamePossessive" 3818 #| msgid "of Tahsas" 3819 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3820 msgid "of Tahsas" 3821 msgstr "તાહસાસનું" 3822 3823 #: kdecore/kcalendarsystemethiopian.cpp:173 3824 #, fuzzy, kde-format 3825 #| msgctxt "Ethiopian month 5 - ShortNamePossessive" 3826 #| msgid "of Ter" 3827 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3828 msgid "of Ter" 3829 msgstr "તિરનું" 3830 3831 #: kdecore/kcalendarsystemethiopian.cpp:175 3832 #, fuzzy, kde-format 3833 #| msgctxt "Ethiopian month 6 - LongNamePossessive" 3834 #| msgid "of Yakatit" 3835 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3836 msgid "of Yakatit" 3837 msgstr "યાકાતિતનું" 3838 3839 #: kdecore/kcalendarsystemethiopian.cpp:177 3840 #, fuzzy, kde-format 3841 #| msgctxt "Ethiopian month 7 - LongNamePossessive" 3842 #| msgid "of Magabit" 3843 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3844 msgid "of Magabit" 3845 msgstr "માગાબિતનું" 3846 3847 #: kdecore/kcalendarsystemethiopian.cpp:179 3848 #, fuzzy, kde-format 3849 #| msgctxt "Ethiopian month 8 - LongNamePossessive" 3850 #| msgid "of Miyazya" 3851 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3852 msgid "of Miyazya" 3853 msgstr "મિયાજ્યાનું" 3854 3855 #: kdecore/kcalendarsystemethiopian.cpp:181 3856 #, fuzzy, kde-format 3857 #| msgctxt "Ethiopian month 9 - LongNamePossessive" 3858 #| msgid "of Genbot" 3859 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3860 msgid "of Genbot" 3861 msgstr "જેનબોતનું" 3862 3863 #: kdecore/kcalendarsystemethiopian.cpp:183 3864 #, fuzzy, kde-format 3865 #| msgctxt "Ethiopian month 10 - LongNamePossessive" 3866 #| msgid "of Sene" 3867 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3868 msgid "of Sene" 3869 msgstr "સેનેનું" 3870 3871 #: kdecore/kcalendarsystemethiopian.cpp:185 3872 #, fuzzy, kde-format 3873 #| msgctxt "Ethiopian month 11 - LongNamePossessive" 3874 #| msgid "of Hamle" 3875 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3876 msgid "of Hamle" 3877 msgstr "હામ્લેનું" 3878 3879 #: kdecore/kcalendarsystemethiopian.cpp:187 3880 #, fuzzy, kde-format 3881 #| msgctxt "Ethiopian month 12 - LongNamePossessive" 3882 #| msgid "of Nehase" 3883 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3884 msgid "of Nehase" 3885 msgstr "નેહાસેનું" 3886 3887 #: kdecore/kcalendarsystemethiopian.cpp:189 3888 #, fuzzy, kde-format 3889 #| msgctxt "Ethiopian month 13 - LongNamePossessive" 3890 #| msgid "of Pagumen" 3891 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3892 msgid "of Pagumen" 3893 msgstr "પાગુમેનનું" 3894 3895 #: kdecore/kcalendarsystemethiopian.cpp:198 3896 #, fuzzy, kde-format 3897 #| msgctxt "Ethiopian month 1 - LongName" 3898 #| msgid "Meskerem" 3899 msgctxt "Ethiopian month 1 - KLocale::LongName" 3900 msgid "Meskerem" 3901 msgstr "મેસ્ક્રેમ" 3902 3903 #: kdecore/kcalendarsystemethiopian.cpp:200 3904 #, fuzzy, kde-format 3905 #| msgctxt "Ethiopian month 2 - LongName" 3906 #| msgid "Tequemt" 3907 msgctxt "Ethiopian month 2 - KLocale::LongName" 3908 msgid "Tequemt" 3909 msgstr "તેક્મત" 3910 3911 #: kdecore/kcalendarsystemethiopian.cpp:202 3912 #, fuzzy, kde-format 3913 #| msgctxt "Ethiopian month 3 - LongName" 3914 #| msgid "Hedar" 3915 msgctxt "Ethiopian month 3 - KLocale::LongName" 3916 msgid "Hedar" 3917 msgstr "હેદાર" 3918 3919 #: kdecore/kcalendarsystemethiopian.cpp:204 3920 #, fuzzy, kde-format 3921 #| msgctxt "Ethiopian month 4 - LongName" 3922 #| msgid "Tahsas" 3923 msgctxt "Ethiopian month 4 - KLocale::LongName" 3924 msgid "Tahsas" 3925 msgstr "તાહસાસ" 3926 3927 #: kdecore/kcalendarsystemethiopian.cpp:206 3928 #, fuzzy, kde-format 3929 #| msgctxt "Ethiopian month 5 - ShortName" 3930 #| msgid "Ter" 3931 msgctxt "Ethiopian month 5 - KLocale::LongName" 3932 msgid "Ter" 3933 msgstr "તેર" 3934 3935 #: kdecore/kcalendarsystemethiopian.cpp:208 3936 #, fuzzy, kde-format 3937 #| msgctxt "Ethiopian month 6 - LongName" 3938 #| msgid "Yakatit" 3939 msgctxt "Ethiopian month 6 - KLocale::LongName" 3940 msgid "Yakatit" 3941 msgstr "યાકાતિત" 3942 3943 #: kdecore/kcalendarsystemethiopian.cpp:210 3944 #, fuzzy, kde-format 3945 #| msgctxt "Ethiopian month 7 - LongName" 3946 #| msgid "Magabit" 3947 msgctxt "Ethiopian month 7 - KLocale::LongName" 3948 msgid "Magabit" 3949 msgstr "મેગાબિત" 3950 3951 #: kdecore/kcalendarsystemethiopian.cpp:212 3952 #, fuzzy, kde-format 3953 #| msgctxt "Ethiopian month 8 - LongName" 3954 #| msgid "Miyazya" 3955 msgctxt "Ethiopian month 8 - KLocale::LongName" 3956 msgid "Miyazya" 3957 msgstr "મિયાઝ્યા" 3958 3959 #: kdecore/kcalendarsystemethiopian.cpp:214 3960 #, fuzzy, kde-format 3961 #| msgctxt "Ethiopian month 9 - LongName" 3962 #| msgid "Genbot" 3963 msgctxt "Ethiopian month 9 - KLocale::LongName" 3964 msgid "Genbot" 3965 msgstr "ગેનબોત" 3966 3967 #: kdecore/kcalendarsystemethiopian.cpp:216 3968 #, fuzzy, kde-format 3969 #| msgctxt "Ethiopian month 10 - LongName" 3970 #| msgid "Sene" 3971 msgctxt "Ethiopian month 10 - KLocale::LongName" 3972 msgid "Sene" 3973 msgstr "સેને" 3974 3975 #: kdecore/kcalendarsystemethiopian.cpp:218 3976 #, fuzzy, kde-format 3977 #| msgctxt "Ethiopian month 11 - LongName" 3978 #| msgid "Hamle" 3979 msgctxt "Ethiopian month 11 - KLocale::LongName" 3980 msgid "Hamle" 3981 msgstr "હામ્લે" 3982 3983 #: kdecore/kcalendarsystemethiopian.cpp:220 3984 #, fuzzy, kde-format 3985 #| msgctxt "Ethiopian month 12 - LongName" 3986 #| msgid "Nehase" 3987 msgctxt "Ethiopian month 12 - KLocale::LongName" 3988 msgid "Nehase" 3989 msgstr "નેહાસે" 3990 3991 #: kdecore/kcalendarsystemethiopian.cpp:222 3992 #, fuzzy, kde-format 3993 #| msgctxt "Ethiopian month 13 - LongName" 3994 #| msgid "Pagumen" 3995 msgctxt "Ethiopian month 13 - KLocale::LongName" 3996 msgid "Pagumen" 3997 msgstr "પાગુમેન" 3998 3999 #: kdecore/kcalendarsystemethiopian.cpp:236 4000 #, kde-format 4001 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 4002 msgid "S" 4003 msgstr "" 4004 4005 #: kdecore/kcalendarsystemethiopian.cpp:238 4006 #, kde-format 4007 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 4008 msgid "M" 4009 msgstr "" 4010 4011 #: kdecore/kcalendarsystemethiopian.cpp:240 4012 #, kde-format 4013 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 4014 msgid "R" 4015 msgstr "" 4016 4017 #: kdecore/kcalendarsystemethiopian.cpp:242 4018 #, kde-format 4019 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 4020 msgid "H" 4021 msgstr "" 4022 4023 #: kdecore/kcalendarsystemethiopian.cpp:244 4024 #, fuzzy, kde-format 4025 #| msgid "Av" 4026 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 4027 msgid "A" 4028 msgstr "અવ" 4029 4030 #: kdecore/kcalendarsystemethiopian.cpp:246 4031 #, kde-format 4032 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 4033 msgid "Q" 4034 msgstr "" 4035 4036 #: kdecore/kcalendarsystemethiopian.cpp:248 4037 #, kde-format 4038 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 4039 msgid "E" 4040 msgstr "" 4041 4042 #: kdecore/kcalendarsystemethiopian.cpp:257 4043 #, fuzzy, kde-format 4044 #| msgctxt "Ethiopian weekday 1 - ShortDayName" 4045 #| msgid "Seg" 4046 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 4047 msgid "Seg" 4048 msgstr "સેગ" 4049 4050 #: kdecore/kcalendarsystemethiopian.cpp:259 4051 #, fuzzy, kde-format 4052 #| msgctxt "Ethiopian weekday 2 - ShortDayName" 4053 #| msgid "Mak" 4054 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 4055 msgid "Mak" 4056 msgstr "માક" 4057 4058 #: kdecore/kcalendarsystemethiopian.cpp:261 4059 #, fuzzy, kde-format 4060 #| msgctxt "Ethiopian weekday 3 - ShortDayName" 4061 #| msgid "Rob" 4062 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 4063 msgid "Rob" 4064 msgstr "રોબ" 4065 4066 #: kdecore/kcalendarsystemethiopian.cpp:263 4067 #, fuzzy, kde-format 4068 #| msgctxt "Ethiopian month 11 - ShortName" 4069 #| msgid "Ham" 4070 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 4071 msgid "Ham" 4072 msgstr "હેમ" 4073 4074 #: kdecore/kcalendarsystemethiopian.cpp:265 4075 #, fuzzy, kde-format 4076 #| msgid "Arb" 4077 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 4078 msgid "Arb" 4079 msgstr "અરબ" 4080 4081 #: kdecore/kcalendarsystemethiopian.cpp:267 4082 #, fuzzy, kde-format 4083 #| msgctxt "Ethiopian weekday 6 - ShortDayName" 4084 #| msgid "Qed" 4085 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 4086 msgid "Qed" 4087 msgstr "કુડ" 4088 4089 #: kdecore/kcalendarsystemethiopian.cpp:269 4090 #, fuzzy, kde-format 4091 #| msgctxt "Ethiopian weekday 7 - ShortDayName" 4092 #| msgid "Ehu" 4093 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 4094 msgid "Ehu" 4095 msgstr "ઇહુ" 4096 4097 #: kdecore/kcalendarsystemethiopian.cpp:276 4098 #, fuzzy, kde-format 4099 #| msgctxt "Ethiopian weekday 1 - LongDayName" 4100 #| msgid "Segno" 4101 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 4102 msgid "Segno" 4103 msgstr "સેગ્નો" 4104 4105 #: kdecore/kcalendarsystemethiopian.cpp:278 4106 #, fuzzy, kde-format 4107 #| msgctxt "Ethiopian weekday 2 - LongDayName" 4108 #| msgid "Maksegno" 4109 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 4110 msgid "Maksegno" 4111 msgstr "માકસેગ્નો" 4112 4113 #: kdecore/kcalendarsystemethiopian.cpp:280 4114 #, fuzzy, kde-format 4115 #| msgctxt "Ethiopian weekday 3 - ShortDayName" 4116 #| msgid "Rob" 4117 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 4118 msgid "Rob" 4119 msgstr "રોબ" 4120 4121 #: kdecore/kcalendarsystemethiopian.cpp:282 4122 #, fuzzy, kde-format 4123 #| msgctxt "Ethiopian weekday 4 - LongDayName" 4124 #| msgid "Hamus" 4125 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 4126 msgid "Hamus" 4127 msgstr "હામુસ" 4128 4129 #: kdecore/kcalendarsystemethiopian.cpp:284 4130 #, fuzzy, kde-format 4131 #| msgid "Arb" 4132 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 4133 msgid "Arb" 4134 msgstr "અરબ" 4135 4136 #: kdecore/kcalendarsystemethiopian.cpp:286 4137 #, fuzzy, kde-format 4138 #| msgctxt "Ethiopian weekday 6 - LongDayName" 4139 #| msgid "Qedame" 4140 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 4141 msgid "Qedame" 4142 msgstr "કુદામે" 4143 4144 #: kdecore/kcalendarsystemethiopian.cpp:288 4145 #, fuzzy, kde-format 4146 #| msgctxt "Ethiopian weekday 7 - LongDayName" 4147 #| msgid "Ehud" 4148 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 4149 msgid "Ehud" 4150 msgstr "હુડ" 4151 4152 #: kdecore/kcalendarsystemgregorian.cpp:53 4153 #, kde-format 4154 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 4155 msgid "Before Common Era" 4156 msgstr "" 4157 4158 #: kdecore/kcalendarsystemgregorian.cpp:54 4159 #, kde-format 4160 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 4161 msgid "BCE" 4162 msgstr "" 4163 4164 #: kdecore/kcalendarsystemgregorian.cpp:56 4165 #, kde-format 4166 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 4167 msgid "Before Christ" 4168 msgstr "" 4169 4170 #: kdecore/kcalendarsystemgregorian.cpp:57 4171 #, kde-format 4172 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 4173 msgid "BC" 4174 msgstr "" 4175 4176 #: kdecore/kcalendarsystemgregorian.cpp:59 4177 #, kde-format 4178 msgctxt "" 4179 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 4180 msgid "%Ey %EC" 4181 msgstr "" 4182 4183 #: kdecore/kcalendarsystemgregorian.cpp:63 4184 #, kde-format 4185 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 4186 msgid "Common Era" 4187 msgstr "" 4188 4189 #: kdecore/kcalendarsystemgregorian.cpp:64 4190 #, kde-format 4191 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 4192 msgid "CE" 4193 msgstr "" 4194 4195 #: kdecore/kcalendarsystemgregorian.cpp:66 4196 #: kdecore/kcalendarsystemjapanese.cpp:57 4197 #, kde-format 4198 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 4199 msgid "Anno Domini" 4200 msgstr "" 4201 4202 #: kdecore/kcalendarsystemgregorian.cpp:67 4203 #: kdecore/kcalendarsystemjapanese.cpp:58 4204 #, kde-format 4205 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 4206 msgid "AD" 4207 msgstr "" 4208 4209 #: kdecore/kcalendarsystemgregorian.cpp:69 4210 #: kdecore/kcalendarsystemjapanese.cpp:59 4211 #, kde-format 4212 msgctxt "" 4213 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 4214 msgid "%Ey %EC" 4215 msgstr "" 4216 4217 #: kdecore/kcalendarsystemgregorian.cpp:138 4218 #, kde-format 4219 msgctxt "Gregorian month 1 - KLocale::NarrowName" 4220 msgid "J" 4221 msgstr "" 4222 4223 #: kdecore/kcalendarsystemgregorian.cpp:140 4224 #, kde-format 4225 msgctxt "Gregorian month 2 - KLocale::NarrowName" 4226 msgid "F" 4227 msgstr "" 4228 4229 #: kdecore/kcalendarsystemgregorian.cpp:142 4230 #, kde-format 4231 msgctxt "Gregorian month 3 - KLocale::NarrowName" 4232 msgid "M" 4233 msgstr "" 4234 4235 #: kdecore/kcalendarsystemgregorian.cpp:144 4236 #, fuzzy, kde-format 4237 #| msgid "Av" 4238 msgctxt "Gregorian month 4 - KLocale::NarrowName" 4239 msgid "A" 4240 msgstr "અવ" 4241 4242 #: kdecore/kcalendarsystemgregorian.cpp:146 4243 #, kde-format 4244 msgctxt "Gregorian month 5 - KLocale::NarrowName" 4245 msgid "M" 4246 msgstr "" 4247 4248 #: kdecore/kcalendarsystemgregorian.cpp:148 4249 #, kde-format 4250 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4251 msgid "J" 4252 msgstr "" 4253 4254 #: kdecore/kcalendarsystemgregorian.cpp:150 4255 #, kde-format 4256 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4257 msgid "J" 4258 msgstr "" 4259 4260 #: kdecore/kcalendarsystemgregorian.cpp:152 4261 #, fuzzy, kde-format 4262 #| msgid "Av" 4263 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4264 msgid "A" 4265 msgstr "અવ" 4266 4267 #: kdecore/kcalendarsystemgregorian.cpp:154 4268 #, kde-format 4269 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4270 msgid "S" 4271 msgstr "" 4272 4273 #: kdecore/kcalendarsystemgregorian.cpp:156 4274 #, kde-format 4275 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4276 msgid "O" 4277 msgstr "" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:158 4280 #, kde-format 4281 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4282 msgid "N" 4283 msgstr "" 4284 4285 #: kdecore/kcalendarsystemgregorian.cpp:160 4286 #, kde-format 4287 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4288 msgid "D" 4289 msgstr "" 4290 4291 #: kdecore/kcalendarsystemgregorian.cpp:169 4292 #, fuzzy, kde-format 4293 #| msgctxt "of January" 4294 #| msgid "of Jan" 4295 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4296 msgid "of Jan" 4297 msgstr "જાન નું" 4298 4299 #: kdecore/kcalendarsystemgregorian.cpp:171 4300 #, fuzzy, kde-format 4301 #| msgctxt "of February" 4302 #| msgid "of Feb" 4303 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4304 msgid "of Feb" 4305 msgstr "ફેબ નું" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:173 4308 #, fuzzy, kde-format 4309 #| msgctxt "of March" 4310 #| msgid "of Mar" 4311 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4312 msgid "of Mar" 4313 msgstr "માર્ચ નું" 4314 4315 #: kdecore/kcalendarsystemgregorian.cpp:175 4316 #, fuzzy, kde-format 4317 #| msgctxt "of April" 4318 #| msgid "of Apr" 4319 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4320 msgid "of Apr" 4321 msgstr "એપ્રિલ નું" 4322 4323 #: kdecore/kcalendarsystemgregorian.cpp:177 4324 #, fuzzy, kde-format 4325 #| msgctxt "of May short" 4326 #| msgid "of May" 4327 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4328 msgid "of May" 4329 msgstr "મે નું" 4330 4331 #: kdecore/kcalendarsystemgregorian.cpp:179 4332 #, fuzzy, kde-format 4333 #| msgctxt "of June" 4334 #| msgid "of Jun" 4335 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4336 msgid "of Jun" 4337 msgstr "જુન નું" 4338 4339 #: kdecore/kcalendarsystemgregorian.cpp:181 4340 #, fuzzy, kde-format 4341 #| msgctxt "of July" 4342 #| msgid "of Jul" 4343 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4344 msgid "of Jul" 4345 msgstr "જુલ નું" 4346 4347 #: kdecore/kcalendarsystemgregorian.cpp:183 4348 #, fuzzy, kde-format 4349 #| msgctxt "of August" 4350 #| msgid "of Aug" 4351 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4352 msgid "of Aug" 4353 msgstr "ઓગ નું" 4354 4355 #: kdecore/kcalendarsystemgregorian.cpp:185 4356 #, fuzzy, kde-format 4357 #| msgctxt "of September" 4358 #| msgid "of Sep" 4359 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4360 msgid "of Sep" 4361 msgstr "સપ્ટે નું" 4362 4363 #: kdecore/kcalendarsystemgregorian.cpp:187 4364 #, fuzzy, kde-format 4365 #| msgctxt "of October" 4366 #| msgid "of Oct" 4367 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4368 msgid "of Oct" 4369 msgstr "ઓક્ટ નું" 4370 4371 #: kdecore/kcalendarsystemgregorian.cpp:189 4372 #, fuzzy, kde-format 4373 #| msgctxt "of November" 4374 #| msgid "of Nov" 4375 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4376 msgid "of Nov" 4377 msgstr "નવે નું" 4378 4379 #: kdecore/kcalendarsystemgregorian.cpp:191 4380 #, fuzzy, kde-format 4381 #| msgctxt "of December" 4382 #| msgid "of Dec" 4383 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4384 msgid "of Dec" 4385 msgstr "ડિસે નું" 4386 4387 #: kdecore/kcalendarsystemgregorian.cpp:200 4388 #, fuzzy, kde-format 4389 #| msgctxt "January" 4390 #| msgid "Jan" 4391 msgctxt "Gregorian month 1 - KLocale::ShortName" 4392 msgid "Jan" 4393 msgstr "જાન" 4394 4395 #: kdecore/kcalendarsystemgregorian.cpp:202 4396 #, fuzzy, kde-format 4397 #| msgctxt "February" 4398 #| msgid "Feb" 4399 msgctxt "Gregorian month 2 - KLocale::ShortName" 4400 msgid "Feb" 4401 msgstr "ફેબ્રુ" 4402 4403 #: kdecore/kcalendarsystemgregorian.cpp:204 4404 #, fuzzy, kde-format 4405 #| msgctxt "March" 4406 #| msgid "Mar" 4407 msgctxt "Gregorian month 3 - KLocale::ShortName" 4408 msgid "Mar" 4409 msgstr "માર્ચ" 4410 4411 #: kdecore/kcalendarsystemgregorian.cpp:206 4412 #, fuzzy, kde-format 4413 #| msgctxt "April" 4414 #| msgid "Apr" 4415 msgctxt "Gregorian month 4 - KLocale::ShortName" 4416 msgid "Apr" 4417 msgstr "એપ્ર" 4418 4419 #: kdecore/kcalendarsystemgregorian.cpp:208 4420 #, fuzzy, kde-format 4421 #| msgctxt "May short" 4422 #| msgid "May" 4423 msgctxt "Gregorian month 5 - KLocale::ShortName" 4424 msgid "May" 4425 msgstr "મે" 4426 4427 #: kdecore/kcalendarsystemgregorian.cpp:210 4428 #, fuzzy, kde-format 4429 #| msgctxt "June" 4430 #| msgid "Jun" 4431 msgctxt "Gregorian month 6 - KLocale::ShortName" 4432 msgid "Jun" 4433 msgstr "જુન" 4434 4435 #: kdecore/kcalendarsystemgregorian.cpp:212 4436 #, fuzzy, kde-format 4437 #| msgctxt "July" 4438 #| msgid "Jul" 4439 msgctxt "Gregorian month 7 - KLocale::ShortName" 4440 msgid "Jul" 4441 msgstr "જુલ" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:214 4444 #, fuzzy, kde-format 4445 #| msgctxt "August" 4446 #| msgid "Aug" 4447 msgctxt "Gregorian month 8 - KLocale::ShortName" 4448 msgid "Aug" 4449 msgstr "ઓગ" 4450 4451 #: kdecore/kcalendarsystemgregorian.cpp:216 4452 #, fuzzy, kde-format 4453 #| msgctxt "September" 4454 #| msgid "Sep" 4455 msgctxt "Gregorian month 9 - KLocale::ShortName" 4456 msgid "Sep" 4457 msgstr "સપ્ટે" 4458 4459 #: kdecore/kcalendarsystemgregorian.cpp:218 4460 #, fuzzy, kde-format 4461 #| msgctxt "October" 4462 #| msgid "Oct" 4463 msgctxt "Gregorian month 10 - KLocale::ShortName" 4464 msgid "Oct" 4465 msgstr "ઓક્ટ" 4466 4467 #: kdecore/kcalendarsystemgregorian.cpp:220 4468 #, fuzzy, kde-format 4469 #| msgctxt "November" 4470 #| msgid "Nov" 4471 msgctxt "Gregorian month 11 - KLocale::ShortName" 4472 msgid "Nov" 4473 msgstr "નવે" 4474 4475 #: kdecore/kcalendarsystemgregorian.cpp:222 4476 #, fuzzy, kde-format 4477 #| msgctxt "December" 4478 #| msgid "Dec" 4479 msgctxt "Gregorian month 12 - KLocale::ShortName" 4480 msgid "Dec" 4481 msgstr "ડિસે" 4482 4483 #: kdecore/kcalendarsystemgregorian.cpp:231 4484 #, fuzzy, kde-format 4485 #| msgid "of January" 4486 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4487 msgid "of January" 4488 msgstr "જાન્યુઆરી નું" 4489 4490 #: kdecore/kcalendarsystemgregorian.cpp:233 4491 #, fuzzy, kde-format 4492 #| msgid "of February" 4493 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4494 msgid "of February" 4495 msgstr "ફેબ્રુઆરી નું" 4496 4497 #: kdecore/kcalendarsystemgregorian.cpp:235 4498 #, fuzzy, kde-format 4499 #| msgid "of March" 4500 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4501 msgid "of March" 4502 msgstr "માર્ચ નું" 4503 4504 #: kdecore/kcalendarsystemgregorian.cpp:237 4505 #, fuzzy, kde-format 4506 #| msgid "of April" 4507 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4508 msgid "of April" 4509 msgstr "એપ્રિલ નું" 4510 4511 #: kdecore/kcalendarsystemgregorian.cpp:239 4512 #, fuzzy, kde-format 4513 #| msgctxt "of May short" 4514 #| msgid "of May" 4515 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4516 msgid "of May" 4517 msgstr "મે નું" 4518 4519 #: kdecore/kcalendarsystemgregorian.cpp:241 4520 #, fuzzy, kde-format 4521 #| msgid "of June" 4522 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4523 msgid "of June" 4524 msgstr "જૂન નું" 4525 4526 #: kdecore/kcalendarsystemgregorian.cpp:243 4527 #, fuzzy, kde-format 4528 #| msgid "of July" 4529 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4530 msgid "of July" 4531 msgstr "જુલાઈ નું" 4532 4533 #: kdecore/kcalendarsystemgregorian.cpp:245 4534 #, fuzzy, kde-format 4535 #| msgid "of August" 4536 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4537 msgid "of August" 4538 msgstr "ઓગસ્ટ નું" 4539 4540 #: kdecore/kcalendarsystemgregorian.cpp:247 4541 #, fuzzy, kde-format 4542 #| msgid "of September" 4543 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4544 msgid "of September" 4545 msgstr "સપ્ટેમ્બર નું" 4546 4547 #: kdecore/kcalendarsystemgregorian.cpp:249 4548 #, fuzzy, kde-format 4549 #| msgid "of October" 4550 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4551 msgid "of October" 4552 msgstr "ઓક્ટોબર નું" 4553 4554 #: kdecore/kcalendarsystemgregorian.cpp:251 4555 #, fuzzy, kde-format 4556 #| msgid "of November" 4557 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4558 msgid "of November" 4559 msgstr "નવેમ્બર નું" 4560 4561 #: kdecore/kcalendarsystemgregorian.cpp:253 4562 #, fuzzy, kde-format 4563 #| msgid "of December" 4564 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4565 msgid "of December" 4566 msgstr "ડિસેમ્બર નું" 4567 4568 #: kdecore/kcalendarsystemgregorian.cpp:262 4569 #, fuzzy, kde-format 4570 #| msgid "January" 4571 msgctxt "Gregorian month 1 - KLocale::LongName" 4572 msgid "January" 4573 msgstr "જાન્યુઆરી" 4574 4575 #: kdecore/kcalendarsystemgregorian.cpp:264 4576 #, fuzzy, kde-format 4577 #| msgid "February" 4578 msgctxt "Gregorian month 2 - KLocale::LongName" 4579 msgid "February" 4580 msgstr "ફેબ્રુઆરી" 4581 4582 #: kdecore/kcalendarsystemgregorian.cpp:266 4583 #, fuzzy, kde-format 4584 #| msgctxt "March long" 4585 #| msgid "March" 4586 msgctxt "Gregorian month 3 - KLocale::LongName" 4587 msgid "March" 4588 msgstr "માર્ચ" 4589 4590 #: kdecore/kcalendarsystemgregorian.cpp:268 4591 #, fuzzy, kde-format 4592 #| msgid "April" 4593 msgctxt "Gregorian month 4 - KLocale::LongName" 4594 msgid "April" 4595 msgstr "એપ્રિલ" 4596 4597 #: kdecore/kcalendarsystemgregorian.cpp:270 4598 #, fuzzy, kde-format 4599 #| msgctxt "May short" 4600 #| msgid "May" 4601 msgctxt "Gregorian month 5 - KLocale::LongName" 4602 msgid "May" 4603 msgstr "મે" 4604 4605 #: kdecore/kcalendarsystemgregorian.cpp:272 4606 #, fuzzy, kde-format 4607 #| msgid "June" 4608 msgctxt "Gregorian month 6 - KLocale::LongName" 4609 msgid "June" 4610 msgstr "જૂન" 4611 4612 #: kdecore/kcalendarsystemgregorian.cpp:274 4613 #, fuzzy, kde-format 4614 #| msgid "July" 4615 msgctxt "Gregorian month 7 - KLocale::LongName" 4616 msgid "July" 4617 msgstr "જૂલાઈ" 4618 4619 #: kdecore/kcalendarsystemgregorian.cpp:276 4620 #, fuzzy, kde-format 4621 #| msgctxt "August long" 4622 #| msgid "August" 4623 msgctxt "Gregorian month 8 - KLocale::LongName" 4624 msgid "August" 4625 msgstr "ઓગસ્ટ" 4626 4627 #: kdecore/kcalendarsystemgregorian.cpp:278 4628 #, fuzzy, kde-format 4629 #| msgid "September" 4630 msgctxt "Gregorian month 9 - KLocale::LongName" 4631 msgid "September" 4632 msgstr "સપ્ટેમ્બર" 4633 4634 #: kdecore/kcalendarsystemgregorian.cpp:280 4635 #, fuzzy, kde-format 4636 #| msgid "October" 4637 msgctxt "Gregorian month 10 - KLocale::LongName" 4638 msgid "October" 4639 msgstr "ઓક્ટોબર" 4640 4641 #: kdecore/kcalendarsystemgregorian.cpp:282 4642 #, fuzzy, kde-format 4643 #| msgid "November" 4644 msgctxt "Gregorian month 11 - KLocale::LongName" 4645 msgid "November" 4646 msgstr "નવેમ્બર" 4647 4648 #: kdecore/kcalendarsystemgregorian.cpp:284 4649 #, fuzzy, kde-format 4650 #| msgid "December" 4651 msgctxt "Gregorian month 12 - KLocale::LongName" 4652 msgid "December" 4653 msgstr "ડિસેમ્બર" 4654 4655 #: kdecore/kcalendarsystemgregorian.cpp:297 4656 #: kdecore/kcalendarsystemhebrew.cpp:807 4657 #, kde-format 4658 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4659 msgid "M" 4660 msgstr "" 4661 4662 #: kdecore/kcalendarsystemgregorian.cpp:299 4663 #: kdecore/kcalendarsystemhebrew.cpp:809 4664 #, kde-format 4665 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4666 msgid "T" 4667 msgstr "" 4668 4669 #: kdecore/kcalendarsystemgregorian.cpp:301 4670 #: kdecore/kcalendarsystemhebrew.cpp:811 4671 #, kde-format 4672 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4673 msgid "W" 4674 msgstr "" 4675 4676 #: kdecore/kcalendarsystemgregorian.cpp:303 4677 #: kdecore/kcalendarsystemhebrew.cpp:813 4678 #, kde-format 4679 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4680 msgid "T" 4681 msgstr "" 4682 4683 #: kdecore/kcalendarsystemgregorian.cpp:305 4684 #: kdecore/kcalendarsystemhebrew.cpp:815 4685 #, kde-format 4686 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4687 msgid "F" 4688 msgstr "" 4689 4690 #: kdecore/kcalendarsystemgregorian.cpp:307 4691 #: kdecore/kcalendarsystemhebrew.cpp:817 4692 #, kde-format 4693 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4694 msgid "S" 4695 msgstr "" 4696 4697 #: kdecore/kcalendarsystemgregorian.cpp:309 4698 #: kdecore/kcalendarsystemhebrew.cpp:819 4699 #, kde-format 4700 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4701 msgid "S" 4702 msgstr "" 4703 4704 #: kdecore/kcalendarsystemgregorian.cpp:318 4705 #: kdecore/kcalendarsystemhebrew.cpp:828 4706 #, fuzzy, kde-format 4707 #| msgctxt "Monday" 4708 #| msgid "Mon" 4709 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4710 msgid "Mon" 4711 msgstr "સોમ" 4712 4713 #: kdecore/kcalendarsystemgregorian.cpp:320 4714 #: kdecore/kcalendarsystemhebrew.cpp:830 4715 #, fuzzy, kde-format 4716 #| msgctxt "Tuesday" 4717 #| msgid "Tue" 4718 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4719 msgid "Tue" 4720 msgstr "મંગળ" 4721 4722 #: kdecore/kcalendarsystemgregorian.cpp:322 4723 #: kdecore/kcalendarsystemhebrew.cpp:832 4724 #, fuzzy, kde-format 4725 #| msgctxt "Wednesday" 4726 #| msgid "Wed" 4727 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4728 msgid "Wed" 4729 msgstr "બુધ" 4730 4731 #: kdecore/kcalendarsystemgregorian.cpp:324 4732 #: kdecore/kcalendarsystemhebrew.cpp:834 4733 #, fuzzy, kde-format 4734 #| msgctxt "Thursday" 4735 #| msgid "Thu" 4736 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4737 msgid "Thu" 4738 msgstr "ગુરુ" 4739 4740 #: kdecore/kcalendarsystemgregorian.cpp:326 4741 #: kdecore/kcalendarsystemhebrew.cpp:836 4742 #, fuzzy, kde-format 4743 #| msgctxt "Friday" 4744 #| msgid "Fri" 4745 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4746 msgid "Fri" 4747 msgstr "શુક્ર" 4748 4749 #: kdecore/kcalendarsystemgregorian.cpp:328 4750 #: kdecore/kcalendarsystemhebrew.cpp:838 4751 #, fuzzy, kde-format 4752 #| msgctxt "Saturday" 4753 #| msgid "Sat" 4754 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4755 msgid "Sat" 4756 msgstr "શનિ" 4757 4758 #: kdecore/kcalendarsystemgregorian.cpp:330 4759 #: kdecore/kcalendarsystemhebrew.cpp:840 4760 #, fuzzy, kde-format 4761 #| msgctxt "Sunday" 4762 #| msgid "Sun" 4763 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4764 msgid "Sun" 4765 msgstr "રવિ" 4766 4767 #: kdecore/kcalendarsystemgregorian.cpp:337 4768 #: kdecore/kcalendarsystemhebrew.cpp:847 4769 #, fuzzy, kde-format 4770 #| msgid "Monday" 4771 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4772 msgid "Monday" 4773 msgstr "સોમવાર" 4774 4775 #: kdecore/kcalendarsystemgregorian.cpp:339 4776 #: kdecore/kcalendarsystemhebrew.cpp:849 4777 #, fuzzy, kde-format 4778 #| msgid "Tuesday" 4779 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4780 msgid "Tuesday" 4781 msgstr "મંગળવાર" 4782 4783 #: kdecore/kcalendarsystemgregorian.cpp:341 4784 #: kdecore/kcalendarsystemhebrew.cpp:851 4785 #, fuzzy, kde-format 4786 #| msgid "Wednesday" 4787 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4788 msgid "Wednesday" 4789 msgstr "બુધવાર" 4790 4791 #: kdecore/kcalendarsystemgregorian.cpp:343 4792 #: kdecore/kcalendarsystemhebrew.cpp:853 4793 #, fuzzy, kde-format 4794 #| msgid "Thursday" 4795 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4796 msgid "Thursday" 4797 msgstr "ગુરુવાર" 4798 4799 #: kdecore/kcalendarsystemgregorian.cpp:345 4800 #: kdecore/kcalendarsystemhebrew.cpp:855 4801 #, fuzzy, kde-format 4802 #| msgid "Friday" 4803 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4804 msgid "Friday" 4805 msgstr "શુક્રવાર" 4806 4807 #: kdecore/kcalendarsystemgregorian.cpp:347 4808 #: kdecore/kcalendarsystemhebrew.cpp:857 4809 #, fuzzy, kde-format 4810 #| msgid "Saturday" 4811 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4812 msgid "Saturday" 4813 msgstr "શનિવાર" 4814 4815 #: kdecore/kcalendarsystemgregorian.cpp:349 4816 #: kdecore/kcalendarsystemhebrew.cpp:859 4817 #, fuzzy, kde-format 4818 #| msgid "Sunday" 4819 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4820 msgid "Sunday" 4821 msgstr "રવિવાર" 4822 4823 #: kdecore/kcalendarsystemhebrew.cpp:281 4824 #, kde-format 4825 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4826 msgid "Anno Mundi" 4827 msgstr "" 4828 4829 #: kdecore/kcalendarsystemhebrew.cpp:282 4830 #, kde-format 4831 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4832 msgid "AM" 4833 msgstr "" 4834 4835 #: kdecore/kcalendarsystemhebrew.cpp:283 4836 #, kde-format 4837 msgctxt "" 4838 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4839 msgid "%Ey %EC" 4840 msgstr "" 4841 4842 #: kdecore/kcalendarsystemhebrew.cpp:625 4843 #, kde-format 4844 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4845 msgid "T" 4846 msgstr "" 4847 4848 #: kdecore/kcalendarsystemhebrew.cpp:627 4849 #, kde-format 4850 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4851 msgid "H" 4852 msgstr "" 4853 4854 #: kdecore/kcalendarsystemhebrew.cpp:629 4855 #, kde-format 4856 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4857 msgid "K" 4858 msgstr "" 4859 4860 #: kdecore/kcalendarsystemhebrew.cpp:631 4861 #, kde-format 4862 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4863 msgid "T" 4864 msgstr "" 4865 4866 #: kdecore/kcalendarsystemhebrew.cpp:633 4867 #, kde-format 4868 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4869 msgid "S" 4870 msgstr "" 4871 4872 #: kdecore/kcalendarsystemhebrew.cpp:635 4873 #, fuzzy, kde-format 4874 #| msgid "Av" 4875 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4876 msgid "A" 4877 msgstr "અવ" 4878 4879 #: kdecore/kcalendarsystemhebrew.cpp:637 4880 #, kde-format 4881 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4882 msgid "N" 4883 msgstr "" 4884 4885 #: kdecore/kcalendarsystemhebrew.cpp:639 4886 #, kde-format 4887 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4888 msgid "I" 4889 msgstr "" 4890 4891 #: kdecore/kcalendarsystemhebrew.cpp:641 4892 #, kde-format 4893 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4894 msgid "S" 4895 msgstr "" 4896 4897 #: kdecore/kcalendarsystemhebrew.cpp:643 4898 #, kde-format 4899 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4900 msgid "T" 4901 msgstr "" 4902 4903 #: kdecore/kcalendarsystemhebrew.cpp:645 4904 #, fuzzy, kde-format 4905 #| msgid "Av" 4906 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4907 msgid "A" 4908 msgstr "અવ" 4909 4910 #: kdecore/kcalendarsystemhebrew.cpp:647 4911 #, kde-format 4912 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4913 msgid "E" 4914 msgstr "" 4915 4916 #: kdecore/kcalendarsystemhebrew.cpp:649 4917 #, fuzzy, kde-format 4918 #| msgid "Av" 4919 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4920 msgid "A" 4921 msgstr "અવ" 4922 4923 #: kdecore/kcalendarsystemhebrew.cpp:651 4924 #, fuzzy, kde-format 4925 #| msgid "Av" 4926 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4927 msgid "A" 4928 msgstr "અવ" 4929 4930 #: kdecore/kcalendarsystemhebrew.cpp:660 4931 #, fuzzy, kde-format 4932 #| msgctxt "of Tir short" 4933 #| msgid "of Tir" 4934 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4935 msgid "of Tis" 4936 msgstr "તિરનું" 4937 4938 #: kdecore/kcalendarsystemhebrew.cpp:662 4939 #, fuzzy, kde-format 4940 #| msgctxt "Coptic month 6 - ShortNamePossessive" 4941 #| msgid "of Mes" 4942 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4943 msgid "of Hes" 4944 msgstr "મેસ નું" 4945 4946 #: kdecore/kcalendarsystemhebrew.cpp:664 4947 #, fuzzy, kde-format 4948 #| msgctxt "Coptic month 4 - ShortNamePossessive" 4949 #| msgid "of Kia" 4950 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4951 msgid "of Kis" 4952 msgstr "કિઆ નું" 4953 4954 #: kdecore/kcalendarsystemhebrew.cpp:666 4955 #, fuzzy, kde-format 4956 #| msgid "of Tevet" 4957 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4958 msgid "of Tev" 4959 msgstr "ટેવેતનું" 4960 4961 #: kdecore/kcalendarsystemhebrew.cpp:668 4962 #, fuzzy, kde-format 4963 #| msgid "of Shvat" 4964 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4965 msgid "of Shv" 4966 msgstr "શ્વાતનું" 4967 4968 #: kdecore/kcalendarsystemhebrew.cpp:670 4969 #, fuzzy, kde-format 4970 #| msgid "of Adar" 4971 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4972 msgid "of Ada" 4973 msgstr "અડારનું" 4974 4975 #: kdecore/kcalendarsystemhebrew.cpp:672 4976 #, fuzzy, kde-format 4977 #| msgid "of Nisan" 4978 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4979 msgid "of Nis" 4980 msgstr "નિસાનનું" 4981 4982 #: kdecore/kcalendarsystemhebrew.cpp:674 4983 #, fuzzy, kde-format 4984 #| msgid "of Iyar" 4985 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4986 msgid "of Iya" 4987 msgstr "ઈયારનું" 4988 4989 #: kdecore/kcalendarsystemhebrew.cpp:676 4990 #, fuzzy, kde-format 4991 #| msgid "of Sivan" 4992 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4993 msgid "of Siv" 4994 msgstr "સિવાનનું" 4995 4996 #: kdecore/kcalendarsystemhebrew.cpp:678 4997 #, fuzzy, kde-format 4998 #| msgid "of Tamuz" 4999 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 5000 msgid "of Tam" 5001 msgstr "તામુઝનું" 5002 5003 #: kdecore/kcalendarsystemhebrew.cpp:680 5004 #, fuzzy, kde-format 5005 #| msgid "of Av" 5006 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 5007 msgid "of Av" 5008 msgstr "અવનું" 5009 5010 #: kdecore/kcalendarsystemhebrew.cpp:682 5011 #, fuzzy, kde-format 5012 #| msgid "of Elul" 5013 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 5014 msgid "of Elu" 5015 msgstr "ઇલુલનું" 5016 5017 #: kdecore/kcalendarsystemhebrew.cpp:684 5018 #, fuzzy, kde-format 5019 #| msgid "of Adar" 5020 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 5021 msgid "of Ad1" 5022 msgstr "અડારનું" 5023 5024 #: kdecore/kcalendarsystemhebrew.cpp:686 5025 #, fuzzy, kde-format 5026 #| msgid "of Adar" 5027 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 5028 msgid "of Ad2" 5029 msgstr "અડારનું" 5030 5031 #: kdecore/kcalendarsystemhebrew.cpp:695 5032 #, fuzzy, kde-format 5033 #| msgctxt "Tir short" 5034 #| msgid "Tir" 5035 msgctxt "Hebrew month 1 - KLocale::ShortName" 5036 msgid "Tis" 5037 msgstr "તિર" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:697 5040 #, fuzzy, kde-format 5041 #| msgctxt "Coptic month 6 - ShortName" 5042 #| msgid "Mes" 5043 msgctxt "Hebrew month 2 - KLocale::ShortName" 5044 msgid "Hes" 5045 msgstr "મેસ" 5046 5047 #: kdecore/kcalendarsystemhebrew.cpp:699 5048 #, fuzzy, kde-format 5049 #| msgid "Kislev" 5050 msgctxt "Hebrew month 3 - KLocale::ShortName" 5051 msgid "Kis" 5052 msgstr "કિસ્લેવ" 5053 5054 #: kdecore/kcalendarsystemhebrew.cpp:701 5055 #, fuzzy, kde-format 5056 #| msgid "Tevet" 5057 msgctxt "Hebrew month 4 - KLocale::ShortName" 5058 msgid "Tev" 5059 msgstr "ટેવેત" 5060 5061 #: kdecore/kcalendarsystemhebrew.cpp:703 5062 #, fuzzy, kde-format 5063 #| msgid "Shvat" 5064 msgctxt "Hebrew month 5 - KLocale::ShortName" 5065 msgid "Shv" 5066 msgstr "શ્વાત" 5067 5068 #: kdecore/kcalendarsystemhebrew.cpp:705 5069 #, fuzzy, kde-format 5070 #| msgid "Adar" 5071 msgctxt "Hebrew month 6 - KLocale::ShortName" 5072 msgid "Ada" 5073 msgstr "અડાર" 5074 5075 #: kdecore/kcalendarsystemhebrew.cpp:707 5076 #, fuzzy, kde-format 5077 #| msgid "Nisan" 5078 msgctxt "Hebrew month 7 - KLocale::ShortName" 5079 msgid "Nis" 5080 msgstr "નિસાન" 5081 5082 #: kdecore/kcalendarsystemhebrew.cpp:709 5083 #, fuzzy, kde-format 5084 #| msgid "Iyar" 5085 msgctxt "Hebrew month 8 - KLocale::ShortName" 5086 msgid "Iya" 5087 msgstr "ઈયાર" 5088 5089 #: kdecore/kcalendarsystemhebrew.cpp:711 5090 #, fuzzy, kde-format 5091 #| msgid "Sivan" 5092 msgctxt "Hebrew month 9 - KLocale::ShortName" 5093 msgid "Siv" 5094 msgstr "સિવાન" 5095 5096 #: kdecore/kcalendarsystemhebrew.cpp:713 5097 #, fuzzy, kde-format 5098 #| msgid "Tamuz" 5099 msgctxt "Hebrew month 10 - KLocale::ShortName" 5100 msgid "Tam" 5101 msgstr "તામુઝ" 5102 5103 #: kdecore/kcalendarsystemhebrew.cpp:715 5104 #, fuzzy, kde-format 5105 #| msgid "Av" 5106 msgctxt "Hebrew month 11 - KLocale::ShortName" 5107 msgid "Av" 5108 msgstr "અવ" 5109 5110 #: kdecore/kcalendarsystemhebrew.cpp:717 5111 #, fuzzy, kde-format 5112 #| msgid "Elul" 5113 msgctxt "Hebrew month 12 - KLocale::ShortName" 5114 msgid "Elu" 5115 msgstr "ઇલુલ" 5116 5117 #: kdecore/kcalendarsystemhebrew.cpp:719 5118 #, fuzzy, kde-format 5119 #| msgid "Ahd" 5120 msgctxt "Hebrew month 13 - KLocale::ShortName" 5121 msgid "Ad1" 5122 msgstr "અહદ" 5123 5124 #: kdecore/kcalendarsystemhebrew.cpp:721 5125 #, fuzzy, kde-format 5126 #| msgid "Ahd" 5127 msgctxt "Hebrew month 14 - KLocale::ShortName" 5128 msgid "Ad2" 5129 msgstr "અહદ" 5130 5131 #: kdecore/kcalendarsystemhebrew.cpp:730 5132 #, fuzzy, kde-format 5133 #| msgid "of Tishrey" 5134 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 5135 msgid "of Tishrey" 5136 msgstr "તીશ્રે નું" 5137 5138 #: kdecore/kcalendarsystemhebrew.cpp:732 5139 #, fuzzy, kde-format 5140 #| msgid "of Heshvan" 5141 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 5142 msgid "of Heshvan" 5143 msgstr "હેશવાનનું" 5144 5145 #: kdecore/kcalendarsystemhebrew.cpp:734 5146 #, fuzzy, kde-format 5147 #| msgid "of Kislev" 5148 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 5149 msgid "of Kislev" 5150 msgstr "કિસ્લેવનું" 5151 5152 #: kdecore/kcalendarsystemhebrew.cpp:736 5153 #, fuzzy, kde-format 5154 #| msgid "of Tevet" 5155 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 5156 msgid "of Tevet" 5157 msgstr "ટેવેતનું" 5158 5159 #: kdecore/kcalendarsystemhebrew.cpp:738 5160 #, fuzzy, kde-format 5161 #| msgid "of Shvat" 5162 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 5163 msgid "of Shvat" 5164 msgstr "શ્વાતનું" 5165 5166 #: kdecore/kcalendarsystemhebrew.cpp:740 5167 #, fuzzy, kde-format 5168 #| msgid "of Adar" 5169 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 5170 msgid "of Adar" 5171 msgstr "અડારનું" 5172 5173 #: kdecore/kcalendarsystemhebrew.cpp:742 5174 #, fuzzy, kde-format 5175 #| msgid "of Nisan" 5176 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 5177 msgid "of Nisan" 5178 msgstr "નિસાનનું" 5179 5180 #: kdecore/kcalendarsystemhebrew.cpp:744 5181 #, fuzzy, kde-format 5182 #| msgid "of Iyar" 5183 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 5184 msgid "of Iyar" 5185 msgstr "ઈયારનું" 5186 5187 #: kdecore/kcalendarsystemhebrew.cpp:746 5188 #, fuzzy, kde-format 5189 #| msgid "of Sivan" 5190 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 5191 msgid "of Sivan" 5192 msgstr "સિવાનનું" 5193 5194 #: kdecore/kcalendarsystemhebrew.cpp:748 5195 #, fuzzy, kde-format 5196 #| msgid "of Tamuz" 5197 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 5198 msgid "of Tamuz" 5199 msgstr "તામુઝનું" 5200 5201 #: kdecore/kcalendarsystemhebrew.cpp:750 5202 #, fuzzy, kde-format 5203 #| msgid "of Av" 5204 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 5205 msgid "of Av" 5206 msgstr "અવનું" 5207 5208 #: kdecore/kcalendarsystemhebrew.cpp:752 5209 #, fuzzy, kde-format 5210 #| msgid "of Elul" 5211 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 5212 msgid "of Elul" 5213 msgstr "ઇલુલનું" 5214 5215 #: kdecore/kcalendarsystemhebrew.cpp:754 5216 #, fuzzy, kde-format 5217 #| msgid "of Adar I" 5218 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 5219 msgid "of Adar I" 5220 msgstr "અડાર ૧ નું" 5221 5222 #: kdecore/kcalendarsystemhebrew.cpp:756 5223 #, fuzzy, kde-format 5224 #| msgid "of Adar II" 5225 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 5226 msgid "of Adar II" 5227 msgstr "અડાર ૨ નું" 5228 5229 #: kdecore/kcalendarsystemhebrew.cpp:765 5230 #, fuzzy, kde-format 5231 #| msgid "Tishrey" 5232 msgctxt "Hebrew month 1 - KLocale::LongName" 5233 msgid "Tishrey" 5234 msgstr "તીશ્રે" 5235 5236 #: kdecore/kcalendarsystemhebrew.cpp:767 5237 #, fuzzy, kde-format 5238 #| msgid "Heshvan" 5239 msgctxt "Hebrew month 2 - KLocale::LongName" 5240 msgid "Heshvan" 5241 msgstr "હેશવાન" 5242 5243 #: kdecore/kcalendarsystemhebrew.cpp:769 5244 #, fuzzy, kde-format 5245 #| msgid "Kislev" 5246 msgctxt "Hebrew month 3 - KLocale::LongName" 5247 msgid "Kislev" 5248 msgstr "કિસ્લેવ" 5249 5250 #: kdecore/kcalendarsystemhebrew.cpp:771 5251 #, fuzzy, kde-format 5252 #| msgid "Tevet" 5253 msgctxt "Hebrew month 4 - KLocale::LongName" 5254 msgid "Tevet" 5255 msgstr "ટેવેત" 5256 5257 #: kdecore/kcalendarsystemhebrew.cpp:773 5258 #, fuzzy, kde-format 5259 #| msgid "Shvat" 5260 msgctxt "Hebrew month 5 - KLocale::LongName" 5261 msgid "Shvat" 5262 msgstr "શ્વાત" 5263 5264 #: kdecore/kcalendarsystemhebrew.cpp:775 5265 #, fuzzy, kde-format 5266 #| msgid "Adar" 5267 msgctxt "Hebrew month 6 - KLocale::LongName" 5268 msgid "Adar" 5269 msgstr "અડાર" 5270 5271 #: kdecore/kcalendarsystemhebrew.cpp:777 5272 #, fuzzy, kde-format 5273 #| msgid "Nisan" 5274 msgctxt "Hebrew month 7 - KLocale::LongName" 5275 msgid "Nisan" 5276 msgstr "નિસાન" 5277 5278 #: kdecore/kcalendarsystemhebrew.cpp:779 5279 #, fuzzy, kde-format 5280 #| msgid "Iyar" 5281 msgctxt "Hebrew month 8 - KLocale::LongName" 5282 msgid "Iyar" 5283 msgstr "ઈયાર" 5284 5285 #: kdecore/kcalendarsystemhebrew.cpp:781 5286 #, fuzzy, kde-format 5287 #| msgid "Sivan" 5288 msgctxt "Hebrew month 9 - KLocale::LongName" 5289 msgid "Sivan" 5290 msgstr "સિવાન" 5291 5292 #: kdecore/kcalendarsystemhebrew.cpp:783 5293 #, fuzzy, kde-format 5294 #| msgid "Tamuz" 5295 msgctxt "Hebrew month 10 - KLocale::LongName" 5296 msgid "Tamuz" 5297 msgstr "તામુઝ" 5298 5299 #: kdecore/kcalendarsystemhebrew.cpp:785 5300 #, fuzzy, kde-format 5301 #| msgid "Av" 5302 msgctxt "Hebrew month 11 - KLocale::LongName" 5303 msgid "Av" 5304 msgstr "અવ" 5305 5306 #: kdecore/kcalendarsystemhebrew.cpp:787 5307 #, fuzzy, kde-format 5308 #| msgid "Elul" 5309 msgctxt "Hebrew month 12 - KLocale::LongName" 5310 msgid "Elul" 5311 msgstr "ઇલુલ" 5312 5313 #: kdecore/kcalendarsystemhebrew.cpp:789 5314 #, fuzzy, kde-format 5315 #| msgid "Adar I" 5316 msgctxt "Hebrew month 13 - KLocale::LongName" 5317 msgid "Adar I" 5318 msgstr "અડાર ૧" 5319 5320 #: kdecore/kcalendarsystemhebrew.cpp:791 5321 #, fuzzy, kde-format 5322 #| msgid "Adar II" 5323 msgctxt "Hebrew month 14 - KLocale::LongName" 5324 msgid "Adar II" 5325 msgstr "અડાર ૨" 5326 5327 #: kdecore/kcalendarsystemindiannational.cpp:66 5328 #, fuzzy, kde-format 5329 #| msgid "Safar" 5330 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5331 msgid "Saka Era" 5332 msgstr "સફર" 5333 5334 #: kdecore/kcalendarsystemindiannational.cpp:67 5335 #, kde-format 5336 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5337 msgid "SE" 5338 msgstr "" 5339 5340 #: kdecore/kcalendarsystemindiannational.cpp:68 5341 #, kde-format 5342 msgctxt "" 5343 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5344 "2000 SE" 5345 msgid "%Ey %EC" 5346 msgstr "" 5347 5348 #: kdecore/kcalendarsystemindiannational.cpp:158 5349 #, kde-format 5350 msgctxt "Indian National month 1 - KLocale::NarrowName" 5351 msgid "C" 5352 msgstr "" 5353 5354 #: kdecore/kcalendarsystemindiannational.cpp:160 5355 #, kde-format 5356 msgctxt "Indian National month 2 - KLocale::NarrowName" 5357 msgid "V" 5358 msgstr "" 5359 5360 #: kdecore/kcalendarsystemindiannational.cpp:162 5361 #, kde-format 5362 msgctxt "Indian National month 3 - KLocale::NarrowName" 5363 msgid "J" 5364 msgstr "" 5365 5366 #: kdecore/kcalendarsystemindiannational.cpp:164 5367 #, fuzzy, kde-format 5368 #| msgctxt "Indian National month 4 - ShortName" 5369 #| msgid "Āsh" 5370 msgctxt "Indian National month 4 - KLocale::NarrowName" 5371 msgid "Ā" 5372 msgstr "એશ" 5373 5374 #: kdecore/kcalendarsystemindiannational.cpp:166 5375 #, kde-format 5376 msgctxt "Indian National month 5 - KLocale::NarrowName" 5377 msgid "S" 5378 msgstr "" 5379 5380 #: kdecore/kcalendarsystemindiannational.cpp:168 5381 #, kde-format 5382 msgctxt "Indian National month 6 - KLocale::NarrowName" 5383 msgid "B" 5384 msgstr "" 5385 5386 #: kdecore/kcalendarsystemindiannational.cpp:170 5387 #, fuzzy, kde-format 5388 #| msgctxt "Indian National month 4 - ShortName" 5389 #| msgid "Āsh" 5390 msgctxt "Indian National month 7 - KLocale::NarrowName" 5391 msgid "Ā" 5392 msgstr "એશ" 5393 5394 #: kdecore/kcalendarsystemindiannational.cpp:172 5395 #, kde-format 5396 msgctxt "Indian National month 8 - KLocale::NarrowName" 5397 msgid "K" 5398 msgstr "" 5399 5400 #: kdecore/kcalendarsystemindiannational.cpp:174 5401 #, fuzzy, kde-format 5402 #| msgid "Av" 5403 msgctxt "Indian National month 9 - KLocale::NarrowName" 5404 msgid "A" 5405 msgstr "અવ" 5406 5407 #: kdecore/kcalendarsystemindiannational.cpp:176 5408 #, kde-format 5409 msgctxt "Indian National month 10 - KLocale::NarrowName" 5410 msgid "P" 5411 msgstr "" 5412 5413 #: kdecore/kcalendarsystemindiannational.cpp:178 5414 #, kde-format 5415 msgctxt "Indian National month 11 - KLocale::NarrowName" 5416 msgid "M" 5417 msgstr "" 5418 5419 #: kdecore/kcalendarsystemindiannational.cpp:180 5420 #, kde-format 5421 msgctxt "Indian National month 12 - KLocale::NarrowName" 5422 msgid "P" 5423 msgstr "" 5424 5425 #: kdecore/kcalendarsystemindiannational.cpp:189 5426 #, fuzzy, kde-format 5427 #| msgctxt "Indian National month 1 - ShortNamePossessive" 5428 #| msgid "of Cha" 5429 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5430 msgid "of Cha" 5431 msgstr "ચાનું" 5432 5433 #: kdecore/kcalendarsystemindiannational.cpp:191 5434 #, fuzzy, kde-format 5435 #| msgctxt "Indian National month 2 - ShortNamePossessive" 5436 #| msgid "of Vai" 5437 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5438 msgid "of Vai" 5439 msgstr "વૈનું" 5440 5441 #: kdecore/kcalendarsystemindiannational.cpp:193 5442 #, fuzzy, kde-format 5443 #| msgctxt "Indian National month 3 - ShortNamePossessive" 5444 #| msgid "of Jya" 5445 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5446 msgid "of Jya" 5447 msgstr "જ્યાનું" 5448 5449 #: kdecore/kcalendarsystemindiannational.cpp:195 5450 #, fuzzy, kde-format 5451 #| msgctxt "Indian National month 4 - ShortNamePossessive" 5452 #| msgid "of Āsh" 5453 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5454 msgid "of Āsh" 5455 msgstr "એશનું" 5456 5457 #: kdecore/kcalendarsystemindiannational.cpp:197 5458 #, fuzzy, kde-format 5459 #| msgctxt "Indian National month 5 - ShortNamePossessive" 5460 #| msgid "of Shr" 5461 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5462 msgid "of Shr" 5463 msgstr "શ્રનું" 5464 5465 #: kdecore/kcalendarsystemindiannational.cpp:199 5466 #, fuzzy, kde-format 5467 #| msgctxt "Indian National month 6 - ShortNamePossessive" 5468 #| msgid "of Bhā" 5469 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5470 msgid "of Bhā" 5471 msgstr "ભાનું" 5472 5473 #: kdecore/kcalendarsystemindiannational.cpp:201 5474 #, fuzzy, kde-format 5475 #| msgctxt "Indian National month 7 - ShortNamePossessive" 5476 #| msgid "of Āsw" 5477 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5478 msgid "of Āsw" 5479 msgstr "એશ્વનું" 5480 5481 #: kdecore/kcalendarsystemindiannational.cpp:203 5482 #, fuzzy, kde-format 5483 #| msgctxt "Indian National month 8 - ShortNamePossessive" 5484 #| msgid "of Kār" 5485 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5486 msgid "of Kār" 5487 msgstr "કારનું" 5488 5489 #: kdecore/kcalendarsystemindiannational.cpp:205 5490 #, fuzzy, kde-format 5491 #| msgctxt "Indian National month 9 - ShortNamePossessive" 5492 #| msgid "of Agr" 5493 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5494 msgid "of Agr" 5495 msgstr "અગ્રનું" 5496 5497 #: kdecore/kcalendarsystemindiannational.cpp:207 5498 #, fuzzy, kde-format 5499 #| msgctxt "Indian National month 10 - ShortNamePossessive" 5500 #| msgid "of Pau" 5501 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5502 msgid "of Pau" 5503 msgstr "પાઉનું" 5504 5505 #: kdecore/kcalendarsystemindiannational.cpp:209 5506 #, fuzzy, kde-format 5507 #| msgctxt "Indian National month 11 - ShortNamePossessive" 5508 #| msgid "of Māg" 5509 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5510 msgid "of Māg" 5511 msgstr "માગનું" 5512 5513 #: kdecore/kcalendarsystemindiannational.cpp:211 5514 #, fuzzy, kde-format 5515 #| msgctxt "Indian National month 12 - ShortNamePossessive" 5516 #| msgid "of Phā" 5517 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5518 msgid "of Phā" 5519 msgstr "ફાનું" 5520 5521 #: kdecore/kcalendarsystemindiannational.cpp:220 5522 #, fuzzy, kde-format 5523 #| msgctxt "Indian National month 1 - ShortName" 5524 #| msgid "Cha" 5525 msgctxt "Indian National month 1 - KLocale::ShortName" 5526 msgid "Cha" 5527 msgstr "ચા" 5528 5529 #: kdecore/kcalendarsystemindiannational.cpp:222 5530 #, fuzzy, kde-format 5531 #| msgctxt "Indian National month 2 - ShortName" 5532 #| msgid "Vai" 5533 msgctxt "Indian National month 2 - KLocale::ShortName" 5534 msgid "Vai" 5535 msgstr "વૈ" 5536 5537 #: kdecore/kcalendarsystemindiannational.cpp:224 5538 #, fuzzy, kde-format 5539 #| msgctxt "Indian National month 3 - ShortName" 5540 #| msgid "Jya" 5541 msgctxt "Indian National month 3 - KLocale::ShortName" 5542 msgid "Jya" 5543 msgstr "જ્યા" 5544 5545 #: kdecore/kcalendarsystemindiannational.cpp:226 5546 #, fuzzy, kde-format 5547 #| msgctxt "Indian National month 4 - ShortName" 5548 #| msgid "Āsh" 5549 msgctxt "Indian National month 4 - KLocale::ShortName" 5550 msgid "Āsh" 5551 msgstr "એશ" 5552 5553 #: kdecore/kcalendarsystemindiannational.cpp:228 5554 #, fuzzy, kde-format 5555 #| msgctxt "Indian National month 5 - ShortName" 5556 #| msgid "Shr" 5557 msgctxt "Indian National month 5 - KLocale::ShortName" 5558 msgid "Shr" 5559 msgstr "શ્ર" 5560 5561 #: kdecore/kcalendarsystemindiannational.cpp:230 5562 #, fuzzy, kde-format 5563 #| msgctxt "Indian National month 6 - ShortName" 5564 #| msgid "Bhā" 5565 msgctxt "Indian National month 6 - KLocale::ShortName" 5566 msgid "Bhā" 5567 msgstr "ભા" 5568 5569 #: kdecore/kcalendarsystemindiannational.cpp:232 5570 #, fuzzy, kde-format 5571 #| msgctxt "Indian National month 7 - ShortName" 5572 #| msgid "Āsw" 5573 msgctxt "Indian National month 7 - KLocale::ShortName" 5574 msgid "Āsw" 5575 msgstr "અશ્વ" 5576 5577 #: kdecore/kcalendarsystemindiannational.cpp:234 5578 #, fuzzy, kde-format 5579 #| msgctxt "Indian National month 8 - ShortName" 5580 #| msgid "Kār" 5581 msgctxt "Indian National month 8 - KLocale::ShortName" 5582 msgid "Kār" 5583 msgstr "કાર" 5584 5585 #: kdecore/kcalendarsystemindiannational.cpp:236 5586 #, fuzzy, kde-format 5587 msgctxt "Indian National month 9 - KLocale::ShortName" 5588 msgid "Agr" 5589 msgstr "અરબ" 5590 5591 #: kdecore/kcalendarsystemindiannational.cpp:238 5592 #, fuzzy, kde-format 5593 #| msgctxt "Indian National month 10 - ShortName" 5594 #| msgid "Pau" 5595 msgctxt "Indian National month 10 - KLocale::ShortName" 5596 msgid "Pau" 5597 msgstr "પાઉ" 5598 5599 #: kdecore/kcalendarsystemindiannational.cpp:240 5600 #, fuzzy, kde-format 5601 msgctxt "Indian National month 11 - KLocale::ShortName" 5602 msgid "Māg" 5603 msgstr "માહ" 5604 5605 #: kdecore/kcalendarsystemindiannational.cpp:242 5606 #, fuzzy, kde-format 5607 msgctxt "Indian National month 12 - KLocale::ShortName" 5608 msgid "Phā" 5609 msgstr "ભા" 5610 5611 #: kdecore/kcalendarsystemindiannational.cpp:251 5612 #, fuzzy, kde-format 5613 #| msgctxt "Indian National month 1 - LongNamePossessive" 5614 #| msgid "of Chaitra" 5615 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5616 msgid "of Chaitra" 5617 msgstr "ચૈત્રનું" 5618 5619 #: kdecore/kcalendarsystemindiannational.cpp:253 5620 #, fuzzy, kde-format 5621 #| msgctxt "Indian National month 2 - LongNamePossessive" 5622 #| msgid "of Vaishākh" 5623 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5624 msgid "of Vaishākh" 5625 msgstr "વૈશાખનું" 5626 5627 #: kdecore/kcalendarsystemindiannational.cpp:255 5628 #, fuzzy, kde-format 5629 #| msgctxt "Indian National month 3 - LongNamePossessive" 5630 #| msgid "of Jyaishtha" 5631 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5632 msgid "of Jyaishtha" 5633 msgstr "જયેષ્ઠનું" 5634 5635 #: kdecore/kcalendarsystemindiannational.cpp:257 5636 #, fuzzy, kde-format 5637 #| msgctxt "Indian National month 4 - LongNamePossessive" 5638 #| msgid "of Āshādha" 5639 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5640 msgid "of Āshādha" 5641 msgstr "અષાઢનું" 5642 5643 #: kdecore/kcalendarsystemindiannational.cpp:259 5644 #, fuzzy, kde-format 5645 #| msgctxt "Indian National month 5 - LongNamePossessive" 5646 #| msgid "of Shrāvana" 5647 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5648 msgid "of Shrāvana" 5649 msgstr "શ્રાવણનું" 5650 5651 #: kdecore/kcalendarsystemindiannational.cpp:261 5652 #, fuzzy, kde-format 5653 #| msgctxt "Indian National month 6 - LongNamePossessive" 5654 #| msgid "of Bhādrapad" 5655 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5656 msgid "of Bhādrapad" 5657 msgstr "ભ" 5658 5659 #: kdecore/kcalendarsystemindiannational.cpp:263 5660 #, fuzzy, kde-format 5661 #| msgctxt "Indian National month 7 - LongNamePossessive" 5662 #| msgid "of Āshwin" 5663 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5664 msgid "of Āshwin" 5665 msgstr "અશ્વિનનું" 5666 5667 #: kdecore/kcalendarsystemindiannational.cpp:265 5668 #, fuzzy, kde-format 5669 #| msgctxt "Indian National month 8 - LongNamePossessive" 5670 #| msgid "of Kārtik" 5671 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5672 msgid "of Kārtik" 5673 msgstr "કાર્તિકનું" 5674 5675 #: kdecore/kcalendarsystemindiannational.cpp:267 5676 #, fuzzy, kde-format 5677 #| msgctxt "Indian National month 9 - LongNamePossessive" 5678 #| msgid "of Agrahayana" 5679 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5680 msgid "of Agrahayana" 5681 msgstr "અગ્રહાયાનાનું" 5682 5683 #: kdecore/kcalendarsystemindiannational.cpp:269 5684 #, fuzzy, kde-format 5685 #| msgctxt "Indian National month 10 - LongNamePossessive" 5686 #| msgid "of Paush" 5687 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5688 msgid "of Paush" 5689 msgstr "પોસનું" 5690 5691 #: kdecore/kcalendarsystemindiannational.cpp:271 5692 #, fuzzy, kde-format 5693 #| msgctxt "Indian National month 11 - LongNamePossessive" 5694 #| msgid "of Māgh" 5695 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5696 msgid "of Māgh" 5697 msgstr "માહનું" 5698 5699 #: kdecore/kcalendarsystemindiannational.cpp:273 5700 #, fuzzy, kde-format 5701 #| msgctxt "Indian National month 12 - LongNamePossessive" 5702 #| msgid "of Phālgun" 5703 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5704 msgid "of Phālgun" 5705 msgstr "ફાગણનું" 5706 5707 #: kdecore/kcalendarsystemindiannational.cpp:282 5708 #, fuzzy, kde-format 5709 #| msgctxt "Indian National month 1 - LongName" 5710 #| msgid "Chaitra" 5711 msgctxt "Indian National month 1 - KLocale::LongName" 5712 msgid "Chaitra" 5713 msgstr "ચૈત્ર" 5714 5715 #: kdecore/kcalendarsystemindiannational.cpp:284 5716 #, fuzzy, kde-format 5717 #| msgctxt "Indian National month 2 - LongName" 5718 #| msgid "Vaishākh" 5719 msgctxt "Indian National month 2 - KLocale::LongName" 5720 msgid "Vaishākh" 5721 msgstr "વૈશાખ" 5722 5723 #: kdecore/kcalendarsystemindiannational.cpp:286 5724 #, fuzzy, kde-format 5725 #| msgctxt "Indian National month 3 - LongName" 5726 #| msgid "Jyaishtha" 5727 msgctxt "Indian National month 3 - KLocale::LongName" 5728 msgid "Jyaishtha" 5729 msgstr "જયેષ્ઠ" 5730 5731 #: kdecore/kcalendarsystemindiannational.cpp:288 5732 #, fuzzy, kde-format 5733 #| msgctxt "Indian National month 4 - LongName" 5734 #| msgid "Āshādha" 5735 msgctxt "Indian National month 4 - KLocale::LongName" 5736 msgid "Āshādha" 5737 msgstr "અષાઢ" 5738 5739 #: kdecore/kcalendarsystemindiannational.cpp:290 5740 #, fuzzy, kde-format 5741 #| msgctxt "Indian National month 5 - LongName" 5742 #| msgid "Shrāvana" 5743 msgctxt "Indian National month 5 - KLocale::LongName" 5744 msgid "Shrāvana" 5745 msgstr "શ્રાવણ" 5746 5747 #: kdecore/kcalendarsystemindiannational.cpp:292 5748 #, fuzzy, kde-format 5749 #| msgctxt "Indian National month 6 - LongName" 5750 #| msgid "Bhādrapad" 5751 msgctxt "Indian National month 6 - KLocale::LongName" 5752 msgid "Bhādrapad" 5753 msgstr "ભાદ્રપદ" 5754 5755 #: kdecore/kcalendarsystemindiannational.cpp:294 5756 #, fuzzy, kde-format 5757 #| msgctxt "Indian National month 7 - LongName" 5758 #| msgid "Āshwin" 5759 msgctxt "Indian National month 7 - KLocale::LongName" 5760 msgid "Āshwin" 5761 msgstr "અશ્વિન" 5762 5763 #: kdecore/kcalendarsystemindiannational.cpp:296 5764 #, fuzzy, kde-format 5765 #| msgctxt "Indian National month 8 - LongName" 5766 #| msgid "Kārtik" 5767 msgctxt "Indian National month 8 - KLocale::LongName" 5768 msgid "Kārtik" 5769 msgstr "કાર્તિક" 5770 5771 #: kdecore/kcalendarsystemindiannational.cpp:298 5772 #, fuzzy, kde-format 5773 #| msgctxt "Indian National month 9 - LongName" 5774 #| msgid "Agrahayana" 5775 msgctxt "Indian National month 9 - KLocale::LongName" 5776 msgid "Agrahayana" 5777 msgstr "અગ્રહાયાના" 5778 5779 #: kdecore/kcalendarsystemindiannational.cpp:300 5780 #, fuzzy, kde-format 5781 #| msgctxt "Indian National month 10 - LongName" 5782 #| msgid "Paush" 5783 msgctxt "Indian National month 10 - KLocale::LongName" 5784 msgid "Paush" 5785 msgstr "પોશ" 5786 5787 #: kdecore/kcalendarsystemindiannational.cpp:302 5788 #, fuzzy, kde-format 5789 #| msgctxt "Indian National month 11 - LongName" 5790 #| msgid "Māgh" 5791 msgctxt "Indian National month 11 - KLocale::LongName" 5792 msgid "Māgh" 5793 msgstr "માહ" 5794 5795 #: kdecore/kcalendarsystemindiannational.cpp:304 5796 #, fuzzy, kde-format 5797 #| msgctxt "Indian National month 12 - LongName" 5798 #| msgid "Phālgun" 5799 msgctxt "Indian National month 12 - KLocale::LongName" 5800 msgid "Phālgun" 5801 msgstr "ફાગણ" 5802 5803 #: kdecore/kcalendarsystemindiannational.cpp:317 5804 #, kde-format 5805 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5806 msgid "S" 5807 msgstr "" 5808 5809 #: kdecore/kcalendarsystemindiannational.cpp:319 5810 #, kde-format 5811 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5812 msgid "M" 5813 msgstr "" 5814 5815 #: kdecore/kcalendarsystemindiannational.cpp:321 5816 #, kde-format 5817 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5818 msgid "B" 5819 msgstr "" 5820 5821 #: kdecore/kcalendarsystemindiannational.cpp:323 5822 #, kde-format 5823 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5824 msgid "G" 5825 msgstr "" 5826 5827 #: kdecore/kcalendarsystemindiannational.cpp:325 5828 #, kde-format 5829 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5830 msgid "S" 5831 msgstr "" 5832 5833 #: kdecore/kcalendarsystemindiannational.cpp:327 5834 #, kde-format 5835 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5836 msgid "S" 5837 msgstr "" 5838 5839 #: kdecore/kcalendarsystemindiannational.cpp:329 5840 #, kde-format 5841 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5842 msgid "R" 5843 msgstr "" 5844 5845 #: kdecore/kcalendarsystemindiannational.cpp:338 5846 #, fuzzy, kde-format 5847 #| msgctxt "Indian National weekday 1 - ShortDayName" 5848 #| msgid "Som" 5849 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5850 msgid "Som" 5851 msgstr "સોમ" 5852 5853 #: kdecore/kcalendarsystemindiannational.cpp:340 5854 #, fuzzy, kde-format 5855 #| msgctxt "Indian National weekday 2 - ShortDayName" 5856 #| msgid "Mañ" 5857 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5858 msgid "Mañ" 5859 msgstr "માન" 5860 5861 #: kdecore/kcalendarsystemindiannational.cpp:342 5862 #, fuzzy, kde-format 5863 #| msgctxt "Indian National weekday 3 - ShortDayName" 5864 #| msgid "Bud" 5865 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5866 msgid "Bud" 5867 msgstr "બુધ" 5868 5869 #: kdecore/kcalendarsystemindiannational.cpp:344 5870 #, fuzzy, kde-format 5871 #| msgctxt "Indian National weekday 4 - ShortDayName" 5872 #| msgid "Gur" 5873 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5874 msgid "Gur" 5875 msgstr "ગુર" 5876 5877 #: kdecore/kcalendarsystemindiannational.cpp:346 5878 #, fuzzy, kde-format 5879 #| msgctxt "Indian National weekday 5 - ShortDayName" 5880 #| msgid "Suk" 5881 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5882 msgid "Suk" 5883 msgstr "શુક્ર" 5884 5885 #: kdecore/kcalendarsystemindiannational.cpp:348 5886 #, fuzzy, kde-format 5887 #| msgctxt "Indian National weekday 6 - ShortDayName" 5888 #| msgid "San" 5889 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5890 msgid "San" 5891 msgstr "સાન" 5892 5893 #: kdecore/kcalendarsystemindiannational.cpp:350 5894 #, fuzzy, kde-format 5895 #| msgctxt "Indian National weekday 7 - ShortDayName" 5896 #| msgid "Rav" 5897 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5898 msgid "Rav" 5899 msgstr "રાવ" 5900 5901 #: kdecore/kcalendarsystemindiannational.cpp:357 5902 #, fuzzy, kde-format 5903 #| msgctxt "Indian National weekday 1 - LongDayName" 5904 #| msgid "Somavãra" 5905 msgctxt "Indian National weekday 1 - KLocale::LongName" 5906 msgid "Somavãra" 5907 msgstr "સોમવાર" 5908 5909 #: kdecore/kcalendarsystemindiannational.cpp:359 5910 #, fuzzy, kde-format 5911 #| msgctxt "Indian National weekday 2 - LongDayName" 5912 #| msgid "Mañgalvã" 5913 msgctxt "Indian National weekday 2 - KLocale::LongName" 5914 msgid "Mañgalvã" 5915 msgstr "મંગળવાર" 5916 5917 #: kdecore/kcalendarsystemindiannational.cpp:361 5918 #, fuzzy, kde-format 5919 #| msgctxt "Indian National weekday 3 - LongDayName" 5920 #| msgid "Budhavãra" 5921 msgctxt "Indian National weekday 3 - KLocale::LongName" 5922 msgid "Budhavãra" 5923 msgstr "બુધવાર" 5924 5925 #: kdecore/kcalendarsystemindiannational.cpp:363 5926 #, fuzzy, kde-format 5927 #| msgctxt "Indian National weekday 4 - LongDayName" 5928 #| msgid "Guruvãra" 5929 msgctxt "Indian National weekday 4 - KLocale::LongName" 5930 msgid "Guruvãra" 5931 msgstr "ગુરુવાર" 5932 5933 #: kdecore/kcalendarsystemindiannational.cpp:365 5934 #, fuzzy, kde-format 5935 #| msgctxt "Indian National weekday 5 - LongDayName" 5936 #| msgid "Sukravãra" 5937 msgctxt "Indian National weekday 5 - KLocale::LongName" 5938 msgid "Sukravãra" 5939 msgstr "શુક્રવાર" 5940 5941 #: kdecore/kcalendarsystemindiannational.cpp:367 5942 #, fuzzy, kde-format 5943 #| msgctxt "Indian National weekday 6 - LongDayName" 5944 #| msgid "Sanivãra" 5945 msgctxt "Indian National weekday 6 - KLocale::LongName" 5946 msgid "Sanivãra" 5947 msgstr "શનિવાર" 5948 5949 #: kdecore/kcalendarsystemindiannational.cpp:369 5950 #, fuzzy, kde-format 5951 #| msgctxt "Indian National weekday 7 - LongDayName" 5952 #| msgid "Raviãra" 5953 msgctxt "Indian National weekday 7 - KLocale::LongName" 5954 msgid "Raviãra" 5955 msgstr "રવિવાર" 5956 5957 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5958 #, kde-format 5959 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5960 msgid "Anno Hegirae" 5961 msgstr "" 5962 5963 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5964 #, kde-format 5965 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5966 msgid "AH" 5967 msgstr "" 5968 5969 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5970 #, kde-format 5971 msgctxt "" 5972 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5973 msgid "%Ey %EC" 5974 msgstr "" 5975 5976 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5977 #, kde-format 5978 msgctxt "Hijri month 1 - KLocale::NarrowName" 5979 msgid "M" 5980 msgstr "" 5981 5982 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5983 #, kde-format 5984 msgctxt "Hijri month 2 - KLocale::NarrowName" 5985 msgid "S" 5986 msgstr "" 5987 5988 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5989 #, fuzzy, kde-format 5990 #| msgid "Av" 5991 msgctxt "Hijri month 3 - KLocale::NarrowName" 5992 msgid "A" 5993 msgstr "અવ" 5994 5995 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5996 #, kde-format 5997 msgctxt "Hijri month 4 - KLocale::NarrowName" 5998 msgid "T" 5999 msgstr "" 6000 6001 #: kdecore/kcalendarsystemislamiccivil.cpp:174 6002 #, fuzzy, kde-format 6003 #| msgid "Av" 6004 msgctxt "Hijri month 5 - KLocale::NarrowName" 6005 msgid "A" 6006 msgstr "અવ" 6007 6008 #: kdecore/kcalendarsystemislamiccivil.cpp:176 6009 #, kde-format 6010 msgctxt "Hijri month 6 - KLocale::NarrowName" 6011 msgid "T" 6012 msgstr "" 6013 6014 #: kdecore/kcalendarsystemislamiccivil.cpp:178 6015 #, kde-format 6016 msgctxt "Hijri month 7 - KLocale::NarrowName" 6017 msgid "R" 6018 msgstr "" 6019 6020 #: kdecore/kcalendarsystemislamiccivil.cpp:180 6021 #, kde-format 6022 msgctxt "Hijri month 8 - KLocale::NarrowName" 6023 msgid "S" 6024 msgstr "" 6025 6026 #: kdecore/kcalendarsystemislamiccivil.cpp:182 6027 #, kde-format 6028 msgctxt "Hijri month 9 - KLocale::NarrowName" 6029 msgid "R" 6030 msgstr "" 6031 6032 #: kdecore/kcalendarsystemislamiccivil.cpp:184 6033 #, kde-format 6034 msgctxt "Hijri month 10 - KLocale::NarrowName" 6035 msgid "S" 6036 msgstr "" 6037 6038 #: kdecore/kcalendarsystemislamiccivil.cpp:186 6039 #, kde-format 6040 msgctxt "Hijri month 11 - KLocale::NarrowName" 6041 msgid "Q" 6042 msgstr "" 6043 6044 #: kdecore/kcalendarsystemislamiccivil.cpp:188 6045 #, kde-format 6046 msgctxt "Hijri month 12 - KLocale::NarrowName" 6047 msgid "H" 6048 msgstr "" 6049 6050 #: kdecore/kcalendarsystemislamiccivil.cpp:197 6051 #, fuzzy, kde-format 6052 #| msgctxt "of Mehr short" 6053 #| msgid "of Meh" 6054 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 6055 msgid "of Muh" 6056 msgstr "મેહનું" 6057 6058 #: kdecore/kcalendarsystemislamiccivil.cpp:199 6059 #, fuzzy, kde-format 6060 #| msgid "of Safar" 6061 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 6062 msgid "of Saf" 6063 msgstr "સફરનું" 6064 6065 #: kdecore/kcalendarsystemislamiccivil.cpp:201 6066 #, fuzzy, kde-format 6067 #| msgid "of R. Awal" 6068 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 6069 msgid "of R.A" 6070 msgstr "ર. અવાલનું" 6071 6072 #: kdecore/kcalendarsystemislamiccivil.cpp:203 6073 #, fuzzy, kde-format 6074 #| msgid "of R. Thaani" 6075 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 6076 msgid "of R.T" 6077 msgstr "ર. થાનીનું" 6078 6079 #: kdecore/kcalendarsystemislamiccivil.cpp:205 6080 #, fuzzy, kde-format 6081 #| msgid "of J. Awal" 6082 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 6083 msgid "of J.A" 6084 msgstr "જ. અવાલનું" 6085 6086 #: kdecore/kcalendarsystemislamiccivil.cpp:207 6087 #, fuzzy, kde-format 6088 #| msgid "of J. Thaani" 6089 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 6090 msgid "of J.T" 6091 msgstr "જ. થાનીનું" 6092 6093 #: kdecore/kcalendarsystemislamiccivil.cpp:209 6094 #, fuzzy, kde-format 6095 #| msgid "of Rajab" 6096 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 6097 msgid "of Raj" 6098 msgstr "રજબનું" 6099 6100 #: kdecore/kcalendarsystemislamiccivil.cpp:211 6101 #, fuzzy, kde-format 6102 #| msgctxt "of Shahrivar short" 6103 #| msgid "of Sha" 6104 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 6105 msgid "of Sha" 6106 msgstr "શાનું" 6107 6108 #: kdecore/kcalendarsystemislamiccivil.cpp:213 6109 #, fuzzy, kde-format 6110 #| msgctxt "Coptic month 8 - ShortNamePossessive" 6111 #| msgid "of Pam" 6112 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 6113 msgid "of Ram" 6114 msgstr "પામ નું" 6115 6116 #: kdecore/kcalendarsystemislamiccivil.cpp:215 6117 #, fuzzy, kde-format 6118 #| msgctxt "of Shahrivar short" 6119 #| msgid "of Sha" 6120 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 6121 msgid "of Shw" 6122 msgstr "શાનું" 6123 6124 #: kdecore/kcalendarsystemislamiccivil.cpp:217 6125 #, fuzzy, kde-format 6126 #| msgid "of Qi`dah" 6127 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 6128 msgid "of Qid" 6129 msgstr "કીદાહનું" 6130 6131 #: kdecore/kcalendarsystemislamiccivil.cpp:219 6132 #, fuzzy, kde-format 6133 #| msgid "of Hijjah" 6134 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 6135 msgid "of Hij" 6136 msgstr "હિજ્જાહનું" 6137 6138 #: kdecore/kcalendarsystemislamiccivil.cpp:228 6139 #, fuzzy, kde-format 6140 #| msgctxt "Mehr short" 6141 #| msgid "Meh" 6142 msgctxt "Hijri month 1 - KLocale::ShortName" 6143 msgid "Muh" 6144 msgstr "મેહ" 6145 6146 #: kdecore/kcalendarsystemislamiccivil.cpp:230 6147 #, fuzzy, kde-format 6148 #| msgid "Safar" 6149 msgctxt "Hijri month 2 - KLocale::ShortName" 6150 msgid "Saf" 6151 msgstr "સફર" 6152 6153 #: kdecore/kcalendarsystemislamiccivil.cpp:232 6154 #, fuzzy, kde-format 6155 #| msgid "R. Awal" 6156 msgctxt "Hijri month 3 - KLocale::ShortName" 6157 msgid "R.A" 6158 msgstr "ર. અવાલ" 6159 6160 #: kdecore/kcalendarsystemislamiccivil.cpp:234 6161 #, kde-format 6162 msgctxt "Hijri month 4 - KLocale::ShortName" 6163 msgid "R.T" 6164 msgstr "" 6165 6166 #: kdecore/kcalendarsystemislamiccivil.cpp:236 6167 #, fuzzy, kde-format 6168 #| msgid "J. Awal" 6169 msgctxt "Hijri month 5 - KLocale::ShortName" 6170 msgid "J.A" 6171 msgstr "જ. અવાલ" 6172 6173 #: kdecore/kcalendarsystemislamiccivil.cpp:238 6174 #, kde-format 6175 msgctxt "Hijri month 6 - KLocale::ShortName" 6176 msgid "J.T" 6177 msgstr "" 6178 6179 #: kdecore/kcalendarsystemislamiccivil.cpp:240 6180 #, fuzzy, kde-format 6181 #| msgid "Rajab" 6182 msgctxt "Hijri month 7 - KLocale::ShortName" 6183 msgid "Raj" 6184 msgstr "રજબ" 6185 6186 #: kdecore/kcalendarsystemislamiccivil.cpp:242 6187 #, fuzzy, kde-format 6188 #| msgctxt "Shahrivar short" 6189 #| msgid "Sha" 6190 msgctxt "Hijri month 8 - KLocale::ShortName" 6191 msgid "Sha" 6192 msgstr "શા" 6193 6194 #: kdecore/kcalendarsystemislamiccivil.cpp:244 6195 #, fuzzy, kde-format 6196 #| msgctxt "Coptic month 8 - ShortName" 6197 #| msgid "Pam" 6198 msgctxt "Hijri month 9 - KLocale::ShortName" 6199 msgid "Ram" 6200 msgstr "પામ" 6201 6202 #: kdecore/kcalendarsystemislamiccivil.cpp:246 6203 #, fuzzy, kde-format 6204 #| msgctxt "Shahrivar short" 6205 #| msgid "Sha" 6206 msgctxt "Hijri month 10 - KLocale::ShortName" 6207 msgid "Shw" 6208 msgstr "શા" 6209 6210 #: kdecore/kcalendarsystemislamiccivil.cpp:248 6211 #, fuzzy, kde-format 6212 #| msgid "Qi`dah" 6213 msgctxt "Hijri month 11 - KLocale::ShortName" 6214 msgid "Qid" 6215 msgstr "કીદાહ" 6216 6217 #: kdecore/kcalendarsystemislamiccivil.cpp:250 6218 #, fuzzy, kde-format 6219 #| msgctxt "@item Calendar system" 6220 #| msgid "Hijri" 6221 msgctxt "Hijri month 12 - KLocale::ShortName" 6222 msgid "Hij" 6223 msgstr "હિજરી" 6224 6225 #: kdecore/kcalendarsystemislamiccivil.cpp:259 6226 #, fuzzy, kde-format 6227 #| msgid "of Muharram" 6228 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 6229 msgid "of Muharram" 6230 msgstr "મોહરમનું" 6231 6232 #: kdecore/kcalendarsystemislamiccivil.cpp:261 6233 #, fuzzy, kde-format 6234 #| msgid "of Safar" 6235 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 6236 msgid "of Safar" 6237 msgstr "સફરનું" 6238 6239 #: kdecore/kcalendarsystemislamiccivil.cpp:263 6240 #, fuzzy, kde-format 6241 #| msgid "of Rabi` al-Awal" 6242 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 6243 msgid "of Rabi` al-Awal" 6244 msgstr "રબી અલ-અવાલનું" 6245 6246 #: kdecore/kcalendarsystemislamiccivil.cpp:265 6247 #, fuzzy, kde-format 6248 #| msgid "of Rabi` al-Thaani" 6249 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 6250 msgid "of Rabi` al-Thaani" 6251 msgstr "રબી અલ-થાનીનું" 6252 6253 #: kdecore/kcalendarsystemislamiccivil.cpp:267 6254 #, fuzzy, kde-format 6255 #| msgid "of Jumaada al-Awal" 6256 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 6257 msgid "of Jumaada al-Awal" 6258 msgstr "જુમાડા અલ-અવાલનું" 6259 6260 #: kdecore/kcalendarsystemislamiccivil.cpp:269 6261 #, fuzzy, kde-format 6262 #| msgid "of Jumaada al-Thaani" 6263 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 6264 msgid "of Jumaada al-Thaani" 6265 msgstr "જુમાડા અલ-થાનીનું" 6266 6267 #: kdecore/kcalendarsystemislamiccivil.cpp:271 6268 #, fuzzy, kde-format 6269 #| msgid "of Rajab" 6270 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 6271 msgid "of Rajab" 6272 msgstr "રજબનું" 6273 6274 #: kdecore/kcalendarsystemislamiccivil.cpp:273 6275 #, fuzzy, kde-format 6276 #| msgid "of Sha`ban" 6277 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 6278 msgid "of Sha`ban" 6279 msgstr "શાબાનનું" 6280 6281 #: kdecore/kcalendarsystemislamiccivil.cpp:275 6282 #, fuzzy, kde-format 6283 #| msgid "of Ramadan" 6284 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 6285 msgid "of Ramadan" 6286 msgstr "રમાદાનનું" 6287 6288 #: kdecore/kcalendarsystemislamiccivil.cpp:277 6289 #, fuzzy, kde-format 6290 #| msgid "of Shawwal" 6291 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 6292 msgid "of Shawwal" 6293 msgstr "શવ્વાલનું" 6294 6295 #: kdecore/kcalendarsystemislamiccivil.cpp:279 6296 #, fuzzy, kde-format 6297 #| msgid "of Thu al-Qi`dah" 6298 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 6299 msgid "of Thu al-Qi`dah" 6300 msgstr "થુ અલ-કીદાહનું" 6301 6302 #: kdecore/kcalendarsystemislamiccivil.cpp:281 6303 #, fuzzy, kde-format 6304 #| msgid "of Thu al-Hijjah" 6305 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 6306 msgid "of Thu al-Hijjah" 6307 msgstr "થુ અલ-હિજાહનું" 6308 6309 #: kdecore/kcalendarsystemislamiccivil.cpp:290 6310 #, fuzzy, kde-format 6311 #| msgid "Muharram" 6312 msgctxt "Hijri month 1 - KLocale::LongName" 6313 msgid "Muharram" 6314 msgstr "મોહરમ" 6315 6316 #: kdecore/kcalendarsystemislamiccivil.cpp:292 6317 #, fuzzy, kde-format 6318 #| msgid "Safar" 6319 msgctxt "Hijri month 2 - KLocale::LongName" 6320 msgid "Safar" 6321 msgstr "સફર" 6322 6323 #: kdecore/kcalendarsystemislamiccivil.cpp:294 6324 #, fuzzy, kde-format 6325 #| msgid "Rabi` al-Awal" 6326 msgctxt "Hijri month 3 - KLocale::LongName" 6327 msgid "Rabi` al-Awal" 6328 msgstr "રબી અલ-અવાલ" 6329 6330 #: kdecore/kcalendarsystemislamiccivil.cpp:296 6331 #, fuzzy, kde-format 6332 #| msgid "Rabi` al-Thaani" 6333 msgctxt "Hijri month 4 - KLocale::LongName" 6334 msgid "Rabi` al-Thaani" 6335 msgstr "રબી અલ-થાની" 6336 6337 #: kdecore/kcalendarsystemislamiccivil.cpp:298 6338 #, fuzzy, kde-format 6339 #| msgid "Jumaada al-Awal" 6340 msgctxt "Hijri month 5 - KLocale::LongName" 6341 msgid "Jumaada al-Awal" 6342 msgstr "જુમાડા અલ-અવાલ" 6343 6344 #: kdecore/kcalendarsystemislamiccivil.cpp:300 6345 #, fuzzy, kde-format 6346 #| msgid "Jumaada al-Thaani" 6347 msgctxt "Hijri month 6 - KLocale::LongName" 6348 msgid "Jumaada al-Thaani" 6349 msgstr "જુમાડા અલ-થાની" 6350 6351 #: kdecore/kcalendarsystemislamiccivil.cpp:302 6352 #, fuzzy, kde-format 6353 #| msgid "Rajab" 6354 msgctxt "Hijri month 7 - KLocale::LongName" 6355 msgid "Rajab" 6356 msgstr "રજબ" 6357 6358 #: kdecore/kcalendarsystemislamiccivil.cpp:304 6359 #, fuzzy, kde-format 6360 #| msgid "Sha`ban" 6361 msgctxt "Hijri month 8 - KLocale::LongName" 6362 msgid "Sha`ban" 6363 msgstr "શાબાન" 6364 6365 #: kdecore/kcalendarsystemislamiccivil.cpp:306 6366 #, fuzzy, kde-format 6367 #| msgid "Ramadan" 6368 msgctxt "Hijri month 9 - KLocale::LongName" 6369 msgid "Ramadan" 6370 msgstr "રમાદાન" 6371 6372 #: kdecore/kcalendarsystemislamiccivil.cpp:308 6373 #, fuzzy, kde-format 6374 #| msgid "Shawwal" 6375 msgctxt "Hijri month 10 - KLocale::LongName" 6376 msgid "Shawwal" 6377 msgstr "શવાલ" 6378 6379 #: kdecore/kcalendarsystemislamiccivil.cpp:310 6380 #, fuzzy, kde-format 6381 #| msgid "Thu al-Qi`dah" 6382 msgctxt "Hijri month 11 - KLocale::LongName" 6383 msgid "Thu al-Qi`dah" 6384 msgstr "થુ અલ-કિદાહ" 6385 6386 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6387 #, fuzzy, kde-format 6388 #| msgid "Thu al-Hijjah" 6389 msgctxt "Hijri month 12 - KLocale::LongName" 6390 msgid "Thu al-Hijjah" 6391 msgstr "થુ અલ-હિજાહ" 6392 6393 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6394 #, kde-format 6395 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6396 msgid "I" 6397 msgstr "" 6398 6399 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6400 #, kde-format 6401 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6402 msgid "T" 6403 msgstr "" 6404 6405 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6406 #, fuzzy, kde-format 6407 #| msgid "Av" 6408 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6409 msgid "A" 6410 msgstr "અવ" 6411 6412 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6413 #, kde-format 6414 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6415 msgid "K" 6416 msgstr "" 6417 6418 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6419 #, kde-format 6420 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6421 msgid "J" 6422 msgstr "" 6423 6424 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6425 #, kde-format 6426 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6427 msgid "S" 6428 msgstr "" 6429 6430 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6431 #, fuzzy, kde-format 6432 #| msgid "Av" 6433 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6434 msgid "A" 6435 msgstr "અવ" 6436 6437 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6438 #, fuzzy, kde-format 6439 #| msgid "Ith" 6440 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6441 msgid "Ith" 6442 msgstr "ઇથ" 6443 6444 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6445 #, fuzzy, kde-format 6446 #| msgid "Thl" 6447 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6448 msgid "Thl" 6449 msgstr "થલ" 6450 6451 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6452 #, fuzzy, kde-format 6453 #| msgid "Arb" 6454 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6455 msgid "Arb" 6456 msgstr "અરબ" 6457 6458 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6459 #, fuzzy, kde-format 6460 #| msgid "Kha" 6461 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6462 msgid "Kha" 6463 msgstr "ખા" 6464 6465 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6466 #, fuzzy, kde-format 6467 #| msgid "Jum" 6468 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6469 msgid "Jum" 6470 msgstr "જુમ" 6471 6472 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6473 #, fuzzy, kde-format 6474 #| msgid "Sab" 6475 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6476 msgid "Sab" 6477 msgstr "સાબ" 6478 6479 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6480 #, fuzzy, kde-format 6481 #| msgid "Ahd" 6482 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6483 msgid "Ahd" 6484 msgstr "અહદ" 6485 6486 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6487 #, fuzzy, kde-format 6488 #| msgid "Yaum al-Ithnain" 6489 msgctxt "Hijri weekday 1 - KLocale::LongName" 6490 msgid "Yaum al-Ithnain" 6491 msgstr "યોમ અલ-ઇથનૈન" 6492 6493 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6494 #, fuzzy, kde-format 6495 #| msgid "Yau al-Thulatha" 6496 msgctxt "Hijri weekday 2 - KLocale::LongName" 6497 msgid "Yau al-Thulatha" 6498 msgstr "યો અલ-થુલાથા" 6499 6500 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6501 #, fuzzy, kde-format 6502 #| msgid "Yaum al-Arbi'a" 6503 msgctxt "Hijri weekday 3 - KLocale::LongName" 6504 msgid "Yaum al-Arbi'a" 6505 msgstr "યોમ અલ-અરબિઆ" 6506 6507 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6508 #, fuzzy, kde-format 6509 #| msgid "Yaum al-Khamees" 6510 msgctxt "Hijri weekday 4 - KLocale::LongName" 6511 msgid "Yaum al-Khamees" 6512 msgstr "યોમ અલ-ખામીસ" 6513 6514 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6515 #, fuzzy, kde-format 6516 #| msgid "Yaum al-Jumma" 6517 msgctxt "Hijri weekday 5 - KLocale::LongName" 6518 msgid "Yaum al-Jumma" 6519 msgstr "યોમ અલ-જુમ્મા" 6520 6521 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6522 #, fuzzy, kde-format 6523 #| msgid "Yaum al-Sabt" 6524 msgctxt "Hijri weekday 6 - KLocale::LongName" 6525 msgid "Yaum al-Sabt" 6526 msgstr "યોમ અલ-સબ્ત" 6527 6528 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6529 #, fuzzy, kde-format 6530 #| msgid "Yaum al-Ahad" 6531 msgctxt "Hijri weekday 7 - KLocale::LongName" 6532 msgid "Yaum al-Ahad" 6533 msgstr "યોમ અલ-અહાદ" 6534 6535 #: kdecore/kcalendarsystemjalali.cpp:74 6536 #, kde-format 6537 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6538 msgid "Anno Persico" 6539 msgstr "" 6540 6541 #: kdecore/kcalendarsystemjalali.cpp:75 6542 #, kde-format 6543 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6544 msgid "AP" 6545 msgstr "" 6546 6547 #: kdecore/kcalendarsystemjalali.cpp:76 6548 #, kde-format 6549 msgctxt "" 6550 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6551 msgid "%Ey %EC" 6552 msgstr "" 6553 6554 #: kdecore/kcalendarsystemjalali.cpp:172 6555 #, kde-format 6556 msgctxt "Jalali month 1 - KLocale::NarrowName" 6557 msgid "F" 6558 msgstr "" 6559 6560 #: kdecore/kcalendarsystemjalali.cpp:174 6561 #, kde-format 6562 msgctxt "Jalali month 2 - KLocale::NarrowName" 6563 msgid "O" 6564 msgstr "" 6565 6566 #: kdecore/kcalendarsystemjalali.cpp:176 6567 #, kde-format 6568 msgctxt "Jalali month 3 - KLocale::NarrowName" 6569 msgid "K" 6570 msgstr "" 6571 6572 #: kdecore/kcalendarsystemjalali.cpp:178 6573 #, kde-format 6574 msgctxt "Jalali month 4 - KLocale::NarrowName" 6575 msgid "T" 6576 msgstr "" 6577 6578 #: kdecore/kcalendarsystemjalali.cpp:180 6579 #, kde-format 6580 msgctxt "Jalali month 5 - KLocale::NarrowName" 6581 msgid "M" 6582 msgstr "" 6583 6584 #: kdecore/kcalendarsystemjalali.cpp:182 6585 #, kde-format 6586 msgctxt "Jalali month 6 - KLocale::NarrowName" 6587 msgid "S" 6588 msgstr "" 6589 6590 #: kdecore/kcalendarsystemjalali.cpp:184 6591 #, kde-format 6592 msgctxt "Jalali month 7 - KLocale::NarrowName" 6593 msgid "M" 6594 msgstr "" 6595 6596 #: kdecore/kcalendarsystemjalali.cpp:186 6597 #, fuzzy, kde-format 6598 #| msgid "Av" 6599 msgctxt "Jalali month 8 - KLocale::NarrowName" 6600 msgid "A" 6601 msgstr "અવ" 6602 6603 #: kdecore/kcalendarsystemjalali.cpp:188 6604 #, fuzzy, kde-format 6605 #| msgid "Av" 6606 msgctxt "Jalali month 9 - KLocale::NarrowName" 6607 msgid "A" 6608 msgstr "અવ" 6609 6610 #: kdecore/kcalendarsystemjalali.cpp:190 6611 #, kde-format 6612 msgctxt "Jalali month 10 - KLocale::NarrowName" 6613 msgid "D" 6614 msgstr "" 6615 6616 #: kdecore/kcalendarsystemjalali.cpp:192 6617 #, kde-format 6618 msgctxt "Jalali month 11 - KLocale::NarrowName" 6619 msgid "B" 6620 msgstr "" 6621 6622 #: kdecore/kcalendarsystemjalali.cpp:194 6623 #, kde-format 6624 msgctxt "Jalali month 12 - KLocale::NarrowName" 6625 msgid "E" 6626 msgstr "" 6627 6628 #: kdecore/kcalendarsystemjalali.cpp:203 6629 #, fuzzy, kde-format 6630 #| msgctxt "of Farvardin short" 6631 #| msgid "of Far" 6632 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6633 msgid "of Far" 6634 msgstr "ફરનું" 6635 6636 #: kdecore/kcalendarsystemjalali.cpp:205 6637 #, fuzzy, kde-format 6638 #| msgctxt "of Ordibehesht short" 6639 #| msgid "of Ord" 6640 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6641 msgid "of Ord" 6642 msgstr "ઓર્દનું" 6643 6644 #: kdecore/kcalendarsystemjalali.cpp:207 6645 #, fuzzy, kde-format 6646 #| msgctxt "of Khordad short" 6647 #| msgid "of Kho" 6648 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6649 msgid "of Kho" 6650 msgstr "ખોનું" 6651 6652 #: kdecore/kcalendarsystemjalali.cpp:209 6653 #, fuzzy, kde-format 6654 #| msgctxt "of Tir short" 6655 #| msgid "of Tir" 6656 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6657 msgid "of Tir" 6658 msgstr "તિરનું" 6659 6660 #: kdecore/kcalendarsystemjalali.cpp:211 6661 #, fuzzy, kde-format 6662 #| msgctxt "of Mordad short" 6663 #| msgid "of Mor" 6664 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6665 msgid "of Mor" 6666 msgstr "મોરનું" 6667 6668 #: kdecore/kcalendarsystemjalali.cpp:213 6669 #, fuzzy, kde-format 6670 #| msgctxt "of Shahrivar short" 6671 #| msgid "of Sha" 6672 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6673 msgid "of Sha" 6674 msgstr "શાનું" 6675 6676 #: kdecore/kcalendarsystemjalali.cpp:215 6677 #, fuzzy, kde-format 6678 #| msgctxt "of Mehr short" 6679 #| msgid "of Meh" 6680 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6681 msgid "of Meh" 6682 msgstr "મેહનું" 6683 6684 #: kdecore/kcalendarsystemjalali.cpp:217 6685 #, fuzzy, kde-format 6686 #| msgctxt "of Aban short" 6687 #| msgid "of Aba" 6688 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6689 msgid "of Aba" 6690 msgstr "અબાનું" 6691 6692 #: kdecore/kcalendarsystemjalali.cpp:219 6693 #, fuzzy, kde-format 6694 #| msgctxt "of Azar short" 6695 #| msgid "of Aza" 6696 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6697 msgid "of Aza" 6698 msgstr "અઝાનું" 6699 6700 #: kdecore/kcalendarsystemjalali.cpp:221 6701 #, fuzzy, kde-format 6702 #| msgctxt "of Dei short" 6703 #| msgid "of Dei" 6704 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6705 msgid "of Dei" 6706 msgstr "ડેઇનું" 6707 6708 #: kdecore/kcalendarsystemjalali.cpp:223 6709 #, fuzzy, kde-format 6710 #| msgctxt "of Bahman short" 6711 #| msgid "of Bah" 6712 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6713 msgid "of Bah" 6714 msgstr "બાહનું" 6715 6716 #: kdecore/kcalendarsystemjalali.cpp:225 6717 #, fuzzy, kde-format 6718 #| msgctxt "of Esfand short" 6719 #| msgid "of Esf" 6720 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6721 msgid "of Esf" 6722 msgstr "ઇસ્ફનું" 6723 6724 #: kdecore/kcalendarsystemjalali.cpp:234 6725 #, fuzzy, kde-format 6726 #| msgctxt "Farvardin short" 6727 #| msgid "Far" 6728 msgctxt "Jalali month 1 - KLocale::ShortName" 6729 msgid "Far" 6730 msgstr "ફર" 6731 6732 #: kdecore/kcalendarsystemjalali.cpp:236 6733 #, fuzzy, kde-format 6734 #| msgctxt "Ordibehesht short" 6735 #| msgid "Ord" 6736 msgctxt "Jalali month 2 - KLocale::ShortName" 6737 msgid "Ord" 6738 msgstr "ઓર્દ" 6739 6740 #: kdecore/kcalendarsystemjalali.cpp:238 6741 #, fuzzy, kde-format 6742 #| msgctxt "Khordad short" 6743 #| msgid "Kho" 6744 msgctxt "Jalali month 3 - KLocale::ShortName" 6745 msgid "Kho" 6746 msgstr "ખો" 6747 6748 #: kdecore/kcalendarsystemjalali.cpp:240 6749 #, fuzzy, kde-format 6750 #| msgctxt "Tir short" 6751 #| msgid "Tir" 6752 msgctxt "Jalali month 4 - KLocale::ShortName" 6753 msgid "Tir" 6754 msgstr "તિર" 6755 6756 #: kdecore/kcalendarsystemjalali.cpp:242 6757 #, fuzzy, kde-format 6758 #| msgctxt "Mordad short" 6759 #| msgid "Mor" 6760 msgctxt "Jalali month 5 - KLocale::ShortName" 6761 msgid "Mor" 6762 msgstr "મોર" 6763 6764 #: kdecore/kcalendarsystemjalali.cpp:244 6765 #, fuzzy, kde-format 6766 #| msgctxt "Shahrivar short" 6767 #| msgid "Sha" 6768 msgctxt "Jalali month 6 - KLocale::ShortName" 6769 msgid "Sha" 6770 msgstr "શા" 6771 6772 #: kdecore/kcalendarsystemjalali.cpp:246 6773 #, fuzzy, kde-format 6774 #| msgctxt "Mehr short" 6775 #| msgid "Meh" 6776 msgctxt "Jalali month 7 - KLocale::ShortName" 6777 msgid "Meh" 6778 msgstr "મેહ" 6779 6780 #: kdecore/kcalendarsystemjalali.cpp:248 6781 #, fuzzy, kde-format 6782 #| msgctxt "Aban short" 6783 #| msgid "Aba" 6784 msgctxt "Jalali month 8 - KLocale::ShortName" 6785 msgid "Aba" 6786 msgstr "અબા" 6787 6788 #: kdecore/kcalendarsystemjalali.cpp:250 6789 #, fuzzy, kde-format 6790 #| msgctxt "Azar short" 6791 #| msgid "Aza" 6792 msgctxt "Jalali month 9 - KLocale::ShortName" 6793 msgid "Aza" 6794 msgstr "અઝા" 6795 6796 #: kdecore/kcalendarsystemjalali.cpp:252 6797 #, fuzzy, kde-format 6798 #| msgctxt "Dei short" 6799 #| msgid "Dei" 6800 msgctxt "Jalali month 10 - KLocale::ShortName" 6801 msgid "Dei" 6802 msgstr "ડેઇ" 6803 6804 #: kdecore/kcalendarsystemjalali.cpp:254 6805 #, fuzzy, kde-format 6806 #| msgctxt "Bahman short" 6807 #| msgid "Bah" 6808 msgctxt "Jalali month 11 - KLocale::ShortName" 6809 msgid "Bah" 6810 msgstr "બાહ" 6811 6812 #: kdecore/kcalendarsystemjalali.cpp:256 6813 #, fuzzy, kde-format 6814 #| msgctxt "Esfand" 6815 #| msgid "Esf" 6816 msgctxt "Jalali month 12 - KLocale::ShortName" 6817 msgid "Esf" 6818 msgstr "ઇસ્ફ" 6819 6820 #: kdecore/kcalendarsystemjalali.cpp:265 6821 #, fuzzy, kde-format 6822 #| msgid "of Farvardin" 6823 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6824 msgid "of Farvardin" 6825 msgstr "ફાર્વારદિનનું" 6826 6827 #: kdecore/kcalendarsystemjalali.cpp:267 6828 #, fuzzy, kde-format 6829 #| msgid "of Ordibehesht" 6830 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6831 msgid "of Ordibehesht" 6832 msgstr "ઓર્ડીબેહેશ્ટનું" 6833 6834 #: kdecore/kcalendarsystemjalali.cpp:269 6835 #, fuzzy, kde-format 6836 #| msgid "of Khordad" 6837 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6838 msgid "of Khordad" 6839 msgstr "ખોરદાદનું" 6840 6841 #: kdecore/kcalendarsystemjalali.cpp:271 6842 #, fuzzy, kde-format 6843 #| msgctxt "of Tir short" 6844 #| msgid "of Tir" 6845 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6846 msgid "of Tir" 6847 msgstr "તિરનું" 6848 6849 #: kdecore/kcalendarsystemjalali.cpp:273 6850 #, fuzzy, kde-format 6851 #| msgid "of Mordad" 6852 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6853 msgid "of Mordad" 6854 msgstr "મોરડાડનું" 6855 6856 #: kdecore/kcalendarsystemjalali.cpp:275 6857 #, fuzzy, kde-format 6858 #| msgid "of Shahrivar" 6859 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6860 msgid "of Shahrivar" 6861 msgstr "શાહરિવરનું" 6862 6863 #: kdecore/kcalendarsystemjalali.cpp:277 6864 #, fuzzy, kde-format 6865 #| msgid "of Mehr" 6866 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6867 msgid "of Mehr" 6868 msgstr "મેહ્રનું" 6869 6870 #: kdecore/kcalendarsystemjalali.cpp:279 6871 #, fuzzy, kde-format 6872 #| msgid "of Aban" 6873 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6874 msgid "of Aban" 6875 msgstr "અબાનનું" 6876 6877 #: kdecore/kcalendarsystemjalali.cpp:281 6878 #, fuzzy, kde-format 6879 #| msgid "of Azar" 6880 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6881 msgid "of Azar" 6882 msgstr "અઝારનું" 6883 6884 #: kdecore/kcalendarsystemjalali.cpp:283 6885 #, fuzzy, kde-format 6886 #| msgctxt "of Dei short" 6887 #| msgid "of Dei" 6888 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6889 msgid "of Dei" 6890 msgstr "ડેઇનું" 6891 6892 #: kdecore/kcalendarsystemjalali.cpp:285 6893 #, fuzzy, kde-format 6894 #| msgid "of Bahman" 6895 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6896 msgid "of Bahman" 6897 msgstr "બેહમેનનું" 6898 6899 #: kdecore/kcalendarsystemjalali.cpp:287 6900 #, fuzzy, kde-format 6901 #| msgid "of Esfand" 6902 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6903 msgid "of Esfand" 6904 msgstr "એસફેન્ડનું" 6905 6906 #: kdecore/kcalendarsystemjalali.cpp:296 6907 #, fuzzy, kde-format 6908 #| msgid "Farvardin" 6909 msgctxt "Jalali month 1 - KLocale::LongName" 6910 msgid "Farvardin" 6911 msgstr "ફાર્વારદિન" 6912 6913 #: kdecore/kcalendarsystemjalali.cpp:298 6914 #, fuzzy, kde-format 6915 #| msgid "Ordibehesht" 6916 msgctxt "Jalali month 2 - KLocale::LongName" 6917 msgid "Ordibehesht" 6918 msgstr "ઓર્ડીબેહેશ્ટ" 6919 6920 #: kdecore/kcalendarsystemjalali.cpp:300 6921 #, fuzzy, kde-format 6922 #| msgid "Khordad" 6923 msgctxt "Jalali month 3 - KLocale::LongName" 6924 msgid "Khordad" 6925 msgstr "ખોરદાદ" 6926 6927 #: kdecore/kcalendarsystemjalali.cpp:302 6928 #, fuzzy, kde-format 6929 #| msgctxt "Tir short" 6930 #| msgid "Tir" 6931 msgctxt "Jalali month 4 - KLocale::LongName" 6932 msgid "Tir" 6933 msgstr "તિર" 6934 6935 #: kdecore/kcalendarsystemjalali.cpp:304 6936 #, fuzzy, kde-format 6937 #| msgid "Mordad" 6938 msgctxt "Jalali month 5 - KLocale::LongName" 6939 msgid "Mordad" 6940 msgstr "મોરડાડ" 6941 6942 #: kdecore/kcalendarsystemjalali.cpp:306 6943 #, fuzzy, kde-format 6944 #| msgid "Shahrivar" 6945 msgctxt "Jalali month 6 - KLocale::LongName" 6946 msgid "Shahrivar" 6947 msgstr "શાહરિવર" 6948 6949 #: kdecore/kcalendarsystemjalali.cpp:308 6950 #, fuzzy, kde-format 6951 #| msgid "Mehr" 6952 msgctxt "Jalali month 7 - KLocale::LongName" 6953 msgid "Mehr" 6954 msgstr "મેહ્ર" 6955 6956 #: kdecore/kcalendarsystemjalali.cpp:310 6957 #, fuzzy, kde-format 6958 #| msgid "Aban" 6959 msgctxt "Jalali month 8 - KLocale::LongName" 6960 msgid "Aban" 6961 msgstr "અબાન" 6962 6963 #: kdecore/kcalendarsystemjalali.cpp:312 6964 #, fuzzy, kde-format 6965 #| msgid "Azar" 6966 msgctxt "Jalali month 9 - KLocale::LongName" 6967 msgid "Azar" 6968 msgstr "અઝાર" 6969 6970 #: kdecore/kcalendarsystemjalali.cpp:314 6971 #, fuzzy, kde-format 6972 #| msgctxt "Dei short" 6973 #| msgid "Dei" 6974 msgctxt "Jalali month 10 - KLocale::LongName" 6975 msgid "Dei" 6976 msgstr "ડેઇ" 6977 6978 #: kdecore/kcalendarsystemjalali.cpp:316 6979 #, fuzzy, kde-format 6980 #| msgid "Bahman" 6981 msgctxt "Jalali month 11 - KLocale::LongName" 6982 msgid "Bahman" 6983 msgstr "બેહમેન" 6984 6985 #: kdecore/kcalendarsystemjalali.cpp:318 6986 #, fuzzy, kde-format 6987 #| msgid "Esfand" 6988 msgctxt "Jalali month 12 - KLocale::LongName" 6989 msgid "Esfand" 6990 msgstr "એસફેન્ડ" 6991 6992 #: kdecore/kcalendarsystemjalali.cpp:331 6993 #, kde-format 6994 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6995 msgid "2" 6996 msgstr "" 6997 6998 #: kdecore/kcalendarsystemjalali.cpp:333 6999 #, kde-format 7000 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 7001 msgid "3" 7002 msgstr "" 7003 7004 #: kdecore/kcalendarsystemjalali.cpp:335 7005 #, kde-format 7006 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 7007 msgid "4" 7008 msgstr "" 7009 7010 #: kdecore/kcalendarsystemjalali.cpp:337 7011 #, kde-format 7012 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 7013 msgid "5" 7014 msgstr "" 7015 7016 #: kdecore/kcalendarsystemjalali.cpp:339 7017 #, kde-format 7018 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 7019 msgid "J" 7020 msgstr "" 7021 7022 #: kdecore/kcalendarsystemjalali.cpp:341 7023 #, kde-format 7024 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 7025 msgid "S" 7026 msgstr "" 7027 7028 #: kdecore/kcalendarsystemjalali.cpp:343 7029 #, kde-format 7030 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 7031 msgid "1" 7032 msgstr "" 7033 7034 #: kdecore/kcalendarsystemjalali.cpp:352 7035 #, fuzzy, kde-format 7036 #| msgctxt "Do shanbe short" 7037 #| msgid "2sh" 7038 msgctxt "Jalali weekday 1 - KLocale::ShortName" 7039 msgid "2sh" 7040 msgstr "૨sh" 7041 7042 #: kdecore/kcalendarsystemjalali.cpp:354 7043 #, fuzzy, kde-format 7044 #| msgctxt "Se shanbe short" 7045 #| msgid "3sh" 7046 msgctxt "Jalali weekday 2 - KLocale::ShortName" 7047 msgid "3sh" 7048 msgstr "૩sh" 7049 7050 #: kdecore/kcalendarsystemjalali.cpp:356 7051 #, fuzzy, kde-format 7052 #| msgctxt "Chahar shanbe short" 7053 #| msgid "4sh" 7054 msgctxt "Jalali weekday 3 - KLocale::ShortName" 7055 msgid "4sh" 7056 msgstr "૪sh" 7057 7058 #: kdecore/kcalendarsystemjalali.cpp:358 7059 #, fuzzy, kde-format 7060 #| msgctxt "Panj shanbe short" 7061 #| msgid "5sh" 7062 msgctxt "Jalali weekday 4 - KLocale::ShortName" 7063 msgid "5sh" 7064 msgstr "૫sh" 7065 7066 #: kdecore/kcalendarsystemjalali.cpp:360 7067 #, fuzzy, kde-format 7068 #| msgctxt "Jumee short" 7069 #| msgid "Jom" 7070 msgctxt "Jalali weekday 5 - KLocale::ShortName" 7071 msgid "Jom" 7072 msgstr "જોમ" 7073 7074 #: kdecore/kcalendarsystemjalali.cpp:362 7075 #, fuzzy, kde-format 7076 #| msgid "Shanbe" 7077 msgctxt "Jalali weekday 6 - KLocale::ShortName" 7078 msgid "Shn" 7079 msgstr "શાન્બે" 7080 7081 #: kdecore/kcalendarsystemjalali.cpp:364 7082 #, fuzzy, kde-format 7083 #| msgctxt "Yek-shanbe short" 7084 #| msgid "1sh" 7085 msgctxt "Jalali weekday 7 - KLocale::ShortName" 7086 msgid "1sh" 7087 msgstr "૧sh" 7088 7089 #: kdecore/kcalendarsystemjalali.cpp:371 7090 #, fuzzy, kde-format 7091 #| msgid "Do shanbe" 7092 msgctxt "Jalali weekday 1 - KLocale::LongName" 7093 msgid "Do shanbe" 7094 msgstr "દો શાન્બે" 7095 7096 #: kdecore/kcalendarsystemjalali.cpp:373 7097 #, fuzzy, kde-format 7098 #| msgid "Se shanbe" 7099 msgctxt "Jalali weekday 2 - KLocale::LongName" 7100 msgid "Se shanbe" 7101 msgstr "શે શાન્બે" 7102 7103 #: kdecore/kcalendarsystemjalali.cpp:375 7104 #, fuzzy, kde-format 7105 #| msgid "Chahar shanbe" 7106 msgctxt "Jalali weekday 3 - KLocale::LongName" 7107 msgid "Chahar shanbe" 7108 msgstr "ચહાર શાન્બે" 7109 7110 #: kdecore/kcalendarsystemjalali.cpp:377 7111 #, fuzzy, kde-format 7112 #| msgid "Panj shanbe" 7113 msgctxt "Jalali weekday 4 - KLocale::LongName" 7114 msgid "Panj shanbe" 7115 msgstr "પન્જ શાન્બે" 7116 7117 #: kdecore/kcalendarsystemjalali.cpp:379 7118 #, fuzzy, kde-format 7119 #| msgid "Jumee" 7120 msgctxt "Jalali weekday 5 - KLocale::LongName" 7121 msgid "Jumee" 7122 msgstr "જુમી" 7123 7124 #: kdecore/kcalendarsystemjalali.cpp:381 7125 #, fuzzy, kde-format 7126 #| msgid "Shanbe" 7127 msgctxt "Jalali weekday 6 - KLocale::LongName" 7128 msgid "Shanbe" 7129 msgstr "શાન્બે" 7130 7131 #: kdecore/kcalendarsystemjalali.cpp:383 7132 #, fuzzy, kde-format 7133 #| msgid "Yek-shanbe" 7134 msgctxt "Jalali weekday 7 - KLocale::LongName" 7135 msgid "Yek-shanbe" 7136 msgstr "યેક-શાન્બે" 7137 7138 #: kdecore/kcalendarsystemjapanese.cpp:62 7139 #, kde-format 7140 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 7141 msgid "Meiji" 7142 msgstr "" 7143 7144 #: kdecore/kcalendarsystemjapanese.cpp:64 7145 #, kde-format 7146 msgctxt "" 7147 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 7148 "e.g. Meiji 1" 7149 msgid "%EC Gannen" 7150 msgstr "" 7151 7152 #: kdecore/kcalendarsystemjapanese.cpp:66 7153 #, kde-format 7154 msgctxt "" 7155 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 7156 "e.g. Meiji 22" 7157 msgid "%EC %Ey" 7158 msgstr "" 7159 7160 #: kdecore/kcalendarsystemjapanese.cpp:69 7161 #, kde-format 7162 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 7163 msgid "Taishō" 7164 msgstr "" 7165 7166 #: kdecore/kcalendarsystemjapanese.cpp:71 7167 #, kde-format 7168 msgctxt "" 7169 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 7170 "1, e.g. Taishō 1" 7171 msgid "%EC Gannen" 7172 msgstr "" 7173 7174 #: kdecore/kcalendarsystemjapanese.cpp:73 7175 #, kde-format 7176 msgctxt "" 7177 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 7178 "1, e.g. Taishō 22" 7179 msgid "%EC %Ey" 7180 msgstr "" 7181 7182 #: kdecore/kcalendarsystemjapanese.cpp:76 7183 #, fuzzy, kde-format 7184 #| msgctxt "Shahrivar short" 7185 #| msgid "Sha" 7186 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 7187 msgid "Shōwa" 7188 msgstr "શા" 7189 7190 #: kdecore/kcalendarsystemjapanese.cpp:78 7191 #, kde-format 7192 msgctxt "" 7193 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 7194 "e.g. Shōwa 1" 7195 msgid "%EC Gannen" 7196 msgstr "" 7197 7198 #: kdecore/kcalendarsystemjapanese.cpp:80 7199 #, kde-format 7200 msgctxt "" 7201 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 7202 "e.g. Shōwa 22" 7203 msgid "%EC %Ey" 7204 msgstr "" 7205 7206 #: kdecore/kcalendarsystemjapanese.cpp:83 7207 #, kde-format 7208 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 7209 msgid "Heisei" 7210 msgstr "" 7211 7212 #: kdecore/kcalendarsystemjapanese.cpp:85 7213 #, kde-format 7214 msgctxt "" 7215 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 7216 "1, e.g. Heisei 1" 7217 msgid "%EC Gannen" 7218 msgstr "" 7219 7220 #: kdecore/kcalendarsystemjapanese.cpp:87 7221 #, kde-format 7222 msgctxt "" 7223 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 7224 "1, e.g. Heisei 22" 7225 msgid "%EC %Ey" 7226 msgstr "" 7227 7228 #: kdecore/kcalendarsystemjapanese.cpp:164 7229 #, fuzzy, kde-format 7230 #| msgctxt "Ethiopian month 9 - ShortName" 7231 #| msgid "Gen" 7232 msgctxt "Japanese year 1 of era" 7233 msgid "Gannen" 7234 msgstr "જેન" 7235 7236 #: kdecore/kcalendarsystemjulian.cpp:73 7237 #, kde-format 7238 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 7239 msgid "Before Common Era" 7240 msgstr "" 7241 7242 #: kdecore/kcalendarsystemjulian.cpp:74 7243 #, kde-format 7244 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 7245 msgid "BCE" 7246 msgstr "" 7247 7248 #: kdecore/kcalendarsystemjulian.cpp:76 7249 #, kde-format 7250 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 7251 msgid "Before Christ" 7252 msgstr "" 7253 7254 #: kdecore/kcalendarsystemjulian.cpp:77 7255 #, kde-format 7256 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 7257 msgid "BC" 7258 msgstr "" 7259 7260 #: kdecore/kcalendarsystemjulian.cpp:79 7261 #, kde-format 7262 msgctxt "" 7263 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 7264 msgid "%Ey %EC" 7265 msgstr "" 7266 7267 #: kdecore/kcalendarsystemjulian.cpp:83 7268 #, kde-format 7269 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 7270 msgid "Common Era" 7271 msgstr "" 7272 7273 #: kdecore/kcalendarsystemjulian.cpp:84 7274 #, kde-format 7275 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 7276 msgid "CE" 7277 msgstr "" 7278 7279 #: kdecore/kcalendarsystemjulian.cpp:86 7280 #, kde-format 7281 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 7282 msgid "Anno Domini" 7283 msgstr "" 7284 7285 #: kdecore/kcalendarsystemjulian.cpp:87 7286 #, kde-format 7287 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 7288 msgid "AD" 7289 msgstr "" 7290 7291 #: kdecore/kcalendarsystemjulian.cpp:89 7292 #, kde-format 7293 msgctxt "" 7294 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 7295 msgid "%Ey %EC" 7296 msgstr "" 7297 7298 #: kdecore/kcalendarsystemjulian.cpp:172 7299 #, kde-format 7300 msgctxt "Julian month 1 - KLocale::NarrowName" 7301 msgid "J" 7302 msgstr "" 7303 7304 #: kdecore/kcalendarsystemjulian.cpp:174 7305 #, kde-format 7306 msgctxt "Julian month 2 - KLocale::NarrowName" 7307 msgid "F" 7308 msgstr "" 7309 7310 #: kdecore/kcalendarsystemjulian.cpp:176 7311 #, kde-format 7312 msgctxt "Julian month 3 - KLocale::NarrowName" 7313 msgid "M" 7314 msgstr "" 7315 7316 #: kdecore/kcalendarsystemjulian.cpp:178 7317 #, fuzzy, kde-format 7318 #| msgid "Av" 7319 msgctxt "Julian month 4 - KLocale::NarrowName" 7320 msgid "A" 7321 msgstr "અવ" 7322 7323 #: kdecore/kcalendarsystemjulian.cpp:180 7324 #, kde-format 7325 msgctxt "Julian month 5 - KLocale::NarrowName" 7326 msgid "M" 7327 msgstr "" 7328 7329 #: kdecore/kcalendarsystemjulian.cpp:182 7330 #, kde-format 7331 msgctxt "Julian month 6 - KLocale::NarrowName" 7332 msgid "J" 7333 msgstr "" 7334 7335 #: kdecore/kcalendarsystemjulian.cpp:184 7336 #, kde-format 7337 msgctxt "Julian month 7 - KLocale::NarrowName" 7338 msgid "J" 7339 msgstr "" 7340 7341 #: kdecore/kcalendarsystemjulian.cpp:186 7342 #, fuzzy, kde-format 7343 #| msgid "Av" 7344 msgctxt "Julian month 8 - KLocale::NarrowName" 7345 msgid "A" 7346 msgstr "અવ" 7347 7348 #: kdecore/kcalendarsystemjulian.cpp:188 7349 #, kde-format 7350 msgctxt "Julian month 9 - KLocale::NarrowName" 7351 msgid "S" 7352 msgstr "" 7353 7354 #: kdecore/kcalendarsystemjulian.cpp:190 7355 #, kde-format 7356 msgctxt "Julian month 10 - KLocale::NarrowName" 7357 msgid "O" 7358 msgstr "" 7359 7360 #: kdecore/kcalendarsystemjulian.cpp:192 7361 #, kde-format 7362 msgctxt "Julian month 11 - KLocale::NarrowName" 7363 msgid "N" 7364 msgstr "" 7365 7366 #: kdecore/kcalendarsystemjulian.cpp:194 7367 #, kde-format 7368 msgctxt "Julian month 12 - KLocale::NarrowName" 7369 msgid "D" 7370 msgstr "" 7371 7372 #: kdecore/kcalendarsystemjulian.cpp:203 7373 #, fuzzy, kde-format 7374 #| msgctxt "of January" 7375 #| msgid "of Jan" 7376 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 7377 msgid "of Jan" 7378 msgstr "જાન નું" 7379 7380 #: kdecore/kcalendarsystemjulian.cpp:205 7381 #, fuzzy, kde-format 7382 #| msgctxt "of February" 7383 #| msgid "of Feb" 7384 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 7385 msgid "of Feb" 7386 msgstr "ફેબ નું" 7387 7388 #: kdecore/kcalendarsystemjulian.cpp:207 7389 #, fuzzy, kde-format 7390 #| msgctxt "of March" 7391 #| msgid "of Mar" 7392 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 7393 msgid "of Mar" 7394 msgstr "માર્ચ નું" 7395 7396 #: kdecore/kcalendarsystemjulian.cpp:209 7397 #, fuzzy, kde-format 7398 #| msgctxt "of April" 7399 #| msgid "of Apr" 7400 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7401 msgid "of Apr" 7402 msgstr "એપ્રિલ નું" 7403 7404 #: kdecore/kcalendarsystemjulian.cpp:211 7405 #, fuzzy, kde-format 7406 #| msgctxt "of May short" 7407 #| msgid "of May" 7408 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7409 msgid "of May" 7410 msgstr "મે નું" 7411 7412 #: kdecore/kcalendarsystemjulian.cpp:213 7413 #, fuzzy, kde-format 7414 #| msgctxt "of June" 7415 #| msgid "of Jun" 7416 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7417 msgid "of Jun" 7418 msgstr "જુન નું" 7419 7420 #: kdecore/kcalendarsystemjulian.cpp:215 7421 #, fuzzy, kde-format 7422 #| msgctxt "of July" 7423 #| msgid "of Jul" 7424 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7425 msgid "of Jul" 7426 msgstr "જુલ નું" 7427 7428 #: kdecore/kcalendarsystemjulian.cpp:217 7429 #, fuzzy, kde-format 7430 #| msgctxt "of August" 7431 #| msgid "of Aug" 7432 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7433 msgid "of Aug" 7434 msgstr "ઓગ નું" 7435 7436 #: kdecore/kcalendarsystemjulian.cpp:219 7437 #, fuzzy, kde-format 7438 #| msgctxt "of September" 7439 #| msgid "of Sep" 7440 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7441 msgid "of Sep" 7442 msgstr "સપ્ટે નું" 7443 7444 #: kdecore/kcalendarsystemjulian.cpp:221 7445 #, fuzzy, kde-format 7446 #| msgctxt "of October" 7447 #| msgid "of Oct" 7448 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7449 msgid "of Oct" 7450 msgstr "ઓક્ટ નું" 7451 7452 #: kdecore/kcalendarsystemjulian.cpp:223 7453 #, fuzzy, kde-format 7454 #| msgctxt "of November" 7455 #| msgid "of Nov" 7456 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7457 msgid "of Nov" 7458 msgstr "નવે નું" 7459 7460 #: kdecore/kcalendarsystemjulian.cpp:225 7461 #, fuzzy, kde-format 7462 #| msgctxt "of December" 7463 #| msgid "of Dec" 7464 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7465 msgid "of Dec" 7466 msgstr "ડિસે નું" 7467 7468 #: kdecore/kcalendarsystemjulian.cpp:234 7469 #, fuzzy, kde-format 7470 #| msgctxt "January" 7471 #| msgid "Jan" 7472 msgctxt "Julian month 1 - KLocale::ShortName" 7473 msgid "Jan" 7474 msgstr "જાન" 7475 7476 #: kdecore/kcalendarsystemjulian.cpp:236 7477 #, fuzzy, kde-format 7478 #| msgctxt "February" 7479 #| msgid "Feb" 7480 msgctxt "Julian month 2 - KLocale::ShortName" 7481 msgid "Feb" 7482 msgstr "ફેબ્રુ" 7483 7484 #: kdecore/kcalendarsystemjulian.cpp:238 7485 #, fuzzy, kde-format 7486 #| msgctxt "March" 7487 #| msgid "Mar" 7488 msgctxt "Julian month 3 - KLocale::ShortName" 7489 msgid "Mar" 7490 msgstr "માર્ચ" 7491 7492 #: kdecore/kcalendarsystemjulian.cpp:240 7493 #, fuzzy, kde-format 7494 #| msgctxt "April" 7495 #| msgid "Apr" 7496 msgctxt "Julian month 4 - KLocale::ShortName" 7497 msgid "Apr" 7498 msgstr "એપ્ર" 7499 7500 #: kdecore/kcalendarsystemjulian.cpp:242 7501 #, fuzzy, kde-format 7502 #| msgctxt "May short" 7503 #| msgid "May" 7504 msgctxt "Julian month 5 - KLocale::ShortName" 7505 msgid "May" 7506 msgstr "મે" 7507 7508 #: kdecore/kcalendarsystemjulian.cpp:244 7509 #, fuzzy, kde-format 7510 #| msgctxt "June" 7511 #| msgid "Jun" 7512 msgctxt "Julian month 6 - KLocale::ShortName" 7513 msgid "Jun" 7514 msgstr "જુન" 7515 7516 #: kdecore/kcalendarsystemjulian.cpp:246 7517 #, fuzzy, kde-format 7518 #| msgctxt "July" 7519 #| msgid "Jul" 7520 msgctxt "Julian month 7 - KLocale::ShortName" 7521 msgid "Jul" 7522 msgstr "જુલ" 7523 7524 #: kdecore/kcalendarsystemjulian.cpp:248 7525 #, fuzzy, kde-format 7526 #| msgctxt "August" 7527 #| msgid "Aug" 7528 msgctxt "Julian month 8 - KLocale::ShortName" 7529 msgid "Aug" 7530 msgstr "ઓગ" 7531 7532 #: kdecore/kcalendarsystemjulian.cpp:250 7533 #, fuzzy, kde-format 7534 #| msgctxt "September" 7535 #| msgid "Sep" 7536 msgctxt "Julian month 9 - KLocale::ShortName" 7537 msgid "Sep" 7538 msgstr "સપ્ટે" 7539 7540 #: kdecore/kcalendarsystemjulian.cpp:252 7541 #, fuzzy, kde-format 7542 #| msgctxt "October" 7543 #| msgid "Oct" 7544 msgctxt "Julian month 10 - KLocale::ShortName" 7545 msgid "Oct" 7546 msgstr "ઓક્ટ" 7547 7548 #: kdecore/kcalendarsystemjulian.cpp:254 7549 #, fuzzy, kde-format 7550 #| msgctxt "November" 7551 #| msgid "Nov" 7552 msgctxt "Julian month 11 - KLocale::ShortName" 7553 msgid "Nov" 7554 msgstr "નવે" 7555 7556 #: kdecore/kcalendarsystemjulian.cpp:256 7557 #, fuzzy, kde-format 7558 #| msgctxt "December" 7559 #| msgid "Dec" 7560 msgctxt "Julian month 12 - KLocale::ShortName" 7561 msgid "Dec" 7562 msgstr "ડિસે" 7563 7564 #: kdecore/kcalendarsystemjulian.cpp:265 7565 #, fuzzy, kde-format 7566 #| msgid "of January" 7567 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7568 msgid "of January" 7569 msgstr "જાન્યુઆરી નું" 7570 7571 #: kdecore/kcalendarsystemjulian.cpp:267 7572 #, fuzzy, kde-format 7573 #| msgid "of February" 7574 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7575 msgid "of February" 7576 msgstr "ફેબ્રુઆરી નું" 7577 7578 #: kdecore/kcalendarsystemjulian.cpp:269 7579 #, fuzzy, kde-format 7580 #| msgid "of March" 7581 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7582 msgid "of March" 7583 msgstr "માર્ચ નું" 7584 7585 #: kdecore/kcalendarsystemjulian.cpp:271 7586 #, fuzzy, kde-format 7587 #| msgid "of April" 7588 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7589 msgid "of April" 7590 msgstr "એપ્રિલ નું" 7591 7592 #: kdecore/kcalendarsystemjulian.cpp:273 7593 #, fuzzy, kde-format 7594 #| msgctxt "of May short" 7595 #| msgid "of May" 7596 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7597 msgid "of May" 7598 msgstr "મે નું" 7599 7600 #: kdecore/kcalendarsystemjulian.cpp:275 7601 #, fuzzy, kde-format 7602 #| msgid "of June" 7603 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7604 msgid "of June" 7605 msgstr "જૂન નું" 7606 7607 #: kdecore/kcalendarsystemjulian.cpp:277 7608 #, fuzzy, kde-format 7609 #| msgid "of July" 7610 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7611 msgid "of July" 7612 msgstr "જુલાઈ નું" 7613 7614 #: kdecore/kcalendarsystemjulian.cpp:279 7615 #, fuzzy, kde-format 7616 #| msgid "of August" 7617 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7618 msgid "of August" 7619 msgstr "ઓગસ્ટ નું" 7620 7621 #: kdecore/kcalendarsystemjulian.cpp:281 7622 #, fuzzy, kde-format 7623 #| msgid "of September" 7624 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7625 msgid "of September" 7626 msgstr "સપ્ટેમ્બર નું" 7627 7628 #: kdecore/kcalendarsystemjulian.cpp:283 7629 #, fuzzy, kde-format 7630 #| msgid "of October" 7631 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7632 msgid "of October" 7633 msgstr "ઓક્ટોબર નું" 7634 7635 #: kdecore/kcalendarsystemjulian.cpp:285 7636 #, fuzzy, kde-format 7637 #| msgid "of November" 7638 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7639 msgid "of November" 7640 msgstr "નવેમ્બર નું" 7641 7642 #: kdecore/kcalendarsystemjulian.cpp:287 7643 #, fuzzy, kde-format 7644 #| msgid "of December" 7645 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7646 msgid "of December" 7647 msgstr "ડિસેમ્બર નું" 7648 7649 #: kdecore/kcalendarsystemjulian.cpp:296 7650 #, fuzzy, kde-format 7651 #| msgid "January" 7652 msgctxt "Julian month 1 - KLocale::LongName" 7653 msgid "January" 7654 msgstr "જાન્યુઆરી" 7655 7656 #: kdecore/kcalendarsystemjulian.cpp:298 7657 #, fuzzy, kde-format 7658 #| msgid "February" 7659 msgctxt "Julian month 2 - KLocale::LongName" 7660 msgid "February" 7661 msgstr "ફેબ્રુઆરી" 7662 7663 #: kdecore/kcalendarsystemjulian.cpp:300 7664 #, fuzzy, kde-format 7665 #| msgctxt "March long" 7666 #| msgid "March" 7667 msgctxt "Julian month 3 - KLocale::LongName" 7668 msgid "March" 7669 msgstr "માર્ચ" 7670 7671 #: kdecore/kcalendarsystemjulian.cpp:302 7672 #, fuzzy, kde-format 7673 #| msgid "April" 7674 msgctxt "Julian month 4 - KLocale::LongName" 7675 msgid "April" 7676 msgstr "એપ્રિલ" 7677 7678 #: kdecore/kcalendarsystemjulian.cpp:304 7679 #, fuzzy, kde-format 7680 #| msgctxt "May short" 7681 #| msgid "May" 7682 msgctxt "Julian month 5 - KLocale::LongName" 7683 msgid "May" 7684 msgstr "મે" 7685 7686 #: kdecore/kcalendarsystemjulian.cpp:306 7687 #, fuzzy, kde-format 7688 #| msgid "June" 7689 msgctxt "Julian month 6 - KLocale::LongName" 7690 msgid "June" 7691 msgstr "જૂન" 7692 7693 #: kdecore/kcalendarsystemjulian.cpp:308 7694 #, fuzzy, kde-format 7695 #| msgid "July" 7696 msgctxt "Julian month 7 - KLocale::LongName" 7697 msgid "July" 7698 msgstr "જૂલાઈ" 7699 7700 #: kdecore/kcalendarsystemjulian.cpp:310 7701 #, fuzzy, kde-format 7702 #| msgctxt "August long" 7703 #| msgid "August" 7704 msgctxt "Julian month 8 - KLocale::LongName" 7705 msgid "August" 7706 msgstr "ઓગસ્ટ" 7707 7708 #: kdecore/kcalendarsystemjulian.cpp:312 7709 #, fuzzy, kde-format 7710 #| msgid "September" 7711 msgctxt "Julian month 9 - KLocale::LongName" 7712 msgid "September" 7713 msgstr "સપ્ટેમ્બર" 7714 7715 #: kdecore/kcalendarsystemjulian.cpp:314 7716 #, fuzzy, kde-format 7717 #| msgid "October" 7718 msgctxt "Julian month 10 - KLocale::LongName" 7719 msgid "October" 7720 msgstr "ઓક્ટોબર" 7721 7722 #: kdecore/kcalendarsystemjulian.cpp:316 7723 #, fuzzy, kde-format 7724 #| msgid "November" 7725 msgctxt "Julian month 11 - KLocale::LongName" 7726 msgid "November" 7727 msgstr "નવેમ્બર" 7728 7729 #: kdecore/kcalendarsystemjulian.cpp:318 7730 #, fuzzy, kde-format 7731 #| msgid "December" 7732 msgctxt "Julian month 12 - KLocale::LongName" 7733 msgid "December" 7734 msgstr "ડિસેમ્બર" 7735 7736 #: kdecore/kcalendarsystemjulian.cpp:331 7737 #, kde-format 7738 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7739 msgid "M" 7740 msgstr "" 7741 7742 #: kdecore/kcalendarsystemjulian.cpp:333 7743 #, kde-format 7744 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7745 msgid "T" 7746 msgstr "" 7747 7748 #: kdecore/kcalendarsystemjulian.cpp:335 7749 #, kde-format 7750 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7751 msgid "W" 7752 msgstr "" 7753 7754 #: kdecore/kcalendarsystemjulian.cpp:337 7755 #, kde-format 7756 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7757 msgid "T" 7758 msgstr "" 7759 7760 #: kdecore/kcalendarsystemjulian.cpp:339 7761 #, kde-format 7762 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7763 msgid "F" 7764 msgstr "" 7765 7766 #: kdecore/kcalendarsystemjulian.cpp:341 7767 #, kde-format 7768 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7769 msgid "S" 7770 msgstr "" 7771 7772 #: kdecore/kcalendarsystemjulian.cpp:343 7773 #, kde-format 7774 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7775 msgid "S" 7776 msgstr "" 7777 7778 #: kdecore/kcalendarsystemjulian.cpp:352 7779 #, fuzzy, kde-format 7780 #| msgctxt "Monday" 7781 #| msgid "Mon" 7782 msgctxt "Julian weekday 1 - KLocale::ShortName" 7783 msgid "Mon" 7784 msgstr "સોમ" 7785 7786 #: kdecore/kcalendarsystemjulian.cpp:354 7787 #, fuzzy, kde-format 7788 #| msgctxt "Tuesday" 7789 #| msgid "Tue" 7790 msgctxt "Julian weekday 2 - KLocale::ShortName" 7791 msgid "Tue" 7792 msgstr "મંગળ" 7793 7794 #: kdecore/kcalendarsystemjulian.cpp:356 7795 #, fuzzy, kde-format 7796 #| msgctxt "Wednesday" 7797 #| msgid "Wed" 7798 msgctxt "Julian weekday 3 - KLocale::ShortName" 7799 msgid "Wed" 7800 msgstr "બુધ" 7801 7802 #: kdecore/kcalendarsystemjulian.cpp:358 7803 #, fuzzy, kde-format 7804 #| msgctxt "Thursday" 7805 #| msgid "Thu" 7806 msgctxt "Julian weekday 4 - KLocale::ShortName" 7807 msgid "Thu" 7808 msgstr "ગુરુ" 7809 7810 #: kdecore/kcalendarsystemjulian.cpp:360 7811 #, fuzzy, kde-format 7812 #| msgctxt "Friday" 7813 #| msgid "Fri" 7814 msgctxt "Julian weekday 5 - KLocale::ShortName" 7815 msgid "Fri" 7816 msgstr "શુક્ર" 7817 7818 #: kdecore/kcalendarsystemjulian.cpp:362 7819 #, fuzzy, kde-format 7820 #| msgctxt "Saturday" 7821 #| msgid "Sat" 7822 msgctxt "Julian weekday 6 - KLocale::ShortName" 7823 msgid "Sat" 7824 msgstr "શનિ" 7825 7826 #: kdecore/kcalendarsystemjulian.cpp:364 7827 #, fuzzy, kde-format 7828 #| msgctxt "Sunday" 7829 #| msgid "Sun" 7830 msgctxt "Julian weekday 7 - KLocale::ShortName" 7831 msgid "Sun" 7832 msgstr "રવિ" 7833 7834 #: kdecore/kcalendarsystemjulian.cpp:371 7835 #, fuzzy, kde-format 7836 #| msgid "Monday" 7837 msgctxt "Julian weekday 1 - KLocale::LongName" 7838 msgid "Monday" 7839 msgstr "સોમવાર" 7840 7841 #: kdecore/kcalendarsystemjulian.cpp:373 7842 #, fuzzy, kde-format 7843 #| msgid "Tuesday" 7844 msgctxt "Julian weekday 2 - KLocale::LongName" 7845 msgid "Tuesday" 7846 msgstr "મંગળવાર" 7847 7848 #: kdecore/kcalendarsystemjulian.cpp:375 7849 #, fuzzy, kde-format 7850 #| msgid "Wednesday" 7851 msgctxt "Julian weekday 3 - KLocale::LongName" 7852 msgid "Wednesday" 7853 msgstr "બુધવાર" 7854 7855 #: kdecore/kcalendarsystemjulian.cpp:377 7856 #, fuzzy, kde-format 7857 #| msgid "Thursday" 7858 msgctxt "Julian weekday 4 - KLocale::LongName" 7859 msgid "Thursday" 7860 msgstr "ગુરુવાર" 7861 7862 #: kdecore/kcalendarsystemjulian.cpp:379 7863 #, fuzzy, kde-format 7864 #| msgid "Friday" 7865 msgctxt "Julian weekday 5 - KLocale::LongName" 7866 msgid "Friday" 7867 msgstr "શુક્રવાર" 7868 7869 #: kdecore/kcalendarsystemjulian.cpp:381 7870 #, fuzzy, kde-format 7871 #| msgid "Saturday" 7872 msgctxt "Julian weekday 6 - KLocale::LongName" 7873 msgid "Saturday" 7874 msgstr "શનિવાર" 7875 7876 #: kdecore/kcalendarsystemjulian.cpp:383 7877 #, fuzzy, kde-format 7878 #| msgid "Sunday" 7879 msgctxt "Julian weekday 7 - KLocale::LongName" 7880 msgid "Sunday" 7881 msgstr "રવિવાર" 7882 7883 #: kdecore/kcalendarsystemminguo.cpp:57 7884 #, kde-format 7885 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7886 msgid "Republic of China Era" 7887 msgstr "" 7888 7889 #: kdecore/kcalendarsystemminguo.cpp:58 7890 #, kde-format 7891 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7892 msgid "ROC" 7893 msgstr "" 7894 7895 #: kdecore/kcalendarsystemminguo.cpp:59 7896 #, kde-format 7897 msgctxt "" 7898 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7899 msgid "%EC %Ey" 7900 msgstr "" 7901 7902 #: kdecore/kcalendarsystemthai.cpp:58 7903 #, kde-format 7904 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7905 msgid "Buddhist Era" 7906 msgstr "" 7907 7908 #: kdecore/kcalendarsystemthai.cpp:59 7909 #, kde-format 7910 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7911 msgid "BE" 7912 msgstr "" 7913 7914 #: kdecore/kcalendarsystemthai.cpp:60 7915 #, kde-format 7916 msgctxt "" 7917 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7918 msgid "%Ey %EC" 7919 msgstr "" 7920 7921 #: kdecore/kcmdlineargs.cpp:278 7922 #, kde-format 7923 msgid "Use the X-server display 'displayname'" 7924 msgstr "X-સર્વર ડિસ્પ્લે 'ડિસ્પ્લેનામ' વાપરો" 7925 7926 #: kdecore/kcmdlineargs.cpp:281 7927 #, kde-format 7928 msgid "Restore the application for the given 'sessionId'" 7929 msgstr "આપેલ 'sessionId' માટે કાર્યક્રમ પુનઃસંગ્રહો" 7930 7931 #: kdecore/kcmdlineargs.cpp:282 7932 #, kde-format 7933 msgid "" 7934 "Causes the application to install a private color\n" 7935 "map on an 8-bit display" 7936 msgstr "" 7937 "કાર્યક્રમને ૮-બીટ ડિસ્પ્લે પર ખાનગી રંગ નકશો સ્થાપિત કરવા\n" 7938 "માટેનું કારણ બને છે" 7939 7940 #: kdecore/kcmdlineargs.cpp:283 7941 #, kde-format 7942 msgid "" 7943 "Limits the number of colors allocated in the color\n" 7944 "cube on an 8-bit display, if the application is\n" 7945 "using the QApplication::ManyColor color\n" 7946 "specification" 7947 msgstr "" 7948 "૮-બીટ ડિસ્પ્લેના ફ્રેમમાંના રંગમાં સમાવાયેલ રંગોની સંખ્યા પર\n" 7949 "મર્યાદા મૂકે છે, જો કાર્યક્રમ એ QApplication::ManyColor\n" 7950 "રંગ સ્પષ્ટીકરણ વાપરી રહ્યું\n" 7951 "હોય" 7952 7953 #: kdecore/kcmdlineargs.cpp:284 7954 #, kde-format 7955 msgid "tells Qt to never grab the mouse or the keyboard" 7956 msgstr "Qt ને ક્યારેય માઉસ અથવા કીબોર્ડ નહી મેળવવા માટે કહે છે" 7957 7958 #: kdecore/kcmdlineargs.cpp:285 7959 #, kde-format 7960 msgid "" 7961 "running under a debugger can cause an implicit\n" 7962 "-nograb, use -dograb to override" 7963 msgstr "" 7964 "ડિબગર હેઠળ ચલાવવાનું -nograb વાપરવાનું કારણ બનશે,\n" 7965 "ફરીથી લખવા માટે -dograb વાપરો" 7966 7967 #: kdecore/kcmdlineargs.cpp:286 7968 #, kde-format 7969 msgid "switches to synchronous mode for debugging" 7970 msgstr "ડિબગીંગ માટે સુમેળ સ્થિતિમાં ફેરવાય છે" 7971 7972 #: kdecore/kcmdlineargs.cpp:288 7973 #, kde-format 7974 msgid "defines the application font" 7975 msgstr "કાર્યક્રમ ફોન્ટ વ્યાખ્યાયિત કરે છે" 7976 7977 #: kdecore/kcmdlineargs.cpp:290 7978 #, kde-format 7979 msgid "" 7980 "sets the default background color and an\n" 7981 "application palette (light and dark shades are\n" 7982 "calculated)" 7983 msgstr "" 7984 "મૂળભૂત પાશ્વભાગ રંગ સુયોજિત કરે છે અને\n" 7985 "કાર્યક્રમ તકતી પણ સુયોજિત કરે છે (આછા અને ઘાટા પડછાયાઓની\n" 7986 "ગણતરી થાય છે)" 7987 7988 #: kdecore/kcmdlineargs.cpp:292 7989 #, kde-format 7990 msgid "sets the default foreground color" 7991 msgstr "મૂળભૂત અગ્ર ભાગનો રંગ સુયોજિત કરે છે" 7992 7993 #: kdecore/kcmdlineargs.cpp:294 7994 #, kde-format 7995 msgid "sets the default button color" 7996 msgstr "મૂળભૂત બટન રંગ સુયોજિત કરે છે" 7997 7998 #: kdecore/kcmdlineargs.cpp:295 7999 #, kde-format 8000 msgid "sets the application name" 8001 msgstr "કાર્યક્રમ નામ સુયોજિત કરે છે" 8002 8003 #: kdecore/kcmdlineargs.cpp:296 8004 #, kde-format 8005 msgid "sets the application title (caption)" 8006 msgstr "કાર્યક્રમ શીર્ષક સુયોજિત કરે છે (કેપ્શન)" 8007 8008 #: kdecore/kcmdlineargs.cpp:297 8009 #, kde-format 8010 msgid "load the testability framework" 8011 msgstr "" 8012 8013 #: kdecore/kcmdlineargs.cpp:299 8014 #, kde-format 8015 msgid "" 8016 "forces the application to use a TrueColor visual on\n" 8017 "an 8-bit display" 8018 msgstr "" 8019 "કાર્યક્રમને ૮-બીટ ડિસ્પ્લે પર TrueColor દૃશ્ય વાપરવા માટે\n" 8020 "દબાણ કરે છે" 8021 8022 #: kdecore/kcmdlineargs.cpp:300 8023 #, kde-format 8024 msgid "" 8025 "sets XIM (X Input Method) input style. Possible\n" 8026 "values are onthespot, overthespot, offthespot and\n" 8027 "root" 8028 msgstr "" 8029 "XIM (X Input Method) ઈનપુટ શૈલી સુયોજિત કરે છે. શક્ય કિંમતો\n" 8030 "onthespot, overthespot, offthespot અને\n" 8031 "root છે" 8032 8033 #: kdecore/kcmdlineargs.cpp:301 8034 #, kde-format 8035 msgid "set XIM server" 8036 msgstr "XIM સર્વર સુયોજિત કરો" 8037 8038 #: kdecore/kcmdlineargs.cpp:302 8039 #, kde-format 8040 msgid "disable XIM" 8041 msgstr "XIM નિષ્ક્રિય કરો" 8042 8043 #: kdecore/kcmdlineargs.cpp:304 8044 #, kde-format 8045 msgid "mirrors the whole layout of widgets" 8046 msgstr "વિજેટોના આખા દેખાવનું દર્પણ બનાવે છે" 8047 8048 #: kdecore/kcmdlineargs.cpp:305 8049 #, kde-format 8050 msgid "applies the Qt stylesheet to the application widgets" 8051 msgstr "Qt સ્ટાઇલશીટને કાર્યક્રમ વિજેટો પર લાગુ પાડે છે" 8052 8053 #: kdecore/kcmdlineargs.cpp:306 8054 #, kde-format 8055 msgid "" 8056 "use a different graphics system instead of the default one, options are " 8057 "raster and opengl (experimental)" 8058 msgstr "" 8059 "મૂળભૂતની જગ્યાએ અલગ ગ્રાફિક્સ સિસ્ટમ વાપરો, વિકલ્પો છે રાસ્ટર અને ઓપનજીએલ (પ્રાયોગિક)" 8060 8061 #: kdecore/kcmdlineargs.cpp:307 8062 #, kde-format 8063 msgid "" 8064 "QML JS debugger information. Application must be\n" 8065 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 8066 "enabled" 8067 msgstr "" 8068 8069 #: kdecore/kcmdlineargs.cpp:308 8070 #, kde-format 8071 msgid "The windowing system platform (e.g. xcb or wayland)" 8072 msgstr "" 8073 8074 #: kdecore/kcmdlineargs.cpp:310 8075 #, kde-format 8076 msgid "Use 'caption' as name in the titlebar" 8077 msgstr "શીર્ષકપટ્ટીમાં 'કેપ્શન' ને નામ તરીકે વાપરો" 8078 8079 #: kdecore/kcmdlineargs.cpp:311 8080 #, kde-format 8081 msgid "Use 'icon' as the application icon" 8082 msgstr "કાર્યક્રમ ચિહ્ન તરીકે 'ચિહ્ન' વાપરો" 8083 8084 #: kdecore/kcmdlineargs.cpp:312 8085 #, kde-format 8086 msgid "Use alternative configuration file" 8087 msgstr "વૈકલ્પિક રૂપરેખાંકન ફાઈલ વાપરો" 8088 8089 #: kdecore/kcmdlineargs.cpp:313 8090 #, kde-format 8091 msgid "Disable crash handler, to get core dumps" 8092 msgstr "ક્રેશ નિયંત્રક નિષ્ક્રિય કરો, મૂળ ડમ્પ મેળવવા માટે" 8093 8094 #: kdecore/kcmdlineargs.cpp:315 8095 #, kde-format 8096 msgid "Waits for a WM_NET compatible windowmanager" 8097 msgstr "WM_NET સુસંગત વિન્ડોવ્યવસ્થાપક માટે રાહ જુએ છે" 8098 8099 #: kdecore/kcmdlineargs.cpp:317 8100 #, kde-format 8101 msgid "sets the application GUI style" 8102 msgstr "કાર્યક્રમ GUI શૈલી સુયોજિત કરે છે" 8103 8104 #: kdecore/kcmdlineargs.cpp:318 8105 #, fuzzy, kde-format 8106 #| msgid "" 8107 #| "sets the client geometry of the main widget - see man X for the argument " 8108 #| "format" 8109 msgid "" 8110 "sets the client geometry of the main widget - see man X for the argument " 8111 "format (usually WidthxHeight+XPos+YPos)" 8112 msgstr "મુખ્ય વિજેટની ક્લાયન્ટ ભૂમિતી સુયોજિત કરે છે - વિકલ્પ બંધારણ માટે man X જુઓ" 8113 8114 #: kdecore/kcmdlineargs.cpp:436 8115 #, kde-format 8116 msgid "KDE Application" 8117 msgstr "KDE કાર્યક્રમ" 8118 8119 #: kdecore/kcmdlineargs.cpp:497 8120 #, kde-format 8121 msgid "Qt" 8122 msgstr "Qt" 8123 8124 #: kdecore/kcmdlineargs.cpp:500 8125 #, kde-format 8126 msgid "KDE" 8127 msgstr "KDE" 8128 8129 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 8130 #, fuzzy, kde-format 8131 #| msgid "ERROR: Unknown protocol '%1'" 8132 msgid "Unknown option '%1'." 8133 msgstr "ક્ષતિ: અજાણ્યો પ્રોટોકોલ '%1'" 8134 8135 #: kdecore/kcmdlineargs.cpp:841 8136 #, kde-format 8137 msgctxt "@info:shell %1 is cmdoption name" 8138 msgid "'%1' missing." 8139 msgstr "'%1' ગુમ થયેલ છે." 8140 8141 #: kdecore/kcmdlineargs.cpp:895 8142 #, kde-format 8143 msgctxt "" 8144 "@info:shell message on appcmd --version; do not translate 'Development " 8145 "Platform'%3 application name, other %n version strings" 8146 msgid "" 8147 "Qt: %1\n" 8148 "KDE Frameworks: %2\n" 8149 "%3: %4\n" 8150 msgstr "" 8151 8152 #: kdecore/kcmdlineargs.cpp:921 8153 #, kde-format 8154 msgctxt "the 2nd argument is a list of name+address, one on each line" 8155 msgid "" 8156 "%1 was written by\n" 8157 "%2" 8158 msgstr "" 8159 "%1 લખાયું છે આમનાં દ્વારા\n" 8160 "%2" 8161 8162 #: kdecore/kcmdlineargs.cpp:924 8163 #, kde-format 8164 msgid "This application was written by somebody who wants to remain anonymous." 8165 msgstr "" 8166 8167 #: kdecore/kcmdlineargs.cpp:929 8168 #, kde-format 8169 msgid "Please use http://bugs.kde.org to report bugs.\n" 8170 msgstr "" 8171 8172 #: kdecore/kcmdlineargs.cpp:931 8173 #, kde-format 8174 msgid "Please report bugs to %1.\n" 8175 msgstr "" 8176 8177 #: kdecore/kcmdlineargs.cpp:961 8178 #, kde-format 8179 msgid "Unexpected argument '%1'." 8180 msgstr "" 8181 8182 #: kdecore/kcmdlineargs.cpp:1074 8183 #, kde-format 8184 msgid "Use --help to get a list of available command line options." 8185 msgstr "" 8186 8187 #: kdecore/kcmdlineargs.cpp:1096 8188 #, kde-format 8189 msgid "[options] " 8190 msgstr "" 8191 8192 #: kdecore/kcmdlineargs.cpp:1101 8193 #, kde-format 8194 msgid "[%1-options]" 8195 msgstr "" 8196 8197 #: kdecore/kcmdlineargs.cpp:1122 8198 #, kde-format 8199 msgid "Usage: %1 %2\n" 8200 msgstr "" 8201 8202 #: kdecore/kcmdlineargs.cpp:1125 8203 #, kde-format 8204 msgid "" 8205 "\n" 8206 "Generic options:\n" 8207 msgstr "" 8208 8209 #: kdecore/kcmdlineargs.cpp:1127 8210 #, kde-format 8211 msgid "Show help about options" 8212 msgstr "" 8213 8214 #: kdecore/kcmdlineargs.cpp:1133 8215 #, kde-format 8216 msgid "Show %1 specific options" 8217 msgstr "" 8218 8219 #: kdecore/kcmdlineargs.cpp:1140 8220 #, fuzzy, kde-format 8221 #| msgid "most locations" 8222 msgid "Show all options" 8223 msgstr "મોટાભાગનાં સ્થળો" 8224 8225 #: kdecore/kcmdlineargs.cpp:1141 8226 #, kde-format 8227 msgid "Show author information" 8228 msgstr "" 8229 8230 #: kdecore/kcmdlineargs.cpp:1142 8231 #, kde-format 8232 msgid "Show version information" 8233 msgstr "" 8234 8235 #: kdecore/kcmdlineargs.cpp:1143 8236 #, kde-format 8237 msgid "Show license information" 8238 msgstr "" 8239 8240 #: kdecore/kcmdlineargs.cpp:1144 8241 #, kde-format 8242 msgid "End of options" 8243 msgstr "" 8244 8245 #: kdecore/kcmdlineargs.cpp:1164 8246 #, kde-format 8247 msgid "" 8248 "\n" 8249 "%1 options:\n" 8250 msgstr "" 8251 8252 #: kdecore/kcmdlineargs.cpp:1166 8253 #, kde-format 8254 msgid "" 8255 "\n" 8256 "Options:\n" 8257 msgstr "" 8258 8259 #: kdecore/kcmdlineargs.cpp:1219 8260 #, kde-format 8261 msgid "" 8262 "\n" 8263 "Arguments:\n" 8264 msgstr "" 8265 8266 #: kdecore/kcmdlineargs.cpp:1580 8267 #, kde-format 8268 msgid "The files/URLs opened by the application will be deleted after use" 8269 msgstr "કાર્યક્રમ દ્વારા ખૂલેલી ફાઈલો/URL વપરાશ પછી કાઢી નાંખવામાં આવશે" 8270 8271 #: kdecore/kcmdlineargs.cpp:1581 8272 #, kde-format 8273 msgid "KDE-tempfile" 8274 msgstr "KDE-કામચલાઉફાઇલ" 8275 8276 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8277 #: kdecore/kdatetime.cpp:2985 8278 #, fuzzy, kde-format 8279 #| msgctxt "Coptic month 8 - ShortName" 8280 #| msgid "Pam" 8281 msgid "am" 8282 msgstr "પામ" 8283 8284 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8285 #: kdecore/kdatetime.cpp:2990 8286 #, kde-format 8287 msgid "pm" 8288 msgstr "સાંજ" 8289 8290 #: kdecore/klibloader.cpp:100 8291 #, kde-format 8292 msgid "Library \"%1\" not found" 8293 msgstr "લાઈબ્રેરી \"%1\" મળી નહી" 8294 8295 #: kdecore/klocale_kde.cpp:785 8296 #, kde-format 8297 msgctxt "digit set" 8298 msgid "Arabic-Indic" 8299 msgstr "અરેબિક-ઇન્ડિક" 8300 8301 #: kdecore/klocale_kde.cpp:788 8302 #, kde-format 8303 msgctxt "digit set" 8304 msgid "Bengali" 8305 msgstr "બંગાળી" 8306 8307 #: kdecore/klocale_kde.cpp:791 8308 #, kde-format 8309 msgctxt "digit set" 8310 msgid "Devanagari" 8311 msgstr "દેવનાગરી" 8312 8313 #: kdecore/klocale_kde.cpp:794 8314 #, kde-format 8315 msgctxt "digit set" 8316 msgid "Eastern Arabic-Indic" 8317 msgstr "પૂર્વીય અરેબિક-ઇન્ડિક" 8318 8319 #: kdecore/klocale_kde.cpp:797 8320 #, kde-format 8321 msgctxt "digit set" 8322 msgid "Gujarati" 8323 msgstr "ગુજરાતી" 8324 8325 #: kdecore/klocale_kde.cpp:800 8326 #, kde-format 8327 msgctxt "digit set" 8328 msgid "Gurmukhi" 8329 msgstr "ગુરુમુખી" 8330 8331 #: kdecore/klocale_kde.cpp:803 8332 #, kde-format 8333 msgctxt "digit set" 8334 msgid "Kannada" 8335 msgstr "કન્નડ" 8336 8337 #: kdecore/klocale_kde.cpp:806 8338 #, kde-format 8339 msgctxt "digit set" 8340 msgid "Khmer" 8341 msgstr "ખ્મેર" 8342 8343 #: kdecore/klocale_kde.cpp:809 8344 #, kde-format 8345 msgctxt "digit set" 8346 msgid "Malayalam" 8347 msgstr "મલયાલમ" 8348 8349 #: kdecore/klocale_kde.cpp:812 8350 #, kde-format 8351 msgctxt "digit set" 8352 msgid "Oriya" 8353 msgstr "ઓરીયા" 8354 8355 #: kdecore/klocale_kde.cpp:815 8356 #, kde-format 8357 msgctxt "digit set" 8358 msgid "Tamil" 8359 msgstr "તમિલ" 8360 8361 #: kdecore/klocale_kde.cpp:818 8362 #, kde-format 8363 msgctxt "digit set" 8364 msgid "Telugu" 8365 msgstr "તેલુગુ" 8366 8367 #: kdecore/klocale_kde.cpp:821 8368 #, fuzzy, kde-format 8369 #| msgid "R. Thaani" 8370 msgctxt "digit set" 8371 msgid "Thai" 8372 msgstr "ર. થાની" 8373 8374 #: kdecore/klocale_kde.cpp:824 8375 #, kde-format 8376 msgctxt "digit set" 8377 msgid "Arabic" 8378 msgstr "અરેબિક" 8379 8380 #: kdecore/klocale_kde.cpp:829 8381 #, kde-format 8382 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8383 msgid "%1 (%2)" 8384 msgstr "%1 (%2)" 8385 8386 #. i18n: comments below, they are used by the 8387 #. translators. 8388 #. This prefix is shared by all current dialects. 8389 #. i18n: Dumb message, avoid any markup or scripting. 8390 #: kdecore/klocale_kde.cpp:1327 8391 #, kde-format 8392 msgctxt "size in bytes" 8393 msgid "%1 B" 8394 msgstr "%1 બાઈટ" 8395 8396 #. i18n: Dumb message, avoid any markup or scripting. 8397 #: kdecore/klocale_kde.cpp:1332 8398 #, kde-format 8399 msgctxt "size in 1000 bytes" 8400 msgid "%1 kB" 8401 msgstr "%1 કેબી" 8402 8403 #. i18n: Dumb message, avoid any markup or scripting. 8404 #: kdecore/klocale_kde.cpp:1334 8405 #, kde-format 8406 msgctxt "size in 10^6 bytes" 8407 msgid "%1 MB" 8408 msgstr "%1 એમબી" 8409 8410 #. i18n: Dumb message, avoid any markup or scripting. 8411 #: kdecore/klocale_kde.cpp:1336 8412 #, kde-format 8413 msgctxt "size in 10^9 bytes" 8414 msgid "%1 GB" 8415 msgstr "%1 જીબી" 8416 8417 #. i18n: Dumb message, avoid any markup or scripting. 8418 #: kdecore/klocale_kde.cpp:1338 8419 #, kde-format 8420 msgctxt "size in 10^12 bytes" 8421 msgid "%1 TB" 8422 msgstr "%1 ટીબી" 8423 8424 #. i18n: Dumb message, avoid any markup or scripting. 8425 #: kdecore/klocale_kde.cpp:1340 8426 #, kde-format 8427 msgctxt "size in 10^15 bytes" 8428 msgid "%1 PB" 8429 msgstr "%1 પીબી" 8430 8431 #. i18n: Dumb message, avoid any markup or scripting. 8432 #: kdecore/klocale_kde.cpp:1342 8433 #, kde-format 8434 msgctxt "size in 10^18 bytes" 8435 msgid "%1 EB" 8436 msgstr "%1 ઈબી" 8437 8438 #. i18n: Dumb message, avoid any markup or scripting. 8439 #: kdecore/klocale_kde.cpp:1344 8440 #, kde-format 8441 msgctxt "size in 10^21 bytes" 8442 msgid "%1 ZB" 8443 msgstr "%1 ઝીબી" 8444 8445 #. i18n: Dumb message, avoid any markup or scripting. 8446 #: kdecore/klocale_kde.cpp:1346 8447 #, kde-format 8448 msgctxt "size in 10^24 bytes" 8449 msgid "%1 YB" 8450 msgstr "%1 વાયબી" 8451 8452 #. i18n: Dumb message, avoid any markup or scripting. 8453 #: kdecore/klocale_kde.cpp:1351 8454 #, kde-format 8455 msgctxt "memory size in 1024 bytes" 8456 msgid "%1 KB" 8457 msgstr "%1 કેબી" 8458 8459 #. i18n: Dumb message, avoid any markup or scripting. 8460 #: kdecore/klocale_kde.cpp:1353 8461 #, kde-format 8462 msgctxt "memory size in 2^20 bytes" 8463 msgid "%1 MB" 8464 msgstr "%1 એમબી" 8465 8466 #. i18n: Dumb message, avoid any markup or scripting. 8467 #: kdecore/klocale_kde.cpp:1355 8468 #, kde-format 8469 msgctxt "memory size in 2^30 bytes" 8470 msgid "%1 GB" 8471 msgstr "%1 જીબી" 8472 8473 #. i18n: Dumb message, avoid any markup or scripting. 8474 #: kdecore/klocale_kde.cpp:1357 8475 #, kde-format 8476 msgctxt "memory size in 2^40 bytes" 8477 msgid "%1 TB" 8478 msgstr "%1 ટીબી" 8479 8480 #. i18n: Dumb message, avoid any markup or scripting. 8481 #: kdecore/klocale_kde.cpp:1359 8482 #, fuzzy, kde-format 8483 #| msgctxt "size in 10^15 bytes" 8484 #| msgid "%1 PB" 8485 msgctxt "memory size in 2^50 bytes" 8486 msgid "%1 PB" 8487 msgstr "%1 પીબી" 8488 8489 #. i18n: Dumb message, avoid any markup or scripting. 8490 #: kdecore/klocale_kde.cpp:1361 8491 #, fuzzy, kde-format 8492 #| msgctxt "size in 10^18 bytes" 8493 #| msgid "%1 EB" 8494 msgctxt "memory size in 2^60 bytes" 8495 msgid "%1 EB" 8496 msgstr "%1 ઈબી" 8497 8498 #. i18n: Dumb message, avoid any markup or scripting. 8499 #: kdecore/klocale_kde.cpp:1363 8500 #, fuzzy, kde-format 8501 #| msgctxt "size in 10^21 bytes" 8502 #| msgid "%1 ZB" 8503 msgctxt "memory size in 2^70 bytes" 8504 msgid "%1 ZB" 8505 msgstr "%1 ઝીબી" 8506 8507 #. i18n: Dumb message, avoid any markup or scripting. 8508 #: kdecore/klocale_kde.cpp:1365 8509 #, fuzzy, kde-format 8510 #| msgctxt "size in 10^24 bytes" 8511 #| msgid "%1 YB" 8512 msgctxt "memory size in 2^80 bytes" 8513 msgid "%1 YB" 8514 msgstr "%1 વાયબી" 8515 8516 #. i18n: Dumb message, avoid any markup or scripting. 8517 #: kdecore/klocale_kde.cpp:1371 8518 #, kde-format 8519 msgctxt "size in 1024 bytes" 8520 msgid "%1 KiB" 8521 msgstr "%1 કેબી" 8522 8523 #. i18n: Dumb message, avoid any markup or scripting. 8524 #: kdecore/klocale_kde.cpp:1373 8525 #, kde-format 8526 msgctxt "size in 2^20 bytes" 8527 msgid "%1 MiB" 8528 msgstr "%1 એમબી" 8529 8530 #. i18n: Dumb message, avoid any markup or scripting. 8531 #: kdecore/klocale_kde.cpp:1375 8532 #, kde-format 8533 msgctxt "size in 2^30 bytes" 8534 msgid "%1 GiB" 8535 msgstr "%1 જીબી" 8536 8537 #. i18n: Dumb message, avoid any markup or scripting. 8538 #: kdecore/klocale_kde.cpp:1377 8539 #, kde-format 8540 msgctxt "size in 2^40 bytes" 8541 msgid "%1 TiB" 8542 msgstr "%1 ટીબી" 8543 8544 #. i18n: Dumb message, avoid any markup or scripting. 8545 #: kdecore/klocale_kde.cpp:1379 8546 #, fuzzy, kde-format 8547 #| msgctxt "size in 2^40 bytes" 8548 #| msgid "%1 PiB" 8549 msgctxt "size in 2^50 bytes" 8550 msgid "%1 PiB" 8551 msgstr "%1 પીબી" 8552 8553 #. i18n: Dumb message, avoid any markup or scripting. 8554 #: kdecore/klocale_kde.cpp:1381 8555 #, fuzzy, kde-format 8556 #| msgctxt "size in 2^50 bytes" 8557 #| msgid "%1 EiB" 8558 msgctxt "size in 2^60 bytes" 8559 msgid "%1 EiB" 8560 msgstr "%1 ઈબી" 8561 8562 #. i18n: Dumb message, avoid any markup or scripting. 8563 #: kdecore/klocale_kde.cpp:1383 8564 #, fuzzy, kde-format 8565 #| msgctxt "size in 2^60 bytes" 8566 #| msgid "%1 ZiB" 8567 msgctxt "size in 2^70 bytes" 8568 msgid "%1 ZiB" 8569 msgstr "%1 ઝીબી" 8570 8571 #. i18n: Dumb message, avoid any markup or scripting. 8572 #: kdecore/klocale_kde.cpp:1385 8573 #, fuzzy, kde-format 8574 #| msgctxt "size in 2^70 bytes" 8575 #| msgid "%1 YiB" 8576 msgctxt "size in 2^80 bytes" 8577 msgid "%1 YiB" 8578 msgstr "%1 વાયબી" 8579 8580 #: kdecore/klocale_kde.cpp:1472 8581 #, kde-format 8582 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8583 msgid "%1 days" 8584 msgstr "%1 દિવસો" 8585 8586 #: kdecore/klocale_kde.cpp:1475 8587 #, kde-format 8588 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8589 msgid "%1 hours" 8590 msgstr "%1 કલાકો" 8591 8592 #: kdecore/klocale_kde.cpp:1478 8593 #, kde-format 8594 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8595 msgid "%1 minutes" 8596 msgstr "%1 મિનિટો" 8597 8598 #: kdecore/klocale_kde.cpp:1481 8599 #, kde-format 8600 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8601 msgid "%1 seconds" 8602 msgstr "%1 સેકંડો" 8603 8604 #: kdecore/klocale_kde.cpp:1484 8605 #, kde-format 8606 msgctxt "@item:intext" 8607 msgid "%1 millisecond" 8608 msgid_plural "%1 milliseconds" 8609 msgstr[0] "" 8610 msgstr[1] "" 8611 8612 #: kdecore/klocale_kde.cpp:1491 8613 #, kde-format 8614 msgctxt "@item:intext" 8615 msgid "1 day" 8616 msgid_plural "%1 days" 8617 msgstr[0] "" 8618 msgstr[1] "" 8619 8620 #: kdecore/klocale_kde.cpp:1493 8621 #, kde-format 8622 msgctxt "@item:intext" 8623 msgid "1 hour" 8624 msgid_plural "%1 hours" 8625 msgstr[0] "" 8626 msgstr[1] "" 8627 8628 #: kdecore/klocale_kde.cpp:1495 8629 #, kde-format 8630 msgctxt "@item:intext" 8631 msgid "1 minute" 8632 msgid_plural "%1 minutes" 8633 msgstr[0] "" 8634 msgstr[1] "" 8635 8636 #: kdecore/klocale_kde.cpp:1497 8637 #, kde-format 8638 msgctxt "@item:intext" 8639 msgid "1 second" 8640 msgid_plural "%1 seconds" 8641 msgstr[0] "" 8642 msgstr[1] "" 8643 8644 #: kdecore/klocale_kde.cpp:1521 8645 #, kde-format 8646 msgctxt "" 8647 "@item:intext days and hours. This uses the previous item:intext messages. If " 8648 "this does not fit the grammar of your language please contact the i18n team " 8649 "to solve the problem" 8650 msgid "%1 and %2" 8651 msgstr "%1 અને %2" 8652 8653 #: kdecore/klocale_kde.cpp:1527 8654 #, kde-format 8655 msgctxt "" 8656 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8657 "If this does not fit the grammar of your language please contact the i18n " 8658 "team to solve the problem" 8659 msgid "%1 and %2" 8660 msgstr "%1 અને %2" 8661 8662 #: kdecore/klocale_kde.cpp:1534 8663 #, kde-format 8664 msgctxt "" 8665 "@item:intext minutes and seconds. This uses the previous item:intext " 8666 "messages. If this does not fit the grammar of your language please contact " 8667 "the i18n team to solve the problem" 8668 msgid "%1 and %2" 8669 msgstr "%1 અને %2" 8670 8671 #: kdecore/klocale_kde.cpp:2153 8672 #, kde-format 8673 msgctxt "Before Noon KLocale::LongName" 8674 msgid "Ante Meridiem" 8675 msgstr "" 8676 8677 #: kdecore/klocale_kde.cpp:2154 8678 #, fuzzy, kde-format 8679 #| msgid "Av" 8680 msgctxt "Before Noon KLocale::ShortName" 8681 msgid "AM" 8682 msgstr "અવ" 8683 8684 #: kdecore/klocale_kde.cpp:2155 8685 #, fuzzy, kde-format 8686 #| msgid "Av" 8687 msgctxt "Before Noon KLocale::NarrowName" 8688 msgid "A" 8689 msgstr "અવ" 8690 8691 #: kdecore/klocale_kde.cpp:2158 8692 #, kde-format 8693 msgctxt "After Noon KLocale::LongName" 8694 msgid "Post Meridiem" 8695 msgstr "" 8696 8697 #: kdecore/klocale_kde.cpp:2159 8698 #, kde-format 8699 msgctxt "After Noon KLocale::ShortName" 8700 msgid "PM" 8701 msgstr "" 8702 8703 #: kdecore/klocale_kde.cpp:2160 8704 #, kde-format 8705 msgctxt "After Noon KLocale::NarrowName" 8706 msgid "P" 8707 msgstr "" 8708 8709 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8710 #, kde-format 8711 msgctxt "concatenation of dates and time" 8712 msgid "%1 %2" 8713 msgstr "%1 %2" 8714 8715 #: kdecore/klocale_kde.cpp:2267 8716 #, kde-format 8717 msgctxt "concatenation of date/time and time zone" 8718 msgid "%1 %2" 8719 msgstr "%1 %2" 8720 8721 #: kdecore/ksavefile.cpp:99 8722 #, kde-format 8723 msgid "No target filename has been given." 8724 msgstr "" 8725 8726 #: kdecore/ksavefile.cpp:106 8727 #, kde-format 8728 msgid "Already opened." 8729 msgstr "" 8730 8731 #: kdecore/ksavefile.cpp:135 8732 #, kde-format 8733 msgid "Insufficient permissions in target directory." 8734 msgstr "" 8735 8736 #: kdecore/ksavefile.cpp:139 8737 #, kde-format 8738 msgid "Unable to open temporary file." 8739 msgstr "" 8740 8741 #: kdecore/ksavefile.cpp:249 8742 #, kde-format 8743 msgid "Synchronization to disk failed" 8744 msgstr "" 8745 8746 #: kdecore/ksavefile.cpp:280 8747 #, kde-format 8748 msgid "Error during rename." 8749 msgstr "" 8750 8751 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8752 #, kde-format 8753 msgid "Timed out trying to connect to remote host" 8754 msgstr "દૂરસ્થ યજમાન સાથે જોડાણ કરતી વખતે સમય સમાપ્તિ" 8755 8756 #: kdecore/netsupp.cpp:866 8757 #, kde-format 8758 msgid "address family for nodename not supported" 8759 msgstr "નોડનામ માટે સરનામાં કુળ આધારિત નથી" 8760 8761 #: kdecore/netsupp.cpp:868 8762 #, kde-format 8763 msgid "invalid value for 'ai_flags'" 8764 msgstr "'ai_flags' માટે અયોગ્ય કિંમત" 8765 8766 #: kdecore/netsupp.cpp:870 8767 #, kde-format 8768 msgid "'ai_family' not supported" 8769 msgstr "'ai_family' આધારિત નથી" 8770 8771 #: kdecore/netsupp.cpp:872 8772 #, kde-format 8773 msgid "no address associated with nodename" 8774 msgstr "નોડનામ સાથે કોઈ સરનામું સંકળાયેલ નથી" 8775 8776 #: kdecore/netsupp.cpp:874 8777 #, kde-format 8778 msgid "servname not supported for ai_socktype" 8779 msgstr "સેવાનામ ai_socktype માટે આધારિત નથી" 8780 8781 #: kdecore/netsupp.cpp:875 8782 #, kde-format 8783 msgid "'ai_socktype' not supported" 8784 msgstr "'ai_socktype' આધારિત નથી" 8785 8786 #: kdecore/netsupp.cpp:876 8787 #, kde-format 8788 msgid "system error" 8789 msgstr "સિસ્ટમ ક્ષતિ" 8790 8791 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8792 #, kde-format 8793 msgid "KDE Test Program" 8794 msgstr "KDE ચકાસણી કાર્યક્રમ" 8795 8796 #: kdecore/TIMEZONES:1 8797 #, kde-format 8798 msgid "Africa/Abidjan" 8799 msgstr "આફિક્રા/અબિડજાન" 8800 8801 #: kdecore/TIMEZONES:2 8802 #, kde-format 8803 msgid "Africa/Accra" 8804 msgstr "આફિક્રા/અકારા" 8805 8806 #: kdecore/TIMEZONES:3 8807 #, kde-format 8808 msgid "Africa/Addis_Ababa" 8809 msgstr "આફિક્રા/અડિસ_અબાબા" 8810 8811 #: kdecore/TIMEZONES:4 8812 #, kde-format 8813 msgid "Africa/Algiers" 8814 msgstr "આફિક્રા/અલ્જીરસ" 8815 8816 #: kdecore/TIMEZONES:5 8817 #, kde-format 8818 msgid "Africa/Asmara" 8819 msgstr "આફિક્રા/અસ્મારા" 8820 8821 #: kdecore/TIMEZONES:6 8822 #, kde-format 8823 msgid "Africa/Asmera" 8824 msgstr "આફિક્રા/અસ્મેરા" 8825 8826 #: kdecore/TIMEZONES:7 8827 #, kde-format 8828 msgid "Africa/Bamako" 8829 msgstr "આફિક્રા/બામાકો" 8830 8831 #: kdecore/TIMEZONES:8 8832 #, kde-format 8833 msgid "Africa/Bangui" 8834 msgstr "આફિક્રા/બાન્ગુઇ" 8835 8836 #: kdecore/TIMEZONES:9 8837 #, kde-format 8838 msgid "Africa/Banjul" 8839 msgstr "આફિક્રા/બાન્જુલ" 8840 8841 #: kdecore/TIMEZONES:10 8842 #, kde-format 8843 msgid "Africa/Bissau" 8844 msgstr "આફિક્રા/બિસાઉ" 8845 8846 #: kdecore/TIMEZONES:11 8847 #, kde-format 8848 msgid "Africa/Blantyre" 8849 msgstr "આફિક્રા/બ્લાન્ટાયરે" 8850 8851 #: kdecore/TIMEZONES:12 8852 #, kde-format 8853 msgid "Africa/Brazzaville" 8854 msgstr "આફિક્રા/બ્રાઝવિલે" 8855 8856 #: kdecore/TIMEZONES:13 8857 #, kde-format 8858 msgid "Africa/Bujumbura" 8859 msgstr "આફિક્રા/બુજુમ્બુરા" 8860 8861 #: kdecore/TIMEZONES:14 8862 #, kde-format 8863 msgid "Africa/Cairo" 8864 msgstr "આફિક્રા/કૈરો" 8865 8866 #: kdecore/TIMEZONES:15 8867 #, kde-format 8868 msgid "Africa/Casablanca" 8869 msgstr "આફિક્રા/કાસાબ્લાન્કા" 8870 8871 #: kdecore/TIMEZONES:16 8872 #, kde-format 8873 msgid "Africa/Ceuta" 8874 msgstr "આફિક્રા/કેયુટા" 8875 8876 #. i18n: comment to the previous timezone 8877 #: kdecore/TIMEZONES:18 8878 #, kde-format 8879 msgid "Ceuta & Melilla" 8880 msgstr "" 8881 8882 #. i18n: comment to the previous timezone 8883 #: kdecore/TIMEZONES:20 8884 #, kde-format 8885 msgid "Ceuta, Melilla" 8886 msgstr "" 8887 8888 #: kdecore/TIMEZONES:21 8889 #, kde-format 8890 msgid "Africa/Conakry" 8891 msgstr "આફિક્રા/કોનાક્રી" 8892 8893 #: kdecore/TIMEZONES:22 8894 #, kde-format 8895 msgid "Africa/Dakar" 8896 msgstr "આફિક્રા/ડકાર" 8897 8898 #: kdecore/TIMEZONES:23 8899 #, kde-format 8900 msgid "Africa/Dar_es_Salaam" 8901 msgstr "આફિક્રા/દાર_ઇ_સલામ" 8902 8903 #: kdecore/TIMEZONES:24 8904 #, kde-format 8905 msgid "Africa/Djibouti" 8906 msgstr "આફિક્રા/જીબુટી" 8907 8908 #: kdecore/TIMEZONES:25 8909 #, kde-format 8910 msgid "Africa/Douala" 8911 msgstr "આફિક્રા/ડોઉલા" 8912 8913 #: kdecore/TIMEZONES:26 8914 #, kde-format 8915 msgid "Africa/El_Aaiun" 8916 msgstr "આફિક્રા/અલ_ઐઉન" 8917 8918 #: kdecore/TIMEZONES:27 8919 #, kde-format 8920 msgid "Africa/Freetown" 8921 msgstr "આફિક્રા/ફ્રીટાઉન" 8922 8923 #: kdecore/TIMEZONES:28 8924 #, kde-format 8925 msgid "Africa/Gaborone" 8926 msgstr "આફિક્રા/ગાબારોને" 8927 8928 #: kdecore/TIMEZONES:29 8929 #, kde-format 8930 msgid "Africa/Harare" 8931 msgstr "આફિક્રા/હરારે" 8932 8933 #: kdecore/TIMEZONES:30 8934 #, kde-format 8935 msgid "Africa/Johannesburg" 8936 msgstr "આફિક્રા/જ્હોનિસબર્ગ" 8937 8938 #: kdecore/TIMEZONES:31 8939 #, fuzzy, kde-format 8940 #| msgid "Africa/Ceuta" 8941 msgid "Africa/Juba" 8942 msgstr "આફિક્રા/કેયુટા" 8943 8944 #: kdecore/TIMEZONES:32 8945 #, kde-format 8946 msgid "Africa/Kampala" 8947 msgstr "આફિક્રા/કમ્પાલા" 8948 8949 #: kdecore/TIMEZONES:33 8950 #, kde-format 8951 msgid "Africa/Khartoum" 8952 msgstr "આફિક્રા/ખાર્ટૂમ" 8953 8954 #: kdecore/TIMEZONES:34 8955 #, kde-format 8956 msgid "Africa/Kigali" 8957 msgstr "આફિક્રા/કિગાલી" 8958 8959 #: kdecore/TIMEZONES:35 8960 #, kde-format 8961 msgid "Africa/Kinshasa" 8962 msgstr "આફિક્રા/કિન્સાસા" 8963 8964 #. i18n: comment to the previous timezone 8965 #: kdecore/TIMEZONES:37 8966 #, kde-format 8967 msgid "west Dem. Rep. of Congo" 8968 msgstr "વેસ્ટર્ન ડેમોક્રેટિક રીપ્બલિક ઓફ કોંગો" 8969 8970 #. i18n: comment to the previous timezone 8971 #: kdecore/TIMEZONES:39 8972 #, fuzzy, kde-format 8973 #| msgid "west Dem. Rep. of Congo" 8974 msgid "Dem. Rep. of Congo (west)" 8975 msgstr "વેસ્ટર્ન ડેમોક્રેટિક રીપ્બલિક ઓફ કોંગો" 8976 8977 #: kdecore/TIMEZONES:40 8978 #, kde-format 8979 msgid "Africa/Lagos" 8980 msgstr "આફિક્રા/લાગોસ" 8981 8982 #: kdecore/TIMEZONES:41 8983 #, kde-format 8984 msgid "Africa/Libreville" 8985 msgstr "આફિક્રા/લિબ્રેવિલે" 8986 8987 #: kdecore/TIMEZONES:42 8988 #, kde-format 8989 msgid "Africa/Lome" 8990 msgstr "આફિક્રા/લોમ" 8991 8992 #: kdecore/TIMEZONES:43 8993 #, kde-format 8994 msgid "Africa/Luanda" 8995 msgstr "આફિક્રા/લુઆન્ડા" 8996 8997 #: kdecore/TIMEZONES:44 8998 #, kde-format 8999 msgid "Africa/Lubumbashi" 9000 msgstr "આફિક્રા/લુબુમ્બાશી" 9001 9002 #. i18n: comment to the previous timezone 9003 #: kdecore/TIMEZONES:46 9004 #, kde-format 9005 msgid "east Dem. Rep. of Congo" 9006 msgstr "ઈસ્ટર્ન ડેમોક્રેટિક રીપબ્લિક ઓફ કોંગો" 9007 9008 #. i18n: comment to the previous timezone 9009 #: kdecore/TIMEZONES:48 9010 #, fuzzy, kde-format 9011 #| msgid "east Dem. Rep. of Congo" 9012 msgid "Dem. Rep. of Congo (east)" 9013 msgstr "ઈસ્ટર્ન ડેમોક્રેટિક રીપબ્લિક ઓફ કોંગો" 9014 9015 #: kdecore/TIMEZONES:49 9016 #, kde-format 9017 msgid "Africa/Lusaka" 9018 msgstr "આફિક્રા/લુસાકા" 9019 9020 #: kdecore/TIMEZONES:50 9021 #, kde-format 9022 msgid "Africa/Malabo" 9023 msgstr "આફિક્રા/માલાબો" 9024 9025 #: kdecore/TIMEZONES:51 9026 #, kde-format 9027 msgid "Africa/Maputo" 9028 msgstr "આફિક્રા/માપુટો" 9029 9030 #: kdecore/TIMEZONES:52 9031 #, kde-format 9032 msgid "Africa/Maseru" 9033 msgstr "આફિક્રા/માસેરૂ" 9034 9035 #: kdecore/TIMEZONES:53 9036 #, kde-format 9037 msgid "Africa/Mbabane" 9038 msgstr "આફિક્રા/મ્બાબાને" 9039 9040 #: kdecore/TIMEZONES:54 9041 #, kde-format 9042 msgid "Africa/Mogadishu" 9043 msgstr "આફિક્રા/મોગાદિશુ" 9044 9045 #: kdecore/TIMEZONES:55 9046 #, kde-format 9047 msgid "Africa/Monrovia" 9048 msgstr "આફિક્રા/મોન્રોવિઆ" 9049 9050 #: kdecore/TIMEZONES:56 9051 #, kde-format 9052 msgid "Africa/Nairobi" 9053 msgstr "આફિક્રા/નૈરોબી" 9054 9055 #: kdecore/TIMEZONES:57 9056 #, kde-format 9057 msgid "Africa/Ndjamena" 9058 msgstr "આફિક્રા/ન્જામેના" 9059 9060 #: kdecore/TIMEZONES:58 9061 #, kde-format 9062 msgid "Africa/Niamey" 9063 msgstr "આફિક્રા/નિઆમે" 9064 9065 #: kdecore/TIMEZONES:59 9066 #, kde-format 9067 msgid "Africa/Nouakchott" 9068 msgstr "આફિક્રા/નાઉક્ચોટ" 9069 9070 #: kdecore/TIMEZONES:60 9071 #, kde-format 9072 msgid "Africa/Ouagadougou" 9073 msgstr "આફિક્રા/ઓગાડોઉગુ" 9074 9075 #: kdecore/TIMEZONES:61 9076 #, kde-format 9077 msgid "Africa/Porto-Novo" 9078 msgstr "આફિક્રા/પોર્ટો-નેવો" 9079 9080 #: kdecore/TIMEZONES:62 9081 #, kde-format 9082 msgid "Africa/Pretoria" 9083 msgstr "આફિક્રા/પ્રિટોરિઆ" 9084 9085 #: kdecore/TIMEZONES:63 9086 #, kde-format 9087 msgid "Africa/Sao_Tome" 9088 msgstr "આફિક્રા/સાઓ_ટોમે" 9089 9090 #: kdecore/TIMEZONES:64 9091 #, kde-format 9092 msgid "Africa/Timbuktu" 9093 msgstr "આફિક્રા/ટીમ્બક્ટુ" 9094 9095 #: kdecore/TIMEZONES:65 9096 #, kde-format 9097 msgid "Africa/Tripoli" 9098 msgstr "આફિક્રા/ટ્રીપોલી" 9099 9100 #: kdecore/TIMEZONES:66 9101 #, kde-format 9102 msgid "Africa/Tunis" 9103 msgstr "આફિક્રા/ટ્યુનિસ" 9104 9105 #: kdecore/TIMEZONES:67 9106 #, kde-format 9107 msgid "Africa/Windhoek" 9108 msgstr "આફિક્રા/વિન્ડહોક" 9109 9110 #: kdecore/TIMEZONES:68 9111 #, kde-format 9112 msgid "America/Adak" 9113 msgstr "અમેરિકા/અડાક" 9114 9115 #. i18n: comment to the previous timezone 9116 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 9117 #, kde-format 9118 msgid "Aleutian Islands" 9119 msgstr "અલ્સુશિયન ટાપુઓ" 9120 9121 #: kdecore/TIMEZONES:71 9122 #, kde-format 9123 msgid "America/Anchorage" 9124 msgstr "અમેરિકા/એન્ચોર્ગ" 9125 9126 #. i18n: comment to the previous timezone 9127 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 9128 #, kde-format 9129 msgid "Alaska Time" 9130 msgstr "અલાસ્કા સમય" 9131 9132 #. i18n: comment to the previous timezone 9133 #: kdecore/TIMEZONES:75 9134 #, fuzzy, kde-format 9135 #| msgid "Alaska Time" 9136 msgid "Alaska (most areas)" 9137 msgstr "અલાસ્કા સમય" 9138 9139 #: kdecore/TIMEZONES:76 9140 #, kde-format 9141 msgid "America/Anguilla" 9142 msgstr "અમેરિકા/એન્ગુઇલા" 9143 9144 #: kdecore/TIMEZONES:77 9145 #, kde-format 9146 msgid "America/Antigua" 9147 msgstr "અમેરિકા/એન્ટિગુઆ" 9148 9149 #: kdecore/TIMEZONES:78 9150 #, kde-format 9151 msgid "America/Araguaina" 9152 msgstr "અમેરિકા/આર્જેન્ટિના" 9153 9154 #. i18n: comment to the previous timezone 9155 #: kdecore/TIMEZONES:80 9156 #, kde-format 9157 msgid "Tocantins" 9158 msgstr "ટોકાન્ટિસ" 9159 9160 #: kdecore/TIMEZONES:81 9161 #, kde-format 9162 msgid "America/Argentina/Buenos_Aires" 9163 msgstr "અમેરિકા/આર્જેન્ટિના/બ્યુનોસ_એરિસ" 9164 9165 #. i18n: comment to the previous timezone 9166 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 9167 #, kde-format 9168 msgid "Buenos Aires (BA, CF)" 9169 msgstr "બુએનોસ એરિસ (BA, CF)" 9170 9171 #: kdecore/TIMEZONES:84 9172 #, kde-format 9173 msgid "America/Argentina/Catamarca" 9174 msgstr "અમેરિકા/આર્જેન્ટિના/કાટામાર્કા" 9175 9176 #. i18n: comment to the previous timezone 9177 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 9178 #, kde-format 9179 msgid "Catamarca (CT), Chubut (CH)" 9180 msgstr "કાટામાર્કા (CT), ચુબુત (CH)" 9181 9182 #. i18n: comment to the previous timezone 9183 #: kdecore/TIMEZONES:88 9184 #, fuzzy, kde-format 9185 #| msgid "Catamarca (CT), Chubut (CH)" 9186 msgid "Catamarca (CT); Chubut (CH)" 9187 msgstr "કાટામાર્કા (CT), ચુબુત (CH)" 9188 9189 #: kdecore/TIMEZONES:89 9190 #, kde-format 9191 msgid "America/Argentina/ComodRivadavia" 9192 msgstr "અમેરિકા/આર્જેન્ટિના/કોમોડરિવાડાવિઆ" 9193 9194 #: kdecore/TIMEZONES:92 9195 #, kde-format 9196 msgid "America/Argentina/Cordoba" 9197 msgstr "અમેરિકા/આર્જેન્ટિના/કોર્ડોબા" 9198 9199 #. i18n: comment to the previous timezone 9200 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 9201 #, kde-format 9202 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 9203 msgstr "મોટાભાગનાં સ્થળો (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 9204 9205 #. i18n: comment to the previous timezone 9206 #: kdecore/TIMEZONES:96 9207 #, kde-format 9208 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 9209 msgstr "માટાભાગનાં સ્થળો (CB, CC, CN, ER, FM, MN, SE, SF)" 9210 9211 #. i18n: comment to the previous timezone 9212 #: kdecore/TIMEZONES:98 9213 #, fuzzy, kde-format 9214 #| msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 9215 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 9216 msgstr "માટાભાગનાં સ્થળો (CB, CC, CN, ER, FM, MN, SE, SF)" 9217 9218 #: kdecore/TIMEZONES:99 9219 #, kde-format 9220 msgid "America/Argentina/Jujuy" 9221 msgstr "અમેરિકા/આર્જેન્ટિના/જુજુય" 9222 9223 #. i18n: comment to the previous timezone 9224 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 9225 #, kde-format 9226 msgid "Jujuy (JY)" 9227 msgstr "જુજુય (JY)" 9228 9229 #: kdecore/TIMEZONES:102 9230 #, kde-format 9231 msgid "America/Argentina/La_Rioja" 9232 msgstr "અમેરિકા/આર્જેન્ટિના/લા_રિઓજા" 9233 9234 #. i18n: comment to the previous timezone 9235 #: kdecore/TIMEZONES:104 9236 #, kde-format 9237 msgid "La Rioja (LR)" 9238 msgstr "લા રિઓજા (LR)" 9239 9240 #: kdecore/TIMEZONES:105 9241 #, kde-format 9242 msgid "America/Argentina/Mendoza" 9243 msgstr "અમેરિકા/આર્જેન્ટિના/મેન્ડોઝા" 9244 9245 #. i18n: comment to the previous timezone 9246 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 9247 #, kde-format 9248 msgid "Mendoza (MZ)" 9249 msgstr "મેન્ડોઝા (MZ)" 9250 9251 #: kdecore/TIMEZONES:108 9252 #, kde-format 9253 msgid "America/Argentina/Rio_Gallegos" 9254 msgstr "અમેરિકા/આર્જેન્ટિના/રીઓ_ગાલેગોસ" 9255 9256 #. i18n: comment to the previous timezone 9257 #: kdecore/TIMEZONES:110 9258 #, kde-format 9259 msgid "Santa Cruz (SC)" 9260 msgstr "સાન્તા ક્રુઝ (SC)" 9261 9262 #: kdecore/TIMEZONES:111 9263 #, kde-format 9264 msgid "America/Argentina/Salta" 9265 msgstr "અમેરિકા/આર્જેન્ટિના/સાલ્ટા" 9266 9267 #. i18n: comment to the previous timezone 9268 #: kdecore/TIMEZONES:113 9269 #, kde-format 9270 msgid "(SA, LP, NQ, RN)" 9271 msgstr "(SA, LP, NQ, RN)" 9272 9273 #. i18n: comment to the previous timezone 9274 #: kdecore/TIMEZONES:115 9275 #, fuzzy, kde-format 9276 #| msgid "(SA, LP, NQ, RN)" 9277 msgid "Salta (SA, LP, NQ, RN)" 9278 msgstr "(SA, LP, NQ, RN)" 9279 9280 #: kdecore/TIMEZONES:116 9281 #, kde-format 9282 msgid "America/Argentina/San_Juan" 9283 msgstr "અમેરિકા/આર્જેન્ટિના/સાન_જુઆન" 9284 9285 #. i18n: comment to the previous timezone 9286 #: kdecore/TIMEZONES:118 9287 #, kde-format 9288 msgid "San Juan (SJ)" 9289 msgstr "સાન જુઆન (SJ)" 9290 9291 #: kdecore/TIMEZONES:119 9292 #, kde-format 9293 msgid "America/Argentina/San_Luis" 9294 msgstr "અમેરિકા/આર્જેન્ટિના/સાન_લુઇસ" 9295 9296 #. i18n: comment to the previous timezone 9297 #: kdecore/TIMEZONES:121 9298 #, kde-format 9299 msgid "San Luis (SL)" 9300 msgstr "સાન લુઇસ (SL)" 9301 9302 #: kdecore/TIMEZONES:122 9303 #, kde-format 9304 msgid "America/Argentina/Tucuman" 9305 msgstr "અમેરિકા/આર્જેન્ટિના/ટુકુમાન" 9306 9307 #. i18n: comment to the previous timezone 9308 #: kdecore/TIMEZONES:124 9309 #, kde-format 9310 msgid "Tucuman (TM)" 9311 msgstr "ટુકુમાન (TM)" 9312 9313 #: kdecore/TIMEZONES:125 9314 #, kde-format 9315 msgid "America/Argentina/Ushuaia" 9316 msgstr "અમેરિકા/આર્જેન્ટિના/ઉહુસિઆ" 9317 9318 #. i18n: comment to the previous timezone 9319 #: kdecore/TIMEZONES:127 9320 #, kde-format 9321 msgid "Tierra del Fuego (TF)" 9322 msgstr "તિએરા ડેલ ફુએગો (TF)" 9323 9324 #: kdecore/TIMEZONES:128 9325 #, kde-format 9326 msgid "America/Aruba" 9327 msgstr "અમેરિકા/અરુબા" 9328 9329 #: kdecore/TIMEZONES:129 9330 #, kde-format 9331 msgid "America/Asuncion" 9332 msgstr "અમેરિકા/અસુન્સિઓન" 9333 9334 #: kdecore/TIMEZONES:130 9335 #, kde-format 9336 msgid "America/Atikokan" 9337 msgstr "અમેરિકા/અટિકોકાન" 9338 9339 #. i18n: comment to the previous timezone 9340 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 9341 #, kde-format 9342 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 9343 msgstr "" 9344 9345 #. i18n: comment to the previous timezone 9346 #: kdecore/TIMEZONES:134 9347 #, kde-format 9348 msgid "EST - ON (Atikokan); NU (Coral H)" 9349 msgstr "" 9350 9351 #: kdecore/TIMEZONES:135 9352 #, kde-format 9353 msgid "America/Atka" 9354 msgstr "અમેરિકા/અટકા" 9355 9356 #: kdecore/TIMEZONES:138 9357 #, kde-format 9358 msgid "America/Bahia" 9359 msgstr "અમેરિકા/બહિઆ" 9360 9361 #. i18n: comment to the previous timezone 9362 #: kdecore/TIMEZONES:140 9363 #, kde-format 9364 msgid "Bahia" 9365 msgstr "બાહીઆ" 9366 9367 #: kdecore/TIMEZONES:141 9368 #, fuzzy, kde-format 9369 #| msgid "America/Bahia" 9370 msgid "America/Bahia_Banderas" 9371 msgstr "અમેરિકા/બહિઆ" 9372 9373 #. i18n: comment to the previous timezone 9374 #: kdecore/TIMEZONES:143 9375 #, kde-format 9376 msgid "Mexican Central Time - Bahia de Banderas" 9377 msgstr "" 9378 9379 #. i18n: comment to the previous timezone 9380 #: kdecore/TIMEZONES:145 9381 #, kde-format 9382 msgid "Central Time - Bahia de Banderas" 9383 msgstr "" 9384 9385 #: kdecore/TIMEZONES:146 9386 #, kde-format 9387 msgid "America/Barbados" 9388 msgstr "અમેરિકા/બાર્બાડોસ" 9389 9390 #: kdecore/TIMEZONES:147 9391 #, kde-format 9392 msgid "America/Belem" 9393 msgstr "અમેરિકા/બેલેમ" 9394 9395 #. i18n: comment to the previous timezone 9396 #: kdecore/TIMEZONES:149 9397 #, kde-format 9398 msgid "Amapa, E Para" 9399 msgstr "અમાપા, ઈ પેરા" 9400 9401 #. i18n: comment to the previous timezone 9402 #: kdecore/TIMEZONES:151 9403 #, kde-format 9404 msgid "Para (east); Amapa" 9405 msgstr "" 9406 9407 #: kdecore/TIMEZONES:152 9408 #, kde-format 9409 msgid "America/Belize" 9410 msgstr "અમેરિકા/બેલિઝ" 9411 9412 #: kdecore/TIMEZONES:153 9413 #, kde-format 9414 msgid "America/Blanc-Sablon" 9415 msgstr "અમેરિકા/બ્લાન્ક-સાબ્લોન" 9416 9417 #. i18n: comment to the previous timezone 9418 #: kdecore/TIMEZONES:155 9419 #, kde-format 9420 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9421 msgstr "" 9422 9423 #. i18n: comment to the previous timezone 9424 #: kdecore/TIMEZONES:157 9425 #, kde-format 9426 msgid "AST - QC (Lower North Shore)" 9427 msgstr "" 9428 9429 #: kdecore/TIMEZONES:158 9430 #, kde-format 9431 msgid "America/Boa_Vista" 9432 msgstr "અમેરિકા/બોઆ_વિસ્ટા" 9433 9434 #. i18n: comment to the previous timezone 9435 #: kdecore/TIMEZONES:160 9436 #, kde-format 9437 msgid "Roraima" 9438 msgstr "રોરાઈમા" 9439 9440 #: kdecore/TIMEZONES:161 9441 #, kde-format 9442 msgid "America/Bogota" 9443 msgstr "અમેરિકા/બોગોટા" 9444 9445 #: kdecore/TIMEZONES:162 9446 #, kde-format 9447 msgid "America/Boise" 9448 msgstr "અમેરિકા/બોઇસે" 9449 9450 #. i18n: comment to the previous timezone 9451 #: kdecore/TIMEZONES:164 9452 #, kde-format 9453 msgid "Mountain Time - south Idaho & east Oregon" 9454 msgstr "" 9455 9456 #. i18n: comment to the previous timezone 9457 #: kdecore/TIMEZONES:166 9458 #, kde-format 9459 msgid "Mountain - ID (south); OR (east)" 9460 msgstr "" 9461 9462 #: kdecore/TIMEZONES:167 9463 #, kde-format 9464 msgid "America/Buenos_Aires" 9465 msgstr "અમેરિકા/બુએનોસ_એરિસ" 9466 9467 #: kdecore/TIMEZONES:170 9468 #, kde-format 9469 msgid "America/Calgary" 9470 msgstr "અમેરિકા/કાલગેરી" 9471 9472 #. i18n: comment to the previous timezone 9473 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9474 #, kde-format 9475 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9476 msgstr "" 9477 9478 #: kdecore/TIMEZONES:173 9479 #, kde-format 9480 msgid "America/Cambridge_Bay" 9481 msgstr "અમેરિકા/કેમ્બ્રિજ_બે" 9482 9483 #. i18n: comment to the previous timezone 9484 #: kdecore/TIMEZONES:175 9485 #, kde-format 9486 msgid "Mountain Time - west Nunavut" 9487 msgstr "" 9488 9489 #. i18n: comment to the previous timezone 9490 #: kdecore/TIMEZONES:177 9491 #, fuzzy, kde-format 9492 #| msgid "Mountain Time" 9493 msgid "Mountain - NU (west)" 9494 msgstr "પર્વતીય સમય" 9495 9496 #: kdecore/TIMEZONES:178 9497 #, kde-format 9498 msgid "America/Campo_Grande" 9499 msgstr "અમેરિકા/કામ્પો_ગ્રાન્ડે" 9500 9501 #. i18n: comment to the previous timezone 9502 #: kdecore/TIMEZONES:180 9503 #, kde-format 9504 msgid "Mato Grosso do Sul" 9505 msgstr "માટો ગ્રોસો ડો સુલ" 9506 9507 #: kdecore/TIMEZONES:181 9508 #, kde-format 9509 msgid "America/Cancun" 9510 msgstr "અમેરિકા/કાન્કુન" 9511 9512 #. i18n: comment to the previous timezone 9513 #: kdecore/TIMEZONES:183 9514 #, kde-format 9515 msgid "Central Time - Quintana Roo" 9516 msgstr "" 9517 9518 #. i18n: comment to the previous timezone 9519 #: kdecore/TIMEZONES:185 9520 #, kde-format 9521 msgid "Eastern Standard Time - Quintana Roo" 9522 msgstr "" 9523 9524 #: kdecore/TIMEZONES:186 9525 #, kde-format 9526 msgid "America/Caracas" 9527 msgstr "અમેરિકા/કારાકાસ" 9528 9529 #: kdecore/TIMEZONES:187 9530 #, kde-format 9531 msgid "America/Catamarca" 9532 msgstr "અમેરિકા/કાટામાર્કા" 9533 9534 #: kdecore/TIMEZONES:190 9535 #, kde-format 9536 msgid "America/Cayenne" 9537 msgstr "અમેરિકા/કાયેન્ને" 9538 9539 #: kdecore/TIMEZONES:191 9540 #, kde-format 9541 msgid "America/Cayman" 9542 msgstr "અમેરિકા/કાયમાન" 9543 9544 #: kdecore/TIMEZONES:192 9545 #, kde-format 9546 msgid "America/Chicago" 9547 msgstr "અમેરિકા/શિકાગો" 9548 9549 #. i18n: comment to the previous timezone 9550 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9551 #, kde-format 9552 msgid "Central Time" 9553 msgstr "મધ્ય સમય" 9554 9555 #. i18n: comment to the previous timezone 9556 #: kdecore/TIMEZONES:196 9557 #, fuzzy, kde-format 9558 #| msgid "Central Time" 9559 msgid "Central (most areas)" 9560 msgstr "મધ્ય સમય" 9561 9562 #: kdecore/TIMEZONES:197 9563 #, kde-format 9564 msgid "America/Chihuahua" 9565 msgstr "અમેરિકા/ચિહુઆઆ" 9566 9567 #. i18n: comment to the previous timezone 9568 #: kdecore/TIMEZONES:199 9569 #, kde-format 9570 msgid "Mountain Time - Chihuahua" 9571 msgstr "" 9572 9573 #. i18n: comment to the previous timezone 9574 #: kdecore/TIMEZONES:201 9575 #, kde-format 9576 msgid "Mexican Mountain Time - Chihuahua away from US border" 9577 msgstr "" 9578 9579 #. i18n: comment to the previous timezone 9580 #: kdecore/TIMEZONES:203 9581 #, kde-format 9582 msgid "Mountain Time - Chihuahua (most areas)" 9583 msgstr "" 9584 9585 #: kdecore/TIMEZONES:204 9586 #, kde-format 9587 msgid "America/Coral_Harbour" 9588 msgstr "અમેરિકા/કોરલ_હાર્બર" 9589 9590 #: kdecore/TIMEZONES:207 9591 #, kde-format 9592 msgid "America/Cordoba" 9593 msgstr "અમેરિકા/કાર્ડોબા" 9594 9595 #: kdecore/TIMEZONES:210 9596 #, kde-format 9597 msgid "America/Costa_Rica" 9598 msgstr "અમેરિકા/કોસ્ટા_રિકા" 9599 9600 #: kdecore/TIMEZONES:211 9601 #, fuzzy, kde-format 9602 #| msgid "America/Fredericton" 9603 msgid "America/Creston" 9604 msgstr "અમેરિકા/ફ્રડેરિક્ટોન" 9605 9606 #. i18n: comment to the previous timezone 9607 #: kdecore/TIMEZONES:213 9608 #, kde-format 9609 msgid "Mountain Standard Time - Creston, British Columbia" 9610 msgstr "" 9611 9612 #. i18n: comment to the previous timezone 9613 #: kdecore/TIMEZONES:215 9614 #, kde-format 9615 msgid "MST - BC (Creston)" 9616 msgstr "" 9617 9618 #: kdecore/TIMEZONES:216 9619 #, kde-format 9620 msgid "America/Cuiaba" 9621 msgstr "અમેરિકા/કુઇબા" 9622 9623 #. i18n: comment to the previous timezone 9624 #: kdecore/TIMEZONES:218 9625 #, kde-format 9626 msgid "Mato Grosso" 9627 msgstr "માટો ગ્રોસો" 9628 9629 #: kdecore/TIMEZONES:219 9630 #, kde-format 9631 msgid "America/Curacao" 9632 msgstr "અમેરિકા/કુરાકાઓ" 9633 9634 #: kdecore/TIMEZONES:220 9635 #, kde-format 9636 msgid "America/Danmarkshavn" 9637 msgstr "અમેરિકા/ડાનમાર્કશહાવન" 9638 9639 #. i18n: comment to the previous timezone 9640 #: kdecore/TIMEZONES:222 9641 #, kde-format 9642 msgid "east coast, north of Scoresbysund" 9643 msgstr "" 9644 9645 #. i18n: comment to the previous timezone 9646 #: kdecore/TIMEZONES:224 9647 #, kde-format 9648 msgid "National Park (east coast)" 9649 msgstr "" 9650 9651 #: kdecore/TIMEZONES:225 9652 #, kde-format 9653 msgid "America/Dawson" 9654 msgstr "અમેરિકા/ડાઉસન" 9655 9656 #. i18n: comment to the previous timezone 9657 #: kdecore/TIMEZONES:227 9658 #, kde-format 9659 msgid "Pacific Time - north Yukon" 9660 msgstr "" 9661 9662 #. i18n: comment to the previous timezone 9663 #: kdecore/TIMEZONES:229 9664 #, kde-format 9665 msgid "MST - Yukon (west)" 9666 msgstr "" 9667 9668 #: kdecore/TIMEZONES:230 9669 #, kde-format 9670 msgid "America/Dawson_Creek" 9671 msgstr "અમેરિકા/ડાઉસન_ક્રીક" 9672 9673 #. i18n: comment to the previous timezone 9674 #: kdecore/TIMEZONES:232 9675 #, kde-format 9676 msgid "" 9677 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9678 msgstr "" 9679 9680 #. i18n: comment to the previous timezone 9681 #: kdecore/TIMEZONES:234 9682 #, kde-format 9683 msgid "MST - BC (Dawson Cr, Ft St John)" 9684 msgstr "" 9685 9686 #: kdecore/TIMEZONES:235 9687 #, kde-format 9688 msgid "America/Denver" 9689 msgstr "અમેરિકા/ડેન્વર" 9690 9691 #. i18n: comment to the previous timezone 9692 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9693 #, kde-format 9694 msgid "Mountain Time" 9695 msgstr "પર્વતીય સમય" 9696 9697 #. i18n: comment to the previous timezone 9698 #: kdecore/TIMEZONES:239 9699 #, fuzzy, kde-format 9700 #| msgid "Mountain Time" 9701 msgid "Mountain (most areas)" 9702 msgstr "પર્વતીય સમય" 9703 9704 #: kdecore/TIMEZONES:240 9705 #, kde-format 9706 msgid "America/Detroit" 9707 msgstr "અમેરિકા/ડેટ્રોઇટ" 9708 9709 #. i18n: comment to the previous timezone 9710 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9711 #, kde-format 9712 msgid "Eastern Time - Michigan - most locations" 9713 msgstr "" 9714 9715 #. i18n: comment to the previous timezone 9716 #: kdecore/TIMEZONES:244 9717 #, kde-format 9718 msgid "Eastern - MI (most areas)" 9719 msgstr "" 9720 9721 #: kdecore/TIMEZONES:245 9722 #, kde-format 9723 msgid "America/Dominica" 9724 msgstr "અમેરિકા/ડોમિનિકા" 9725 9726 #: kdecore/TIMEZONES:246 9727 #, kde-format 9728 msgid "America/Edmonton" 9729 msgstr "અમેરિકા/એડમોન્ટોન" 9730 9731 #. i18n: comment to the previous timezone 9732 #: kdecore/TIMEZONES:250 9733 #, kde-format 9734 msgid "Mountain - AB; BC (E); SK (W)" 9735 msgstr "" 9736 9737 #: kdecore/TIMEZONES:251 9738 #, kde-format 9739 msgid "America/Eirunepe" 9740 msgstr "અમેરિકા/ઇરુનેપે" 9741 9742 #. i18n: comment to the previous timezone 9743 #: kdecore/TIMEZONES:253 9744 #, kde-format 9745 msgid "W Amazonas" 9746 msgstr "પ. એમેઝોન્સ" 9747 9748 #. i18n: comment to the previous timezone 9749 #: kdecore/TIMEZONES:255 9750 #, fuzzy, kde-format 9751 #| msgid "W Amazonas" 9752 msgid "Amazonas (west)" 9753 msgstr "પ. એમેઝોન્સ" 9754 9755 #: kdecore/TIMEZONES:256 9756 #, kde-format 9757 msgid "America/El_Salvador" 9758 msgstr "અમેરિકા/અલ_સાલ્વાડોર" 9759 9760 #: kdecore/TIMEZONES:257 9761 #, kde-format 9762 msgid "America/Ensenada" 9763 msgstr "અમેરિકા/ઇન્સેન્ડા" 9764 9765 #. i18n: comment to the previous timezone 9766 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9767 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9768 #, kde-format 9769 msgid "Pacific Time" 9770 msgstr "પેસફિક સમય" 9771 9772 #: kdecore/TIMEZONES:260 9773 #, fuzzy, kde-format 9774 #| msgid "America/Porto_Velho" 9775 msgid "America/Fort_Nelson" 9776 msgstr "અમેરિકા/પોર્ટો_વેલ્હો" 9777 9778 #. i18n: comment to the previous timezone 9779 #: kdecore/TIMEZONES:262 9780 #, kde-format 9781 msgid "MST - BC (Ft Nelson)" 9782 msgstr "" 9783 9784 #: kdecore/TIMEZONES:263 9785 #, kde-format 9786 msgid "America/Fort_Wayne" 9787 msgstr "અમેરિકા/ફોર્ટ_વેઇન" 9788 9789 #. i18n: comment to the previous timezone 9790 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9791 #: kdecore/TIMEZONES:1419 9792 #, kde-format 9793 msgid "Eastern Time - Indiana - most locations" 9794 msgstr "" 9795 9796 #: kdecore/TIMEZONES:266 9797 #, kde-format 9798 msgid "America/Fortaleza" 9799 msgstr "અમેરિકા/ફોર્ટાલેઝા" 9800 9801 #. i18n: comment to the previous timezone 9802 #: kdecore/TIMEZONES:268 9803 #, kde-format 9804 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9805 msgstr "" 9806 9807 #. i18n: comment to the previous timezone 9808 #: kdecore/TIMEZONES:270 9809 #, kde-format 9810 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9811 msgstr "" 9812 9813 #: kdecore/TIMEZONES:271 9814 #, kde-format 9815 msgid "America/Fredericton" 9816 msgstr "અમેરિકા/ફ્રડેરિક્ટોન" 9817 9818 #. i18n: comment to the previous timezone 9819 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9820 #, kde-format 9821 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9822 msgstr "" 9823 9824 #: kdecore/TIMEZONES:274 9825 #, kde-format 9826 msgid "America/Glace_Bay" 9827 msgstr "અમેરિકા/ગ્લેસ_બે" 9828 9829 #. i18n: comment to the previous timezone 9830 #: kdecore/TIMEZONES:276 9831 #, kde-format 9832 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9833 msgstr "" 9834 9835 #. i18n: comment to the previous timezone 9836 #: kdecore/TIMEZONES:278 9837 #, fuzzy, kde-format 9838 #| msgid "Atlantic/Cape_Verde" 9839 msgid "Atlantic - NS (Cape Breton)" 9840 msgstr "એટલાન્ટિક/કેપે_વર્દે" 9841 9842 #: kdecore/TIMEZONES:279 9843 #, kde-format 9844 msgid "America/Godthab" 9845 msgstr "અમેરિકા/ગોડથાબ" 9846 9847 #. i18n: comment to the previous timezone 9848 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9849 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9850 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9851 #: kdecore/TIMEZONES:1350 9852 #, kde-format 9853 msgid "most locations" 9854 msgstr "મોટાભાગનાં સ્થળો" 9855 9856 #: kdecore/TIMEZONES:282 9857 #, kde-format 9858 msgid "America/Goose_Bay" 9859 msgstr "અમેરિકા/ગૂસ_બે" 9860 9861 #. i18n: comment to the previous timezone 9862 #: kdecore/TIMEZONES:284 9863 #, kde-format 9864 msgid "Atlantic Time - Labrador - most locations" 9865 msgstr "" 9866 9867 #. i18n: comment to the previous timezone 9868 #: kdecore/TIMEZONES:286 9869 #, kde-format 9870 msgid "Atlantic - Labrador (most areas)" 9871 msgstr "" 9872 9873 #: kdecore/TIMEZONES:287 9874 #, kde-format 9875 msgid "America/Grand_Turk" 9876 msgstr "અમેરિકા/ગ્રાન્ડ_તુર્ક" 9877 9878 #: kdecore/TIMEZONES:288 9879 #, kde-format 9880 msgid "America/Grenada" 9881 msgstr "અમેરિકા/ગ્રેનેડા" 9882 9883 #: kdecore/TIMEZONES:289 9884 #, kde-format 9885 msgid "America/Guadeloupe" 9886 msgstr "અમેરિકા/ગુડેલોઉપે" 9887 9888 #: kdecore/TIMEZONES:290 9889 #, kde-format 9890 msgid "America/Guatemala" 9891 msgstr "અમેરિકા/ગ્વાટેમાલા" 9892 9893 #: kdecore/TIMEZONES:291 9894 #, kde-format 9895 msgid "America/Guayaquil" 9896 msgstr "અમેરિકા/ગુયાક્વિલ" 9897 9898 #. i18n: comment to the previous timezone 9899 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9900 #: kdecore/TIMEZONES:1400 9901 #, kde-format 9902 msgid "mainland" 9903 msgstr "મુખ્યજમીન" 9904 9905 #. i18n: comment to the previous timezone 9906 #: kdecore/TIMEZONES:295 9907 #, fuzzy, kde-format 9908 #| msgid "mainland" 9909 msgid "Ecuador (mainland)" 9910 msgstr "મુખ્યજમીન" 9911 9912 #: kdecore/TIMEZONES:296 9913 #, kde-format 9914 msgid "America/Guyana" 9915 msgstr "અમેરિકા/ગુયાના" 9916 9917 #: kdecore/TIMEZONES:297 9918 #, kde-format 9919 msgid "America/Halifax" 9920 msgstr "અમેરિકા/હાલિફેક્સ" 9921 9922 #. i18n: comment to the previous timezone 9923 #: kdecore/TIMEZONES:301 9924 #, kde-format 9925 msgid "Atlantic - NS (most areas); PE" 9926 msgstr "" 9927 9928 #: kdecore/TIMEZONES:302 9929 #, kde-format 9930 msgid "America/Havana" 9931 msgstr "અમેરિકા/હવાના" 9932 9933 #: kdecore/TIMEZONES:303 9934 #, kde-format 9935 msgid "America/Hermosillo" 9936 msgstr "અમેરિકા/હેર્મોસિલો" 9937 9938 #. i18n: comment to the previous timezone 9939 #: kdecore/TIMEZONES:305 9940 #, kde-format 9941 msgid "Mountain Standard Time - Sonora" 9942 msgstr "" 9943 9944 #: kdecore/TIMEZONES:306 9945 #, kde-format 9946 msgid "America/Indiana/Indianapolis" 9947 msgstr "અમેરિકા/ઇન્ડિયાના/ઇન્ડિયાનાપોલિસ" 9948 9949 #. i18n: comment to the previous timezone 9950 #: kdecore/TIMEZONES:310 9951 #, kde-format 9952 msgid "Eastern - IN (most areas)" 9953 msgstr "" 9954 9955 #: kdecore/TIMEZONES:311 9956 #, kde-format 9957 msgid "America/Indiana/Knox" 9958 msgstr "અમેરિકા/ઇન્ડિયાના/ક્નોક્સ" 9959 9960 #. i18n: comment to the previous timezone 9961 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9962 #, kde-format 9963 msgid "Eastern Time - Indiana - Starke County" 9964 msgstr "" 9965 9966 #. i18n: comment to the previous timezone 9967 #: kdecore/TIMEZONES:315 9968 #, kde-format 9969 msgid "Central Time - Indiana - Starke County" 9970 msgstr "" 9971 9972 #. i18n: comment to the previous timezone 9973 #: kdecore/TIMEZONES:317 9974 #, kde-format 9975 msgid "Central - IN (Starke)" 9976 msgstr "" 9977 9978 #: kdecore/TIMEZONES:318 9979 #, kde-format 9980 msgid "America/Indiana/Marengo" 9981 msgstr "અમેરિકા/ઇન્ડિયાના/મારેન્ગો" 9982 9983 #. i18n: comment to the previous timezone 9984 #: kdecore/TIMEZONES:320 9985 #, kde-format 9986 msgid "Eastern Time - Indiana - Crawford County" 9987 msgstr "" 9988 9989 #. i18n: comment to the previous timezone 9990 #: kdecore/TIMEZONES:322 9991 #, kde-format 9992 msgid "Eastern - IN (Crawford)" 9993 msgstr "" 9994 9995 #: kdecore/TIMEZONES:323 9996 #, kde-format 9997 msgid "America/Indiana/Petersburg" 9998 msgstr "અમેરિકા/ઇન્ડિયાના/પીટર્સબર્ગ" 9999 10000 #. i18n: comment to the previous timezone 10001 #: kdecore/TIMEZONES:325 10002 #, kde-format 10003 msgid "Central Time - Indiana - Pike County" 10004 msgstr "" 10005 10006 #. i18n: comment to the previous timezone 10007 #: kdecore/TIMEZONES:327 10008 #, kde-format 10009 msgid "Eastern Time - Indiana - Pike County" 10010 msgstr "" 10011 10012 #. i18n: comment to the previous timezone 10013 #: kdecore/TIMEZONES:329 10014 #, kde-format 10015 msgid "Eastern - IN (Pike)" 10016 msgstr "" 10017 10018 #: kdecore/TIMEZONES:330 10019 #, kde-format 10020 msgid "America/Indiana/Tell_City" 10021 msgstr "અમેરિકા/ઇન્ડિયાના/ટેલ_સીટી" 10022 10023 #. i18n: comment to the previous timezone 10024 #: kdecore/TIMEZONES:332 10025 #, kde-format 10026 msgid "Central Time - Indiana - Perry County" 10027 msgstr "" 10028 10029 #. i18n: comment to the previous timezone 10030 #: kdecore/TIMEZONES:334 10031 #, kde-format 10032 msgid "Central - IN (Perry)" 10033 msgstr "" 10034 10035 #: kdecore/TIMEZONES:335 10036 #, kde-format 10037 msgid "America/Indiana/Vevay" 10038 msgstr "અમેરિકા/ઇન્ડિયાના/વેવાય" 10039 10040 #. i18n: comment to the previous timezone 10041 #: kdecore/TIMEZONES:337 10042 #, kde-format 10043 msgid "Eastern Time - Indiana - Switzerland County" 10044 msgstr "" 10045 10046 #. i18n: comment to the previous timezone 10047 #: kdecore/TIMEZONES:339 10048 #, kde-format 10049 msgid "Eastern - IN (Switzerland)" 10050 msgstr "" 10051 10052 #: kdecore/TIMEZONES:340 10053 #, kde-format 10054 msgid "America/Indiana/Vincennes" 10055 msgstr "અમેરિકા/ઇન્ડિયાના/વિન્સેન્નેસ" 10056 10057 #. i18n: comment to the previous timezone 10058 #: kdecore/TIMEZONES:342 10059 #, kde-format 10060 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 10061 msgstr "" 10062 10063 #. i18n: comment to the previous timezone 10064 #: kdecore/TIMEZONES:344 10065 #, kde-format 10066 msgid "Eastern - IN (Da, Du, K, Mn)" 10067 msgstr "" 10068 10069 #: kdecore/TIMEZONES:345 10070 #, kde-format 10071 msgid "America/Indiana/Winamac" 10072 msgstr "અમેરિકા/ઇન્ડિયાના/વિનમેક" 10073 10074 #. i18n: comment to the previous timezone 10075 #: kdecore/TIMEZONES:347 10076 #, kde-format 10077 msgid "Eastern Time - Indiana - Pulaski County" 10078 msgstr "" 10079 10080 #. i18n: comment to the previous timezone 10081 #: kdecore/TIMEZONES:349 10082 #, kde-format 10083 msgid "Eastern - IN (Pulaski)" 10084 msgstr "" 10085 10086 #: kdecore/TIMEZONES:350 10087 #, kde-format 10088 msgid "America/Indianapolis" 10089 msgstr "અમેરિકા/ઇન્ડિયાનાપોલિસ" 10090 10091 #: kdecore/TIMEZONES:353 10092 #, kde-format 10093 msgid "America/Inuvik" 10094 msgstr "અમેરિકા/ઇનુવિક" 10095 10096 #. i18n: comment to the previous timezone 10097 #: kdecore/TIMEZONES:355 10098 #, kde-format 10099 msgid "Mountain Time - west Northwest Territories" 10100 msgstr "" 10101 10102 #. i18n: comment to the previous timezone 10103 #: kdecore/TIMEZONES:357 10104 #, fuzzy, kde-format 10105 #| msgid "Mountain Time" 10106 msgid "Mountain - NT (west)" 10107 msgstr "પર્વતીય સમય" 10108 10109 #: kdecore/TIMEZONES:358 10110 #, kde-format 10111 msgid "America/Iqaluit" 10112 msgstr "અમેરિકા/ઇકાલુઇટ" 10113 10114 #. i18n: comment to the previous timezone 10115 #: kdecore/TIMEZONES:360 10116 #, kde-format 10117 msgid "Eastern Time - east Nunavut - most locations" 10118 msgstr "" 10119 10120 #. i18n: comment to the previous timezone 10121 #: kdecore/TIMEZONES:362 10122 #, kde-format 10123 msgid "Eastern - NU (most east areas)" 10124 msgstr "" 10125 10126 #: kdecore/TIMEZONES:363 10127 #, kde-format 10128 msgid "America/Jamaica" 10129 msgstr "અમેરિકા/જમૈકા" 10130 10131 #: kdecore/TIMEZONES:364 10132 #, kde-format 10133 msgid "America/Jujuy" 10134 msgstr "અમેરિકા/જુજુય" 10135 10136 #: kdecore/TIMEZONES:367 10137 #, kde-format 10138 msgid "America/Juneau" 10139 msgstr "અમેરિકા/જુનેઆઉ" 10140 10141 #. i18n: comment to the previous timezone 10142 #: kdecore/TIMEZONES:369 10143 #, kde-format 10144 msgid "Alaska Time - Alaska panhandle" 10145 msgstr "" 10146 10147 #. i18n: comment to the previous timezone 10148 #: kdecore/TIMEZONES:371 10149 #, kde-format 10150 msgid "Alaska - Juneau area" 10151 msgstr "" 10152 10153 #: kdecore/TIMEZONES:372 10154 #, kde-format 10155 msgid "America/Kentucky/Louisville" 10156 msgstr "અમેરિકા/કેન્ટુકી/લુઇસવિલે" 10157 10158 #. i18n: comment to the previous timezone 10159 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 10160 #, kde-format 10161 msgid "Eastern Time - Kentucky - Louisville area" 10162 msgstr "પૂર્વિય સમય - કેન્ટુકી - લુઇસવિલે વિસ્તાર" 10163 10164 #. i18n: comment to the previous timezone 10165 #: kdecore/TIMEZONES:376 10166 #, fuzzy, kde-format 10167 #| msgid "Eastern Time - Kentucky - Louisville area" 10168 msgid "Eastern - KY (Louisville area)" 10169 msgstr "પૂર્વિય સમય - કેન્ટુકી - લુઇસવિલે વિસ્તાર" 10170 10171 #: kdecore/TIMEZONES:377 10172 #, kde-format 10173 msgid "America/Kentucky/Monticello" 10174 msgstr "અમેરિકા/કેન્ટુકી/મોન્ટીસેલો" 10175 10176 #. i18n: comment to the previous timezone 10177 #: kdecore/TIMEZONES:379 10178 #, kde-format 10179 msgid "Eastern Time - Kentucky - Wayne County" 10180 msgstr "" 10181 10182 #. i18n: comment to the previous timezone 10183 #: kdecore/TIMEZONES:381 10184 #, kde-format 10185 msgid "Eastern - KY (Wayne)" 10186 msgstr "" 10187 10188 #: kdecore/TIMEZONES:382 10189 #, kde-format 10190 msgid "America/Knox_IN" 10191 msgstr "અમેરિકા/ક્નોક્સ_ઇન" 10192 10193 #: kdecore/TIMEZONES:385 10194 #, fuzzy, kde-format 10195 #| msgid "America/Grenada" 10196 msgid "America/Kralendijk" 10197 msgstr "અમેરિકા/ગ્રેનેડા" 10198 10199 #: kdecore/TIMEZONES:386 10200 #, kde-format 10201 msgid "America/La_Paz" 10202 msgstr "અમેરિકા/લા_પાઝ" 10203 10204 #: kdecore/TIMEZONES:387 10205 #, kde-format 10206 msgid "America/Lima" 10207 msgstr "અમેરિકા/લિમા" 10208 10209 #: kdecore/TIMEZONES:388 10210 #, kde-format 10211 msgid "America/Los_Angeles" 10212 msgstr "અમેરિકા/લોસ_એન્જેલસ" 10213 10214 #. i18n: comment to the previous timezone 10215 #: kdecore/TIMEZONES:392 10216 #, fuzzy, kde-format 10217 #| msgid "US/Pacific" 10218 msgid "Pacific" 10219 msgstr "અમેરિકા/પેસફિક" 10220 10221 #: kdecore/TIMEZONES:393 10222 #, kde-format 10223 msgid "America/Louisville" 10224 msgstr "અમેરિકા/લુઇસવિલે" 10225 10226 #: kdecore/TIMEZONES:396 10227 #, fuzzy, kde-format 10228 #| msgid "America/Port-au-Prince" 10229 msgid "America/Lower_Princes" 10230 msgstr "અમેરિકા/પાર્ટ-આઉ-પ્રિન્સ" 10231 10232 #: kdecore/TIMEZONES:397 10233 #, kde-format 10234 msgid "America/Maceio" 10235 msgstr "અમેરિકા/માસેઇઓ" 10236 10237 #. i18n: comment to the previous timezone 10238 #: kdecore/TIMEZONES:399 10239 #, kde-format 10240 msgid "Alagoas, Sergipe" 10241 msgstr "" 10242 10243 #: kdecore/TIMEZONES:400 10244 #, kde-format 10245 msgid "America/Managua" 10246 msgstr "અમેરિકા/માનાગુઆ" 10247 10248 #: kdecore/TIMEZONES:401 10249 #, kde-format 10250 msgid "America/Manaus" 10251 msgstr "અમેરિકા/માનાઉસ" 10252 10253 #. i18n: comment to the previous timezone 10254 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 10255 #, kde-format 10256 msgid "E Amazonas" 10257 msgstr "પૂ. એમેઝોન્સ" 10258 10259 #. i18n: comment to the previous timezone 10260 #: kdecore/TIMEZONES:405 10261 #, fuzzy, kde-format 10262 #| msgid "W Amazonas" 10263 msgid "Amazonas (east)" 10264 msgstr "પ. એમેઝોન્સ" 10265 10266 #: kdecore/TIMEZONES:406 10267 #, kde-format 10268 msgid "America/Marigot" 10269 msgstr "અમેરિકા/મેરિગોટ" 10270 10271 #: kdecore/TIMEZONES:407 10272 #, kde-format 10273 msgid "America/Martinique" 10274 msgstr "અમેરિકા/માર્ટિનિક" 10275 10276 #: kdecore/TIMEZONES:408 10277 #, fuzzy, kde-format 10278 #| msgid "America/Manaus" 10279 msgid "America/Matamoros" 10280 msgstr "અમેરિકા/માનાઉસ" 10281 10282 #. i18n: comment to the previous timezone 10283 #: kdecore/TIMEZONES:410 10284 #, kde-format 10285 msgid "" 10286 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 10287 msgstr "" 10288 10289 #. i18n: comment to the previous timezone 10290 #: kdecore/TIMEZONES:412 10291 #, kde-format 10292 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 10293 msgstr "" 10294 10295 #: kdecore/TIMEZONES:413 10296 #, kde-format 10297 msgid "America/Mazatlan" 10298 msgstr "અમેરિકા/માઝાટ્લાન" 10299 10300 #. i18n: comment to the previous timezone 10301 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 10302 #, kde-format 10303 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 10304 msgstr "" 10305 10306 #. i18n: comment to the previous timezone 10307 #: kdecore/TIMEZONES:417 10308 #, kde-format 10309 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 10310 msgstr "" 10311 10312 #: kdecore/TIMEZONES:418 10313 #, kde-format 10314 msgid "America/Mendoza" 10315 msgstr "અમેરિકા/મેન્ડોઝા" 10316 10317 #: kdecore/TIMEZONES:421 10318 #, kde-format 10319 msgid "America/Menominee" 10320 msgstr "અમેરિકા/મેનોમિને" 10321 10322 #. i18n: comment to the previous timezone 10323 #: kdecore/TIMEZONES:423 10324 #, kde-format 10325 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 10326 msgstr "" 10327 10328 #. i18n: comment to the previous timezone 10329 #: kdecore/TIMEZONES:425 10330 #, kde-format 10331 msgid "Central - MI (Wisconsin border)" 10332 msgstr "" 10333 10334 #: kdecore/TIMEZONES:426 10335 #, kde-format 10336 msgid "America/Merida" 10337 msgstr "અમેરિકા/મેરિડા" 10338 10339 #. i18n: comment to the previous timezone 10340 #: kdecore/TIMEZONES:428 10341 #, kde-format 10342 msgid "Central Time - Campeche, Yucatan" 10343 msgstr "" 10344 10345 #: kdecore/TIMEZONES:429 10346 #, fuzzy, kde-format 10347 #| msgid "America/Mazatlan" 10348 msgid "America/Metlakatla" 10349 msgstr "અમેરિકા/માઝાટ્લાન" 10350 10351 #. i18n: comment to the previous timezone 10352 #: kdecore/TIMEZONES:431 10353 #, kde-format 10354 msgid "Metlakatla Time - Annette Island" 10355 msgstr "" 10356 10357 #. i18n: comment to the previous timezone 10358 #: kdecore/TIMEZONES:433 10359 #, fuzzy, kde-format 10360 #| msgid "Tasmania - King Island" 10361 msgid "Alaska - Annette Island" 10362 msgstr "તાસ્માનિયા - કીંગ ટાપુ" 10363 10364 #: kdecore/TIMEZONES:434 10365 #, kde-format 10366 msgid "America/Mexico_City" 10367 msgstr "અમેરિકા/મેક્સિકો_સીટી" 10368 10369 #. i18n: comment to the previous timezone 10370 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 10371 #, kde-format 10372 msgid "Central Time - most locations" 10373 msgstr "" 10374 10375 #: kdecore/TIMEZONES:439 10376 #, kde-format 10377 msgid "America/Miquelon" 10378 msgstr "અમેરિકા/મિકેલોન" 10379 10380 #: kdecore/TIMEZONES:440 10381 #, kde-format 10382 msgid "America/Moncton" 10383 msgstr "અમેરિકા/મોન્સ્ટોન" 10384 10385 #. i18n: comment to the previous timezone 10386 #: kdecore/TIMEZONES:442 10387 #, kde-format 10388 msgid "Atlantic Time - New Brunswick" 10389 msgstr "" 10390 10391 #. i18n: comment to the previous timezone 10392 #: kdecore/TIMEZONES:444 10393 #, kde-format 10394 msgid "Atlantic - New Brunswick" 10395 msgstr "" 10396 10397 #: kdecore/TIMEZONES:445 10398 #, kde-format 10399 msgid "America/Monterrey" 10400 msgstr "અમેરિકા/મોન્ટેરરી" 10401 10402 #. i18n: comment to the previous timezone 10403 #: kdecore/TIMEZONES:447 10404 #, kde-format 10405 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10406 msgstr "" 10407 10408 #. i18n: comment to the previous timezone 10409 #: kdecore/TIMEZONES:449 10410 #, kde-format 10411 msgid "" 10412 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10413 "US border" 10414 msgstr "" 10415 10416 #. i18n: comment to the previous timezone 10417 #: kdecore/TIMEZONES:451 10418 #, kde-format 10419 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10420 msgstr "" 10421 10422 #: kdecore/TIMEZONES:452 10423 #, kde-format 10424 msgid "America/Montevideo" 10425 msgstr "અમેરિકા/મોન્ટેવિડિઓ" 10426 10427 #: kdecore/TIMEZONES:453 10428 #, kde-format 10429 msgid "America/Montreal" 10430 msgstr "અમેરિકા/મોન્ટ્રીઅલ" 10431 10432 #. i18n: comment to the previous timezone 10433 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10434 #, kde-format 10435 msgid "Eastern Time - Quebec - most locations" 10436 msgstr "" 10437 10438 #: kdecore/TIMEZONES:456 10439 #, kde-format 10440 msgid "America/Montserrat" 10441 msgstr "અમેરિકા/મોન્ટેસેર્રાન્ટ" 10442 10443 #: kdecore/TIMEZONES:457 10444 #, kde-format 10445 msgid "America/Nassau" 10446 msgstr "અમેરિકા/નાસાઉ" 10447 10448 #: kdecore/TIMEZONES:458 10449 #, kde-format 10450 msgid "America/New_York" 10451 msgstr "અમેરિકા/ન્યુ_યોર્ક" 10452 10453 #. i18n: comment to the previous timezone 10454 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10455 #, kde-format 10456 msgid "Eastern Time" 10457 msgstr "" 10458 10459 #. i18n: comment to the previous timezone 10460 #: kdecore/TIMEZONES:462 10461 #, kde-format 10462 msgid "Eastern (most areas)" 10463 msgstr "" 10464 10465 #: kdecore/TIMEZONES:463 10466 #, kde-format 10467 msgid "America/Nipigon" 10468 msgstr "અમેરિકા/નિપિગોન" 10469 10470 #. i18n: comment to the previous timezone 10471 #: kdecore/TIMEZONES:465 10472 #, kde-format 10473 msgid "" 10474 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10475 msgstr "" 10476 10477 #. i18n: comment to the previous timezone 10478 #: kdecore/TIMEZONES:467 10479 #, kde-format 10480 msgid "Eastern - ON, QC (no DST 1967-73)" 10481 msgstr "" 10482 10483 #: kdecore/TIMEZONES:468 10484 #, kde-format 10485 msgid "America/Nome" 10486 msgstr "અમેરિકા/નોમ" 10487 10488 #. i18n: comment to the previous timezone 10489 #: kdecore/TIMEZONES:470 10490 #, kde-format 10491 msgid "Alaska Time - west Alaska" 10492 msgstr "" 10493 10494 #. i18n: comment to the previous timezone 10495 #: kdecore/TIMEZONES:472 10496 #, fuzzy, kde-format 10497 #| msgid "Alaska Time" 10498 msgid "Alaska (west)" 10499 msgstr "અલાસ્કા સમય" 10500 10501 #: kdecore/TIMEZONES:473 10502 #, kde-format 10503 msgid "America/Noronha" 10504 msgstr "અમેરિકા/નોરોન્હા" 10505 10506 #. i18n: comment to the previous timezone 10507 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10508 #, kde-format 10509 msgid "Atlantic islands" 10510 msgstr "એટલાન્ટિક ટાપુઓ" 10511 10512 #: kdecore/TIMEZONES:476 10513 #, fuzzy, kde-format 10514 #| msgid "America/North_Dakota/Center" 10515 msgid "America/North_Dakota/Beulah" 10516 msgstr "અમેરિકા/નોર્થ_ડાકોટા/સેન્ટર" 10517 10518 #. i18n: comment to the previous timezone 10519 #: kdecore/TIMEZONES:478 10520 #, kde-format 10521 msgid "Central Time - North Dakota - Mercer County" 10522 msgstr "" 10523 10524 #. i18n: comment to the previous timezone 10525 #: kdecore/TIMEZONES:480 10526 #, kde-format 10527 msgid "Central - ND (Mercer)" 10528 msgstr "" 10529 10530 #: kdecore/TIMEZONES:481 10531 #, kde-format 10532 msgid "America/North_Dakota/Center" 10533 msgstr "અમેરિકા/નોર્થ_ડાકોટા/સેન્ટર" 10534 10535 #. i18n: comment to the previous timezone 10536 #: kdecore/TIMEZONES:483 10537 #, kde-format 10538 msgid "Central Time - North Dakota - Oliver County" 10539 msgstr "" 10540 10541 #. i18n: comment to the previous timezone 10542 #: kdecore/TIMEZONES:485 10543 #, fuzzy, kde-format 10544 #| msgid "Central Time" 10545 msgid "Central - ND (Oliver)" 10546 msgstr "મધ્ય સમય" 10547 10548 #: kdecore/TIMEZONES:486 10549 #, kde-format 10550 msgid "America/North_Dakota/New_Salem" 10551 msgstr "અમેરિકા/નોર્થ_ડાકોટા/ન્યુ_સાલેમ" 10552 10553 #. i18n: comment to the previous timezone 10554 #: kdecore/TIMEZONES:488 10555 #, kde-format 10556 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10557 msgstr "" 10558 10559 #. i18n: comment to the previous timezone 10560 #: kdecore/TIMEZONES:490 10561 #, kde-format 10562 msgid "Central - ND (Morton rural)" 10563 msgstr "" 10564 10565 #: kdecore/TIMEZONES:491 10566 #, fuzzy, kde-format 10567 #| msgid "America/Jujuy" 10568 msgid "America/Nuuk" 10569 msgstr "અમેરિકા/જુજુય" 10570 10571 #. i18n: comment to the previous timezone 10572 #: kdecore/TIMEZONES:493 10573 #, kde-format 10574 msgid "Greenland (most areas)" 10575 msgstr "" 10576 10577 #: kdecore/TIMEZONES:494 10578 #, fuzzy, kde-format 10579 #| msgid "America/Managua" 10580 msgid "America/Ojinaga" 10581 msgstr "અમેરિકા/માનાગુઆ" 10582 10583 #. i18n: comment to the previous timezone 10584 #: kdecore/TIMEZONES:496 10585 #, kde-format 10586 msgid "US Mountain Time - Chihuahua near US border" 10587 msgstr "" 10588 10589 #. i18n: comment to the previous timezone 10590 #: kdecore/TIMEZONES:498 10591 #, kde-format 10592 msgid "Mountain Time US - Chihuahua (US border)" 10593 msgstr "" 10594 10595 #: kdecore/TIMEZONES:499 10596 #, kde-format 10597 msgid "America/Ontario" 10598 msgstr "અમેરિકા/ઓન્ટારિઓ" 10599 10600 #: kdecore/TIMEZONES:502 10601 #, kde-format 10602 msgid "America/Panama" 10603 msgstr "અમેરિકા/પનામા" 10604 10605 #: kdecore/TIMEZONES:503 10606 #, kde-format 10607 msgid "America/Pangnirtung" 10608 msgstr "અમેરિકા/પાન્ગનિરટુંગ" 10609 10610 #. i18n: comment to the previous timezone 10611 #: kdecore/TIMEZONES:505 10612 #, kde-format 10613 msgid "Eastern Time - Pangnirtung, Nunavut" 10614 msgstr "" 10615 10616 #. i18n: comment to the previous timezone 10617 #: kdecore/TIMEZONES:507 10618 #, kde-format 10619 msgid "Eastern - NU (Pangnirtung)" 10620 msgstr "" 10621 10622 #: kdecore/TIMEZONES:508 10623 #, kde-format 10624 msgid "America/Paramaribo" 10625 msgstr "અમેરિકા/પારામારિબો" 10626 10627 #: kdecore/TIMEZONES:509 10628 #, kde-format 10629 msgid "America/Phoenix" 10630 msgstr "અમેરિકા/ફોનિક્સ" 10631 10632 #. i18n: comment to the previous timezone 10633 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10634 #, kde-format 10635 msgid "Mountain Standard Time - Arizona" 10636 msgstr "" 10637 10638 #. i18n: comment to the previous timezone 10639 #: kdecore/TIMEZONES:513 10640 #, kde-format 10641 msgid "MST - Arizona (except Navajo)" 10642 msgstr "" 10643 10644 #: kdecore/TIMEZONES:514 10645 #, kde-format 10646 msgid "America/Port-au-Prince" 10647 msgstr "અમેરિકા/પાર્ટ-આઉ-પ્રિન્સ" 10648 10649 #: kdecore/TIMEZONES:515 10650 #, kde-format 10651 msgid "America/Port_of_Spain" 10652 msgstr "અમેરિકા/પોર્ટ_ઓફ_સ્પેન" 10653 10654 #: kdecore/TIMEZONES:516 10655 #, kde-format 10656 msgid "America/Porto_Acre" 10657 msgstr "અમેરિકા/પોર્ટો_એક્રે" 10658 10659 #. i18n: comment to the previous timezone 10660 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10661 #, kde-format 10662 msgid "Acre" 10663 msgstr "" 10664 10665 #: kdecore/TIMEZONES:519 10666 #, kde-format 10667 msgid "America/Porto_Velho" 10668 msgstr "અમેરિકા/પોર્ટો_વેલ્હો" 10669 10670 #. i18n: comment to the previous timezone 10671 #: kdecore/TIMEZONES:521 10672 #, kde-format 10673 msgid "Rondonia" 10674 msgstr "રોન્ડોનિઆ" 10675 10676 #: kdecore/TIMEZONES:522 10677 #, kde-format 10678 msgid "America/Puerto_Rico" 10679 msgstr "અમેરિકા/પુએર્ટો_રિકો" 10680 10681 #: kdecore/TIMEZONES:523 10682 #, fuzzy, kde-format 10683 #| msgid "America/Buenos_Aires" 10684 msgid "America/Punta_Arenas" 10685 msgstr "અમેરિકા/બુએનોસ_એરિસ" 10686 10687 #. i18n: comment to the previous timezone 10688 #: kdecore/TIMEZONES:525 10689 #, kde-format 10690 msgid "Region of Magallanes" 10691 msgstr "" 10692 10693 #: kdecore/TIMEZONES:526 10694 #, kde-format 10695 msgid "America/Rainy_River" 10696 msgstr "અમેરિકા/રેઇની_રિવર" 10697 10698 #. i18n: comment to the previous timezone 10699 #: kdecore/TIMEZONES:528 10700 #, kde-format 10701 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10702 msgstr "" 10703 10704 #. i18n: comment to the previous timezone 10705 #: kdecore/TIMEZONES:530 10706 #, kde-format 10707 msgid "Central - ON (Rainy R, Ft Frances)" 10708 msgstr "" 10709 10710 #: kdecore/TIMEZONES:531 10711 #, kde-format 10712 msgid "America/Rankin_Inlet" 10713 msgstr "અમેરિકા/રાન્કિન_ઇન્લેટ" 10714 10715 #. i18n: comment to the previous timezone 10716 #: kdecore/TIMEZONES:533 10717 #, kde-format 10718 msgid "Central Time - central Nunavut" 10719 msgstr "" 10720 10721 #. i18n: comment to the previous timezone 10722 #: kdecore/TIMEZONES:535 10723 #, kde-format 10724 msgid "Central - NU (central)" 10725 msgstr "" 10726 10727 #: kdecore/TIMEZONES:536 10728 #, kde-format 10729 msgid "America/Recife" 10730 msgstr "અમેરિકા/રેસિફે" 10731 10732 #. i18n: comment to the previous timezone 10733 #: kdecore/TIMEZONES:538 10734 #, kde-format 10735 msgid "Pernambuco" 10736 msgstr "" 10737 10738 #: kdecore/TIMEZONES:539 10739 #, kde-format 10740 msgid "America/Regina" 10741 msgstr "અમેરિકા/રેગિના" 10742 10743 #. i18n: comment to the previous timezone 10744 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10745 #: kdecore/TIMEZONES:1123 10746 #, kde-format 10747 msgid "Central Standard Time - Saskatchewan - most locations" 10748 msgstr "" 10749 10750 #. i18n: comment to the previous timezone 10751 #: kdecore/TIMEZONES:543 10752 #, kde-format 10753 msgid "CST - SK (most areas)" 10754 msgstr "" 10755 10756 #: kdecore/TIMEZONES:544 10757 #, kde-format 10758 msgid "America/Resolute" 10759 msgstr "અમેરિકા/રીસોલ્યુટે" 10760 10761 #. i18n: comment to the previous timezone 10762 #: kdecore/TIMEZONES:546 10763 #, kde-format 10764 msgid "Eastern Time - Resolute, Nunavut" 10765 msgstr "" 10766 10767 #. i18n: comment to the previous timezone 10768 #: kdecore/TIMEZONES:548 10769 #, kde-format 10770 msgid "Central Standard Time - Resolute, Nunavut" 10771 msgstr "" 10772 10773 #. i18n: comment to the previous timezone 10774 #: kdecore/TIMEZONES:550 10775 #, kde-format 10776 msgid "Central - NU (Resolute)" 10777 msgstr "" 10778 10779 #: kdecore/TIMEZONES:551 10780 #, kde-format 10781 msgid "America/Rio_Branco" 10782 msgstr "અમેરિકા/રીઓ_બ્રાન્કો" 10783 10784 #: kdecore/TIMEZONES:554 10785 #, kde-format 10786 msgid "America/Rosario" 10787 msgstr "અમેરિકા/રોસારિઓ" 10788 10789 #: kdecore/TIMEZONES:557 10790 #, fuzzy, kde-format 10791 #| msgid "America/Santarem" 10792 msgid "America/Santa_Isabel" 10793 msgstr "અમેરિકા/સાન્તારેમ" 10794 10795 #. i18n: comment to the previous timezone 10796 #: kdecore/TIMEZONES:559 10797 #, kde-format 10798 msgid "Mexican Pacific Time - Baja California away from US border" 10799 msgstr "" 10800 10801 #: kdecore/TIMEZONES:560 10802 #, kde-format 10803 msgid "America/Santarem" 10804 msgstr "અમેરિકા/સાન્તારેમ" 10805 10806 #. i18n: comment to the previous timezone 10807 #: kdecore/TIMEZONES:562 10808 #, fuzzy, kde-format 10809 #| msgctxt "Coptic month 7 - ShortNamePossessive" 10810 #| msgid "of Par" 10811 msgid "W Para" 10812 msgstr "પાર નું" 10813 10814 #. i18n: comment to the previous timezone 10815 #: kdecore/TIMEZONES:564 10816 #, kde-format 10817 msgid "Para (west)" 10818 msgstr "" 10819 10820 #: kdecore/TIMEZONES:565 10821 #, kde-format 10822 msgid "America/Santiago" 10823 msgstr "અમેરિકા/સાન્ટિઆગો" 10824 10825 #. i18n: comment to the previous timezone 10826 #: kdecore/TIMEZONES:569 10827 #, kde-format 10828 msgid "Chile (most areas)" 10829 msgstr "" 10830 10831 #: kdecore/TIMEZONES:570 10832 #, kde-format 10833 msgid "America/Santo_Domingo" 10834 msgstr "અમેરિકા/સાન્ટો_ડોમિન્ગો" 10835 10836 #: kdecore/TIMEZONES:571 10837 #, kde-format 10838 msgid "America/Sao_Paulo" 10839 msgstr "અમેરિકા/સાઓ_પાઉલો" 10840 10841 #. i18n: comment to the previous timezone 10842 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10843 #, kde-format 10844 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10845 msgstr "" 10846 10847 #. i18n: comment to the previous timezone 10848 #: kdecore/TIMEZONES:575 10849 #, kde-format 10850 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10851 msgstr "" 10852 10853 #: kdecore/TIMEZONES:576 10854 #, kde-format 10855 msgid "America/Saskatoon" 10856 msgstr "અમેરિકા/સાસ્કાટૂન" 10857 10858 #: kdecore/TIMEZONES:579 10859 #, kde-format 10860 msgid "America/Scoresbysund" 10861 msgstr "અમેરિકા/સ્કોર્સબ્યુસુન્ડ" 10862 10863 #. i18n: comment to the previous timezone 10864 #: kdecore/TIMEZONES:581 10865 #, kde-format 10866 msgid "Scoresbysund / Ittoqqortoormiit" 10867 msgstr "" 10868 10869 #. i18n: comment to the previous timezone 10870 #: kdecore/TIMEZONES:583 10871 #, kde-format 10872 msgid "Scoresbysund/Ittoqqortoormiit" 10873 msgstr "" 10874 10875 #: kdecore/TIMEZONES:584 10876 #, kde-format 10877 msgid "America/Shiprock" 10878 msgstr "અમેરિકા/શિપ્રોક" 10879 10880 #. i18n: comment to the previous timezone 10881 #: kdecore/TIMEZONES:586 10882 #, kde-format 10883 msgid "Mountain Time - Navajo" 10884 msgstr "" 10885 10886 #: kdecore/TIMEZONES:587 10887 #, fuzzy, kde-format 10888 #| msgid "America/Atka" 10889 msgid "America/Sitka" 10890 msgstr "અમેરિકા/અટકા" 10891 10892 #. i18n: comment to the previous timezone 10893 #: kdecore/TIMEZONES:589 10894 #, kde-format 10895 msgid "Alaska Time - southeast Alaska panhandle" 10896 msgstr "" 10897 10898 #. i18n: comment to the previous timezone 10899 #: kdecore/TIMEZONES:591 10900 #, fuzzy, kde-format 10901 #| msgid "Alaska Time" 10902 msgid "Alaska - Sitka area" 10903 msgstr "અલાસ્કા સમય" 10904 10905 #: kdecore/TIMEZONES:592 10906 #, kde-format 10907 msgid "America/St_Barthelemy" 10908 msgstr "અમેરિકા/સેન્ટ_બાર્થેલેમી" 10909 10910 #: kdecore/TIMEZONES:593 10911 #, kde-format 10912 msgid "America/St_Johns" 10913 msgstr "અમેરિકા/સેન્ટ_જ્હોન્સ" 10914 10915 #. i18n: comment to the previous timezone 10916 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10917 #, kde-format 10918 msgid "Newfoundland Time, including SE Labrador" 10919 msgstr "" 10920 10921 #. i18n: comment to the previous timezone 10922 #: kdecore/TIMEZONES:597 10923 #, kde-format 10924 msgid "Newfoundland; Labrador (southeast)" 10925 msgstr "" 10926 10927 #: kdecore/TIMEZONES:598 10928 #, kde-format 10929 msgid "America/St_Kitts" 10930 msgstr "અમેરિકા/સેન્ટ_કિટ્ટસ" 10931 10932 #: kdecore/TIMEZONES:599 10933 #, kde-format 10934 msgid "America/St_Lucia" 10935 msgstr "અમેરિકા/સેન્ટ_લ્યુસિઆ" 10936 10937 #: kdecore/TIMEZONES:600 10938 #, kde-format 10939 msgid "America/St_Thomas" 10940 msgstr "અમેરિકા/સેન્ટ_થોમસ" 10941 10942 #: kdecore/TIMEZONES:601 10943 #, kde-format 10944 msgid "America/St_Vincent" 10945 msgstr "અમેરિકા/સેન્ટ_વિન્સેન્ટ" 10946 10947 #: kdecore/TIMEZONES:602 10948 #, kde-format 10949 msgid "America/Swift_Current" 10950 msgstr "અમેરિકા/સ્વિફ્ટ_કરન્ટ" 10951 10952 #. i18n: comment to the previous timezone 10953 #: kdecore/TIMEZONES:604 10954 #, kde-format 10955 msgid "Central Standard Time - Saskatchewan - midwest" 10956 msgstr "" 10957 10958 #. i18n: comment to the previous timezone 10959 #: kdecore/TIMEZONES:606 10960 #, kde-format 10961 msgid "CST - SK (midwest)" 10962 msgstr "" 10963 10964 #: kdecore/TIMEZONES:607 10965 #, kde-format 10966 msgid "America/Tegucigalpa" 10967 msgstr "અમેરિકા/તેગુસિગાલ્પા" 10968 10969 #: kdecore/TIMEZONES:608 10970 #, kde-format 10971 msgid "America/Thule" 10972 msgstr "અમેરિકા/થુલે" 10973 10974 #. i18n: comment to the previous timezone 10975 #: kdecore/TIMEZONES:610 10976 #, kde-format 10977 msgid "Thule / Pituffik" 10978 msgstr "" 10979 10980 #. i18n: comment to the previous timezone 10981 #: kdecore/TIMEZONES:612 10982 #, kde-format 10983 msgid "Thule/Pituffik" 10984 msgstr "" 10985 10986 #: kdecore/TIMEZONES:613 10987 #, kde-format 10988 msgid "America/Thunder_Bay" 10989 msgstr "અમેરિકા/થન્ડર_બે" 10990 10991 #. i18n: comment to the previous timezone 10992 #: kdecore/TIMEZONES:615 10993 #, kde-format 10994 msgid "Eastern Time - Thunder Bay, Ontario" 10995 msgstr "" 10996 10997 #. i18n: comment to the previous timezone 10998 #: kdecore/TIMEZONES:617 10999 #, kde-format 11000 msgid "Eastern - ON (Thunder Bay)" 11001 msgstr "" 11002 11003 #: kdecore/TIMEZONES:618 11004 #, kde-format 11005 msgid "America/Tijuana" 11006 msgstr "અમેરિકા/જુઆના" 11007 11008 #. i18n: comment to the previous timezone 11009 #: kdecore/TIMEZONES:622 11010 #, kde-format 11011 msgid "US Pacific Time - Baja California near US border" 11012 msgstr "" 11013 11014 #. i18n: comment to the previous timezone 11015 #: kdecore/TIMEZONES:624 11016 #, kde-format 11017 msgid "Pacific Time US - Baja California" 11018 msgstr "" 11019 11020 #: kdecore/TIMEZONES:625 11021 #, kde-format 11022 msgid "America/Toronto" 11023 msgstr "અમેરિકા/ટોરેન્ટો" 11024 11025 #. i18n: comment to the previous timezone 11026 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 11027 #, kde-format 11028 msgid "Eastern Time - Ontario - most locations" 11029 msgstr "" 11030 11031 #. i18n: comment to the previous timezone 11032 #: kdecore/TIMEZONES:629 11033 #, kde-format 11034 msgid "Eastern - ON, QC (most areas)" 11035 msgstr "" 11036 11037 #: kdecore/TIMEZONES:630 11038 #, kde-format 11039 msgid "America/Tortola" 11040 msgstr "અમેરિકા/ટોર્ટોલા" 11041 11042 #: kdecore/TIMEZONES:631 11043 #, kde-format 11044 msgid "America/Vancouver" 11045 msgstr "અમેરિકા/વાનકુંવર" 11046 11047 #. i18n: comment to the previous timezone 11048 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 11049 #, kde-format 11050 msgid "Pacific Time - west British Columbia" 11051 msgstr "" 11052 11053 #. i18n: comment to the previous timezone 11054 #: kdecore/TIMEZONES:635 11055 #, kde-format 11056 msgid "Pacific - BC (most areas)" 11057 msgstr "" 11058 11059 #: kdecore/TIMEZONES:636 11060 #, kde-format 11061 msgid "America/Virgin" 11062 msgstr "અમેરિકા/વર્જિન" 11063 11064 #: kdecore/TIMEZONES:637 11065 #, kde-format 11066 msgid "America/Whitehorse" 11067 msgstr "અમેરિકા/વ્હાઇટહાઉસ" 11068 11069 #. i18n: comment to the previous timezone 11070 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 11071 #, kde-format 11072 msgid "Pacific Time - south Yukon" 11073 msgstr "" 11074 11075 #. i18n: comment to the previous timezone 11076 #: kdecore/TIMEZONES:641 11077 #, kde-format 11078 msgid "MST - Yukon (east)" 11079 msgstr "" 11080 11081 #: kdecore/TIMEZONES:642 11082 #, kde-format 11083 msgid "America/Winnipeg" 11084 msgstr "અમેરિકા/વિનિપેગ" 11085 11086 #. i18n: comment to the previous timezone 11087 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 11088 #, kde-format 11089 msgid "Central Time - Manitoba & west Ontario" 11090 msgstr "" 11091 11092 #. i18n: comment to the previous timezone 11093 #: kdecore/TIMEZONES:646 11094 #, kde-format 11095 msgid "Central - ON (west); Manitoba" 11096 msgstr "" 11097 11098 #: kdecore/TIMEZONES:647 11099 #, kde-format 11100 msgid "America/Yakutat" 11101 msgstr "અમેરિકા/યાકુટાટ" 11102 11103 #. i18n: comment to the previous timezone 11104 #: kdecore/TIMEZONES:649 11105 #, kde-format 11106 msgid "Alaska Time - Alaska panhandle neck" 11107 msgstr "" 11108 11109 #. i18n: comment to the previous timezone 11110 #: kdecore/TIMEZONES:651 11111 #, kde-format 11112 msgid "Alaska - Yakutat" 11113 msgstr "" 11114 11115 #: kdecore/TIMEZONES:652 11116 #, kde-format 11117 msgid "America/Yellowknife" 11118 msgstr "અમેરિકા/યેલોનાઇફ" 11119 11120 #. i18n: comment to the previous timezone 11121 #: kdecore/TIMEZONES:654 11122 #, kde-format 11123 msgid "Mountain Time - central Northwest Territories" 11124 msgstr "" 11125 11126 #. i18n: comment to the previous timezone 11127 #: kdecore/TIMEZONES:656 11128 #, fuzzy, kde-format 11129 #| msgid "Mountain Time" 11130 msgid "Mountain - NT (central)" 11131 msgstr "પર્વતીય સમય" 11132 11133 #: kdecore/TIMEZONES:657 11134 #, kde-format 11135 msgid "Antarctica/Casey" 11136 msgstr "એન્ટાર્ટિકા/કેસે" 11137 11138 #. i18n: comment to the previous timezone 11139 #: kdecore/TIMEZONES:659 11140 #, kde-format 11141 msgid "Casey Station, Bailey Peninsula" 11142 msgstr "" 11143 11144 #. i18n: comment to the previous timezone 11145 #: kdecore/TIMEZONES:661 11146 #, kde-format 11147 msgid "Casey" 11148 msgstr "" 11149 11150 #: kdecore/TIMEZONES:662 11151 #, kde-format 11152 msgid "Antarctica/Davis" 11153 msgstr "એન્ટાર્ટિકા/ડેવિસ" 11154 11155 #. i18n: comment to the previous timezone 11156 #: kdecore/TIMEZONES:664 11157 #, kde-format 11158 msgid "Davis Station, Vestfold Hills" 11159 msgstr "" 11160 11161 #. i18n: comment to the previous timezone 11162 #: kdecore/TIMEZONES:666 11163 #, kde-format 11164 msgid "Davis" 11165 msgstr "" 11166 11167 #: kdecore/TIMEZONES:667 11168 #, kde-format 11169 msgid "Antarctica/DumontDUrville" 11170 msgstr "એન્ટાર્ટિકા/ડુમોન્ટઉર્વિલે" 11171 11172 #. i18n: comment to the previous timezone 11173 #: kdecore/TIMEZONES:669 11174 #, kde-format 11175 msgid "Dumont-d'Urville Station, Terre Adelie" 11176 msgstr "" 11177 11178 #. i18n: comment to the previous timezone 11179 #: kdecore/TIMEZONES:671 11180 #, fuzzy, kde-format 11181 #| msgid "Antarctica/DumontDUrville" 11182 msgid "Dumont-d'Urville" 11183 msgstr "એન્ટાર્ટિકા/ડુમોન્ટઉર્વિલે" 11184 11185 #: kdecore/TIMEZONES:672 11186 #, fuzzy, kde-format 11187 #| msgid "Antarctica/McMurdo" 11188 msgid "Antarctica/Macquarie" 11189 msgstr "એન્ટાર્ટિકા/મેકમુર્ડો" 11190 11191 #. i18n: comment to the previous timezone 11192 #: kdecore/TIMEZONES:674 11193 #, kde-format 11194 msgid "Macquarie Island Station, Macquarie Island" 11195 msgstr "" 11196 11197 #. i18n: comment to the previous timezone 11198 #: kdecore/TIMEZONES:676 11199 #, fuzzy, kde-format 11200 #| msgid "Marquesas Islands" 11201 msgid "Macquarie Island" 11202 msgstr "માર્કેસસ ટાપુઓ" 11203 11204 #: kdecore/TIMEZONES:677 11205 #, kde-format 11206 msgid "Antarctica/Mawson" 11207 msgstr "એન્ટાર્ટિકા/માઉસોન" 11208 11209 #. i18n: comment to the previous timezone 11210 #: kdecore/TIMEZONES:679 11211 #, kde-format 11212 msgid "Mawson Station, Holme Bay" 11213 msgstr "" 11214 11215 #. i18n: comment to the previous timezone 11216 #: kdecore/TIMEZONES:681 11217 #, kde-format 11218 msgid "Mawson" 11219 msgstr "" 11220 11221 #: kdecore/TIMEZONES:682 11222 #, kde-format 11223 msgid "Antarctica/McMurdo" 11224 msgstr "એન્ટાર્ટિકા/મેકમુર્ડો" 11225 11226 #. i18n: comment to the previous timezone 11227 #: kdecore/TIMEZONES:684 11228 #, kde-format 11229 msgid "McMurdo Station, Ross Island" 11230 msgstr "" 11231 11232 #. i18n: comment to the previous timezone 11233 #: kdecore/TIMEZONES:686 11234 #, kde-format 11235 msgid "New Zealand time - McMurdo, South Pole" 11236 msgstr "" 11237 11238 #: kdecore/TIMEZONES:687 11239 #, kde-format 11240 msgid "Antarctica/Palmer" 11241 msgstr "એન્ટાર્ટિકા/પાલ્મેર" 11242 11243 #. i18n: comment to the previous timezone 11244 #: kdecore/TIMEZONES:689 11245 #, kde-format 11246 msgid "Palmer Station, Anvers Island" 11247 msgstr "" 11248 11249 #. i18n: comment to the previous timezone 11250 #: kdecore/TIMEZONES:691 11251 #, kde-format 11252 msgid "Palmer" 11253 msgstr "" 11254 11255 #: kdecore/TIMEZONES:692 11256 #, kde-format 11257 msgid "Antarctica/Rothera" 11258 msgstr "એન્ટાર્ટિકા/રોથેરા" 11259 11260 #. i18n: comment to the previous timezone 11261 #: kdecore/TIMEZONES:694 11262 #, kde-format 11263 msgid "Rothera Station, Adelaide Island" 11264 msgstr "" 11265 11266 #. i18n: comment to the previous timezone 11267 #: kdecore/TIMEZONES:696 11268 #, kde-format 11269 msgid "Rothera" 11270 msgstr "" 11271 11272 #: kdecore/TIMEZONES:697 11273 #, kde-format 11274 msgid "Antarctica/South_Pole" 11275 msgstr "એન્ટાર્ટિકા/દક્ષિણ_ધ્રુવ" 11276 11277 #. i18n: comment to the previous timezone 11278 #: kdecore/TIMEZONES:699 11279 #, kde-format 11280 msgid "Amundsen-Scott Station, South Pole" 11281 msgstr "" 11282 11283 #: kdecore/TIMEZONES:700 11284 #, kde-format 11285 msgid "Antarctica/Syowa" 11286 msgstr "એન્ટાર્ટિકા/સ્યોવા" 11287 11288 #. i18n: comment to the previous timezone 11289 #: kdecore/TIMEZONES:702 11290 #, kde-format 11291 msgid "Syowa Station, E Ongul I" 11292 msgstr "" 11293 11294 #. i18n: comment to the previous timezone 11295 #: kdecore/TIMEZONES:704 11296 #, kde-format 11297 msgid "Syowa" 11298 msgstr "" 11299 11300 #: kdecore/TIMEZONES:705 11301 #, fuzzy, kde-format 11302 #| msgid "Antarctica/McMurdo" 11303 msgid "Antarctica/Troll" 11304 msgstr "એન્ટાર્ટિકા/મેકમુર્ડો" 11305 11306 #. i18n: comment to the previous timezone 11307 #: kdecore/TIMEZONES:707 11308 #, kde-format 11309 msgid "Troll" 11310 msgstr "" 11311 11312 #: kdecore/TIMEZONES:708 11313 #, kde-format 11314 msgid "Antarctica/Vostok" 11315 msgstr "એન્ટાર્ટિકા/વોસ્ટોક" 11316 11317 #. i18n: comment to the previous timezone 11318 #: kdecore/TIMEZONES:710 11319 #, kde-format 11320 msgid "Vostok Station, S Magnetic Pole" 11321 msgstr "" 11322 11323 #. i18n: comment to the previous timezone 11324 #: kdecore/TIMEZONES:712 11325 #, kde-format 11326 msgid "Vostok Station, Lake Vostok" 11327 msgstr "" 11328 11329 #. i18n: comment to the previous timezone 11330 #: kdecore/TIMEZONES:714 11331 #, kde-format 11332 msgid "Vostok" 11333 msgstr "" 11334 11335 #: kdecore/TIMEZONES:715 11336 #, kde-format 11337 msgid "Arctic/Longyearbyen" 11338 msgstr "આર્કટિક/લોંગયેરબ્યેન" 11339 11340 #: kdecore/TIMEZONES:716 11341 #, kde-format 11342 msgid "Asia/Aden" 11343 msgstr "એશિયા/એડન" 11344 11345 #: kdecore/TIMEZONES:717 11346 #, kde-format 11347 msgid "Asia/Almaty" 11348 msgstr "એશિયા/અલ્માટી" 11349 11350 #. i18n: comment to the previous timezone 11351 #: kdecore/TIMEZONES:721 11352 #, kde-format 11353 msgid "Kazakhstan (most areas)" 11354 msgstr "" 11355 11356 #: kdecore/TIMEZONES:722 11357 #, kde-format 11358 msgid "Asia/Amman" 11359 msgstr "એશિયા/અમ્માન" 11360 11361 #: kdecore/TIMEZONES:723 11362 #, kde-format 11363 msgid "Asia/Anadyr" 11364 msgstr "એશિયા/અનાડ્યેર" 11365 11366 #. i18n: comment to the previous timezone 11367 #: kdecore/TIMEZONES:725 11368 #, kde-format 11369 msgid "Moscow+10 - Bering Sea" 11370 msgstr "" 11371 11372 #. i18n: comment to the previous timezone 11373 #: kdecore/TIMEZONES:727 11374 #, fuzzy, kde-format 11375 #| msgid "Moscow+08 - Magadan" 11376 msgid "Moscow+08 - Bering Sea" 11377 msgstr "મોસ્કો +૦૮ - માગાદાન" 11378 11379 #. i18n: comment to the previous timezone 11380 #: kdecore/TIMEZONES:729 11381 #, fuzzy, kde-format 11382 #| msgid "Moscow+08 - Magadan" 11383 msgid "MSK+09 - Bering Sea" 11384 msgstr "મોસ્કો +૦૮ - માગાદાન" 11385 11386 #: kdecore/TIMEZONES:730 11387 #, kde-format 11388 msgid "Asia/Aqtau" 11389 msgstr "એશિયા/અક્ટાઉ" 11390 11391 #. i18n: comment to the previous timezone 11392 #: kdecore/TIMEZONES:732 11393 #, kde-format 11394 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11395 msgstr "" 11396 11397 #. i18n: comment to the previous timezone 11398 #: kdecore/TIMEZONES:734 11399 #, kde-format 11400 msgid "Mangghystau/Mankistau" 11401 msgstr "" 11402 11403 #: kdecore/TIMEZONES:735 11404 #, kde-format 11405 msgid "Asia/Aqtobe" 11406 msgstr "એશિયા/અક્ટોબે" 11407 11408 #. i18n: comment to the previous timezone 11409 #: kdecore/TIMEZONES:737 11410 #, kde-format 11411 msgid "Aqtobe (Aktobe)" 11412 msgstr "" 11413 11414 #. i18n: comment to the previous timezone 11415 #: kdecore/TIMEZONES:739 11416 #, kde-format 11417 msgid "Aqtobe/Aktobe" 11418 msgstr "" 11419 11420 #: kdecore/TIMEZONES:740 11421 #, kde-format 11422 msgid "Asia/Ashgabat" 11423 msgstr "એશિયા/અશ્ગબાત" 11424 11425 #: kdecore/TIMEZONES:741 11426 #, kde-format 11427 msgid "Asia/Ashkhabad" 11428 msgstr "એશિયા/અશ્ખાબાદ" 11429 11430 #: kdecore/TIMEZONES:742 11431 #, fuzzy, kde-format 11432 #| msgid "Asia/Aqtau" 11433 msgid "Asia/Atyrau" 11434 msgstr "એશિયા/અક્ટાઉ" 11435 11436 #. i18n: comment to the previous timezone 11437 #: kdecore/TIMEZONES:744 11438 #, kde-format 11439 msgid "Atyrau/Atirau/Gur'yev" 11440 msgstr "" 11441 11442 #: kdecore/TIMEZONES:745 11443 #, kde-format 11444 msgid "Asia/Baghdad" 11445 msgstr "એશિયા/બગદાદ" 11446 11447 #: kdecore/TIMEZONES:746 11448 #, kde-format 11449 msgid "Asia/Bahrain" 11450 msgstr "એશિયા/બહેરિન" 11451 11452 #: kdecore/TIMEZONES:747 11453 #, kde-format 11454 msgid "Asia/Baku" 11455 msgstr "એશિયા/બાકુ" 11456 11457 #: kdecore/TIMEZONES:748 11458 #, kde-format 11459 msgid "Asia/Bangkok" 11460 msgstr "એશિયા/બેંગકોક" 11461 11462 #: kdecore/TIMEZONES:749 11463 #, fuzzy, kde-format 11464 #| msgid "Asia/Baku" 11465 msgid "Asia/Barnaul" 11466 msgstr "એશિયા/બાકુ" 11467 11468 #. i18n: comment to the previous timezone 11469 #: kdecore/TIMEZONES:751 11470 #, kde-format 11471 msgid "MSK+04 - Altai" 11472 msgstr "" 11473 11474 #: kdecore/TIMEZONES:752 11475 #, kde-format 11476 msgid "Asia/Beijing" 11477 msgstr "એશિયા/બેઇજિંગ" 11478 11479 #. i18n: comment to the previous timezone 11480 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11481 #, kde-format 11482 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11483 msgstr "" 11484 11485 #. i18n: comment to the previous timezone 11486 #: kdecore/TIMEZONES:756 11487 #, kde-format 11488 msgid "China Standard Time" 11489 msgstr "" 11490 11491 #: kdecore/TIMEZONES:757 11492 #, kde-format 11493 msgid "Asia/Beirut" 11494 msgstr "એશિયા/બૈરુત" 11495 11496 #: kdecore/TIMEZONES:758 11497 #, kde-format 11498 msgid "Asia/Bishkek" 11499 msgstr "એશિયા/બિશ્કેક" 11500 11501 #: kdecore/TIMEZONES:759 11502 #, kde-format 11503 msgid "Asia/Brunei" 11504 msgstr "એશિયા/બ્રુનેઇ" 11505 11506 #: kdecore/TIMEZONES:760 11507 #, kde-format 11508 msgid "Asia/Calcutta" 11509 msgstr "એશિયા/કલકત્તા" 11510 11511 #: kdecore/TIMEZONES:761 11512 #, fuzzy, kde-format 11513 #| msgid "Asia/Choibalsan" 11514 msgid "Asia/Chita" 11515 msgstr "એશિયા/ચોઇબાલ્સાન" 11516 11517 #. i18n: comment to the previous timezone 11518 #: kdecore/TIMEZONES:763 11519 #, kde-format 11520 msgid "MSK+06 - Zabaykalsky" 11521 msgstr "" 11522 11523 #: kdecore/TIMEZONES:764 11524 #, kde-format 11525 msgid "Asia/Choibalsan" 11526 msgstr "એશિયા/ચોઇબાલ્સાન" 11527 11528 #. i18n: comment to the previous timezone 11529 #: kdecore/TIMEZONES:766 11530 #, kde-format 11531 msgid "Dornod, Sukhbaatar" 11532 msgstr "" 11533 11534 #: kdecore/TIMEZONES:767 11535 #, kde-format 11536 msgid "Asia/Chongqing" 11537 msgstr "એશિયા/ચોંગકિંગ" 11538 11539 #. i18n: comment to the previous timezone 11540 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11541 #, kde-format 11542 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11543 msgstr "" 11544 11545 #. i18n: comment to the previous timezone 11546 #: kdecore/TIMEZONES:771 11547 #, kde-format 11548 msgid "China mountains" 11549 msgstr "" 11550 11551 #: kdecore/TIMEZONES:772 11552 #, kde-format 11553 msgid "Asia/Chungking" 11554 msgstr "એશિયા/ચુંગકિંગ" 11555 11556 #: kdecore/TIMEZONES:775 11557 #, kde-format 11558 msgid "Asia/Colombo" 11559 msgstr "એશિયા/કોલંબો" 11560 11561 #: kdecore/TIMEZONES:776 11562 #, kde-format 11563 msgid "Asia/Dacca" 11564 msgstr "એશિયા/ડાક્કા" 11565 11566 #: kdecore/TIMEZONES:777 11567 #, kde-format 11568 msgid "Asia/Damascus" 11569 msgstr "એશિયા/દમાસ્ક્સ" 11570 11571 #: kdecore/TIMEZONES:778 11572 #, kde-format 11573 msgid "Asia/Dhaka" 11574 msgstr "એશિયા/ઢાકા" 11575 11576 #: kdecore/TIMEZONES:779 11577 #, kde-format 11578 msgid "Asia/Dili" 11579 msgstr "એશિયા/દિલ્લી" 11580 11581 #: kdecore/TIMEZONES:780 11582 #, kde-format 11583 msgid "Asia/Dubai" 11584 msgstr "એશિયા/દુબઇ" 11585 11586 #: kdecore/TIMEZONES:781 11587 #, fuzzy, kde-format 11588 #| msgid "Do shanbe" 11589 msgid "Asia/Dushanbe" 11590 msgstr "દો શાન્બે" 11591 11592 #: kdecore/TIMEZONES:782 11593 #, fuzzy, kde-format 11594 #| msgid "Asia/Damascus" 11595 msgid "Asia/Famagusta" 11596 msgstr "એશિયા/દમાસ્ક્સ" 11597 11598 #. i18n: comment to the previous timezone 11599 #: kdecore/TIMEZONES:784 11600 #, kde-format 11601 msgid "Northern Cyprus" 11602 msgstr "" 11603 11604 #: kdecore/TIMEZONES:785 11605 #, kde-format 11606 msgid "Asia/Gaza" 11607 msgstr "એશિયા/ગાઝા" 11608 11609 #. i18n: comment to the previous timezone 11610 #: kdecore/TIMEZONES:787 11611 #, kde-format 11612 msgid "Gaza Strip" 11613 msgstr "" 11614 11615 #: kdecore/TIMEZONES:788 11616 #, kde-format 11617 msgid "Asia/Harbin" 11618 msgstr "એશિયા/હાર્બિન" 11619 11620 #. i18n: comment to the previous timezone 11621 #: kdecore/TIMEZONES:790 11622 #, kde-format 11623 msgid "Heilongjiang (except Mohe), Jilin" 11624 msgstr "" 11625 11626 #. i18n: comment to the previous timezone 11627 #: kdecore/TIMEZONES:792 11628 #, kde-format 11629 msgid "China north" 11630 msgstr "" 11631 11632 #: kdecore/TIMEZONES:793 11633 #, fuzzy, kde-format 11634 #| msgid "Asia/Harbin" 11635 msgid "Asia/Hebron" 11636 msgstr "એશિયા/હાર્બિન" 11637 11638 #. i18n: comment to the previous timezone 11639 #: kdecore/TIMEZONES:795 11640 #, kde-format 11641 msgid "West Bank" 11642 msgstr "" 11643 11644 #: kdecore/TIMEZONES:796 11645 #, kde-format 11646 msgid "Asia/Ho_Chi_Minh" 11647 msgstr "એશિયા/હો_ચિ_મિન્હ" 11648 11649 #: kdecore/TIMEZONES:797 11650 #, kde-format 11651 msgid "Asia/Hong_Kong" 11652 msgstr "એશિયા/હોંગ_કોંગ" 11653 11654 #: kdecore/TIMEZONES:798 11655 #, kde-format 11656 msgid "Asia/Hovd" 11657 msgstr "એશિયા/હોવ્ડ" 11658 11659 #. i18n: comment to the previous timezone 11660 #: kdecore/TIMEZONES:800 11661 #, kde-format 11662 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11663 msgstr "" 11664 11665 #: kdecore/TIMEZONES:801 11666 #, kde-format 11667 msgid "Asia/Irkutsk" 11668 msgstr "એશિયા/ઇકુત્સ્ક" 11669 11670 #. i18n: comment to the previous timezone 11671 #: kdecore/TIMEZONES:803 11672 #, kde-format 11673 msgid "Moscow+05 - Lake Baikal" 11674 msgstr "મોસ્કો +૦૫ - લેક બૈકાલ" 11675 11676 #. i18n: comment to the previous timezone 11677 #: kdecore/TIMEZONES:805 11678 #, kde-format 11679 msgid "MSK+05 - Irkutsk, Buryatia" 11680 msgstr "" 11681 11682 #: kdecore/TIMEZONES:806 11683 #, kde-format 11684 msgid "Asia/Jakarta" 11685 msgstr "એશિયા/જાકાર્તા" 11686 11687 #. i18n: comment to the previous timezone 11688 #: kdecore/TIMEZONES:808 11689 #, kde-format 11690 msgid "Java & Sumatra" 11691 msgstr "જાવા & સુમાત્રા" 11692 11693 #. i18n: comment to the previous timezone 11694 #: kdecore/TIMEZONES:810 11695 #, fuzzy, kde-format 11696 #| msgid "Java & Sumatra" 11697 msgid "Java, Sumatra" 11698 msgstr "જાવા & સુમાત્રા" 11699 11700 #: kdecore/TIMEZONES:811 11701 #, kde-format 11702 msgid "Asia/Jayapura" 11703 msgstr "એશિયા/જયપુરા" 11704 11705 #. i18n: comment to the previous timezone 11706 #: kdecore/TIMEZONES:813 11707 #, kde-format 11708 msgid "Irian Jaya & the Moluccas" 11709 msgstr "ઈરિયન જયા અને મોલુક્કાસ" 11710 11711 #. i18n: comment to the previous timezone 11712 #: kdecore/TIMEZONES:815 11713 #, kde-format 11714 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11715 msgstr "" 11716 11717 #. i18n: comment to the previous timezone 11718 #: kdecore/TIMEZONES:817 11719 #, kde-format 11720 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11721 msgstr "" 11722 11723 #: kdecore/TIMEZONES:818 11724 #, kde-format 11725 msgid "Asia/Jerusalem" 11726 msgstr "એશિયા/જેરુસલેમ" 11727 11728 #: kdecore/TIMEZONES:819 11729 #, kde-format 11730 msgid "Asia/Kabul" 11731 msgstr "એશિયા/કાબુલ" 11732 11733 #: kdecore/TIMEZONES:820 11734 #, kde-format 11735 msgid "Asia/Kamchatka" 11736 msgstr "એશિયા/કામચાટ્કા" 11737 11738 #. i18n: comment to the previous timezone 11739 #: kdecore/TIMEZONES:822 11740 #, kde-format 11741 msgid "Moscow+09 - Kamchatka" 11742 msgstr "મોસ્કો +૦૯ - કામચાટ્કા" 11743 11744 #. i18n: comment to the previous timezone 11745 #: kdecore/TIMEZONES:824 11746 #, fuzzy, kde-format 11747 #| msgid "Moscow+09 - Kamchatka" 11748 msgid "Moscow+08 - Kamchatka" 11749 msgstr "મોસ્કો +૦૯ - કામચાટ્કા" 11750 11751 #. i18n: comment to the previous timezone 11752 #: kdecore/TIMEZONES:826 11753 #, fuzzy, kde-format 11754 #| msgid "Moscow+09 - Kamchatka" 11755 msgid "MSK+09 - Kamchatka" 11756 msgstr "મોસ્કો +૦૯ - કામચાટ્કા" 11757 11758 #: kdecore/TIMEZONES:827 11759 #, kde-format 11760 msgid "Asia/Karachi" 11761 msgstr "એશિયા/કંરાચી" 11762 11763 #: kdecore/TIMEZONES:828 11764 #, kde-format 11765 msgid "Asia/Kashgar" 11766 msgstr "એશિયા/કાશ્ગર" 11767 11768 #. i18n: comment to the previous timezone 11769 #: kdecore/TIMEZONES:830 11770 #, kde-format 11771 msgid "west Tibet & Xinjiang" 11772 msgstr "પૂર્વ તિબેટ અને ઝિંગિંઅન્ગ" 11773 11774 #. i18n: comment to the previous timezone 11775 #: kdecore/TIMEZONES:832 11776 #, fuzzy, kde-format 11777 #| msgid "west Tibet & Xinjiang" 11778 msgid "China west Xinjiang" 11779 msgstr "પૂર્વ તિબેટ અને ઝિંગિંઅન્ગ" 11780 11781 #: kdecore/TIMEZONES:833 11782 #, fuzzy, kde-format 11783 #| msgid "Asia/Katmandu" 11784 msgid "Asia/Kathmandu" 11785 msgstr "એશિયા/કાઠમંડુ" 11786 11787 #: kdecore/TIMEZONES:834 11788 #, kde-format 11789 msgid "Asia/Katmandu" 11790 msgstr "એશિયા/કાઠમંડુ" 11791 11792 #: kdecore/TIMEZONES:835 11793 #, fuzzy, kde-format 11794 #| msgid "Asia/Shanghai" 11795 msgid "Asia/Khandyga" 11796 msgstr "એશિયા/શાંગાઇ" 11797 11798 #. i18n: comment to the previous timezone 11799 #: kdecore/TIMEZONES:837 11800 #, kde-format 11801 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11802 msgstr "" 11803 11804 #: kdecore/TIMEZONES:838 11805 #, kde-format 11806 msgid "Asia/Kolkata" 11807 msgstr "એશિયા/કોલકાતા" 11808 11809 #: kdecore/TIMEZONES:839 11810 #, kde-format 11811 msgid "Asia/Krasnoyarsk" 11812 msgstr "એશિયા/ક્રસ્નોયાર્સ્ક" 11813 11814 #. i18n: comment to the previous timezone 11815 #: kdecore/TIMEZONES:841 11816 #, kde-format 11817 msgid "Moscow+04 - Yenisei River" 11818 msgstr "મોસ્કો +૦૪ - યેનિસેઈ નદી" 11819 11820 #. i18n: comment to the previous timezone 11821 #: kdecore/TIMEZONES:843 11822 #, kde-format 11823 msgid "MSK+04 - Krasnoyarsk area" 11824 msgstr "" 11825 11826 #: kdecore/TIMEZONES:844 11827 #, kde-format 11828 msgid "Asia/Kuala_Lumpur" 11829 msgstr "એશિયા/કુઆલા_લમ્પુર" 11830 11831 #. i18n: comment to the previous timezone 11832 #: kdecore/TIMEZONES:846 11833 #, kde-format 11834 msgid "peninsular Malaysia" 11835 msgstr "" 11836 11837 #. i18n: comment to the previous timezone 11838 #: kdecore/TIMEZONES:848 11839 #, kde-format 11840 msgid "Malaysia (peninsula)" 11841 msgstr "" 11842 11843 #: kdecore/TIMEZONES:849 11844 #, kde-format 11845 msgid "Asia/Kuching" 11846 msgstr "એશિયા/કુચિંગ" 11847 11848 #. i18n: comment to the previous timezone 11849 #: kdecore/TIMEZONES:851 11850 #, kde-format 11851 msgid "Sabah & Sarawak" 11852 msgstr "સાબાહ અને સારાવાક" 11853 11854 #. i18n: comment to the previous timezone 11855 #: kdecore/TIMEZONES:853 11856 #, fuzzy, kde-format 11857 #| msgid "Sabah & Sarawak" 11858 msgid "Sabah, Sarawak" 11859 msgstr "સાબાહ અને સારાવાક" 11860 11861 #: kdecore/TIMEZONES:854 11862 #, kde-format 11863 msgid "Asia/Kuwait" 11864 msgstr "એશિયા/કુવેત્ત" 11865 11866 #: kdecore/TIMEZONES:855 11867 #, kde-format 11868 msgid "Asia/Macao" 11869 msgstr "એશિયા/મકાઉ" 11870 11871 #: kdecore/TIMEZONES:856 11872 #, kde-format 11873 msgid "Asia/Macau" 11874 msgstr "એશિયા/મકાઉ" 11875 11876 #: kdecore/TIMEZONES:857 11877 #, kde-format 11878 msgid "Asia/Magadan" 11879 msgstr "એશિયા/માગાદાન" 11880 11881 #. i18n: comment to the previous timezone 11882 #: kdecore/TIMEZONES:859 11883 #, kde-format 11884 msgid "Moscow+08 - Magadan" 11885 msgstr "મોસ્કો +૦૮ - માગાદાન" 11886 11887 #. i18n: comment to the previous timezone 11888 #: kdecore/TIMEZONES:861 11889 #, fuzzy, kde-format 11890 #| msgid "Moscow+08 - Magadan" 11891 msgid "MSK+08 - Magadan" 11892 msgstr "મોસ્કો +૦૮ - માગાદાન" 11893 11894 #: kdecore/TIMEZONES:862 11895 #, kde-format 11896 msgid "Asia/Makassar" 11897 msgstr "એશિયા/માકાસ્સર" 11898 11899 #. i18n: comment to the previous timezone 11900 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11901 #, kde-format 11902 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11903 msgstr "" 11904 11905 #. i18n: comment to the previous timezone 11906 #: kdecore/TIMEZONES:866 11907 #, kde-format 11908 msgid "" 11909 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11910 msgstr "" 11911 11912 #. i18n: comment to the previous timezone 11913 #: kdecore/TIMEZONES:868 11914 #, kde-format 11915 msgid "" 11916 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11917 msgstr "" 11918 11919 #: kdecore/TIMEZONES:869 11920 #, kde-format 11921 msgid "Asia/Manila" 11922 msgstr "એશિયા/મનિલા" 11923 11924 #: kdecore/TIMEZONES:870 11925 #, kde-format 11926 msgid "Asia/Muscat" 11927 msgstr "એશિયા/મસ્કત" 11928 11929 #: kdecore/TIMEZONES:871 11930 #, kde-format 11931 msgid "Asia/Nicosia" 11932 msgstr "એશિયા/નિકોસિઆ" 11933 11934 #. i18n: comment to the previous timezone 11935 #: kdecore/TIMEZONES:873 11936 #, kde-format 11937 msgid "Cyprus (most areas)" 11938 msgstr "" 11939 11940 #: kdecore/TIMEZONES:874 11941 #, fuzzy, kde-format 11942 #| msgid "Asia/Irkutsk" 11943 msgid "Asia/Novokuznetsk" 11944 msgstr "એશિયા/ઇકુત્સ્ક" 11945 11946 #. i18n: comment to the previous timezone 11947 #: kdecore/TIMEZONES:876 11948 #, fuzzy, kde-format 11949 #| msgid "Moscow+03 - Novosibirsk" 11950 msgid "Moscow+03 - Novokuznetsk" 11951 msgstr "મોસ્કો+૦૩ - નોવોસિબિરસ્ક" 11952 11953 #. i18n: comment to the previous timezone 11954 #: kdecore/TIMEZONES:878 11955 #, kde-format 11956 msgid "MSK+04 - Kemerovo" 11957 msgstr "" 11958 11959 #: kdecore/TIMEZONES:879 11960 #, kde-format 11961 msgid "Asia/Novosibirsk" 11962 msgstr "એશિયા/નોવોસિબિરસ્ક" 11963 11964 #. i18n: comment to the previous timezone 11965 #: kdecore/TIMEZONES:881 11966 #, kde-format 11967 msgid "Moscow+03 - Novosibirsk" 11968 msgstr "મોસ્કો+૦૩ - નોવોસિબિરસ્ક" 11969 11970 #. i18n: comment to the previous timezone 11971 #: kdecore/TIMEZONES:883 11972 #, fuzzy, kde-format 11973 #| msgid "Moscow+03 - Novosibirsk" 11974 msgid "MSK+04 - Novosibirsk" 11975 msgstr "મોસ્કો+૦૩ - નોવોસિબિરસ્ક" 11976 11977 #: kdecore/TIMEZONES:884 11978 #, kde-format 11979 msgid "Asia/Omsk" 11980 msgstr "એશિયા/ઓમસ્ક" 11981 11982 #. i18n: comment to the previous timezone 11983 #: kdecore/TIMEZONES:886 11984 #, kde-format 11985 msgid "Moscow+03 - west Siberia" 11986 msgstr "" 11987 11988 #. i18n: comment to the previous timezone 11989 #: kdecore/TIMEZONES:888 11990 #, kde-format 11991 msgid "MSK+03 - Omsk" 11992 msgstr "" 11993 11994 #: kdecore/TIMEZONES:889 11995 #, kde-format 11996 msgid "Asia/Oral" 11997 msgstr "એશિયા/ઓરલ" 11998 11999 #. i18n: comment to the previous timezone 12000 #: kdecore/TIMEZONES:891 12001 #, kde-format 12002 msgid "West Kazakhstan" 12003 msgstr "પશ્ચિમ કઝાકસ્તાન" 12004 12005 #: kdecore/TIMEZONES:892 12006 #, kde-format 12007 msgid "Asia/Phnom_Penh" 12008 msgstr "એશિયા/નોમ_પેન્હ" 12009 12010 #: kdecore/TIMEZONES:893 12011 #, kde-format 12012 msgid "Asia/Pontianak" 12013 msgstr "એશિયા/પોન્ટિઆનાક" 12014 12015 #. i18n: comment to the previous timezone 12016 #: kdecore/TIMEZONES:895 12017 #, kde-format 12018 msgid "west & central Borneo" 12019 msgstr "" 12020 12021 #. i18n: comment to the previous timezone 12022 #: kdecore/TIMEZONES:897 12023 #, kde-format 12024 msgid "Borneo (west, central)" 12025 msgstr "" 12026 12027 #: kdecore/TIMEZONES:898 12028 #, kde-format 12029 msgid "Asia/Pyongyang" 12030 msgstr "એશિયા/યોંગયાંગ" 12031 12032 #: kdecore/TIMEZONES:899 12033 #, kde-format 12034 msgid "Asia/Qatar" 12035 msgstr "એશિયા/કતાર" 12036 12037 #: kdecore/TIMEZONES:900 12038 #, fuzzy, kde-format 12039 #| msgid "Asia/Pontianak" 12040 msgid "Asia/Qostanay" 12041 msgstr "એશિયા/પોન્ટિઆનાક" 12042 12043 #. i18n: comment to the previous timezone 12044 #: kdecore/TIMEZONES:902 12045 #, kde-format 12046 msgid "Qostanay/Kostanay/Kustanay" 12047 msgstr "" 12048 12049 #: kdecore/TIMEZONES:903 12050 #, kde-format 12051 msgid "Asia/Qyzylorda" 12052 msgstr "એશિયા/ક્યઝલોર્ડા" 12053 12054 #. i18n: comment to the previous timezone 12055 #: kdecore/TIMEZONES:905 12056 #, kde-format 12057 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 12058 msgstr "" 12059 12060 #. i18n: comment to the previous timezone 12061 #: kdecore/TIMEZONES:907 12062 #, kde-format 12063 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 12064 msgstr "" 12065 12066 #: kdecore/TIMEZONES:908 12067 #, kde-format 12068 msgid "Asia/Rangoon" 12069 msgstr "એશિયા/રંગૂન" 12070 12071 #: kdecore/TIMEZONES:909 12072 #, kde-format 12073 msgid "Asia/Riyadh" 12074 msgstr "એશિયા/રિયાધ" 12075 12076 #: kdecore/TIMEZONES:910 12077 #, kde-format 12078 msgid "Asia/Saigon" 12079 msgstr "એશિયા/સાઇગોન" 12080 12081 #: kdecore/TIMEZONES:911 12082 #, kde-format 12083 msgid "Asia/Sakhalin" 12084 msgstr "એશિયા/સખાલિન" 12085 12086 #. i18n: comment to the previous timezone 12087 #: kdecore/TIMEZONES:913 12088 #, kde-format 12089 msgid "Moscow+07 - Sakhalin Island" 12090 msgstr "" 12091 12092 #. i18n: comment to the previous timezone 12093 #: kdecore/TIMEZONES:915 12094 #, kde-format 12095 msgid "MSK+08 - Sakhalin Island" 12096 msgstr "" 12097 12098 #: kdecore/TIMEZONES:916 12099 #, kde-format 12100 msgid "Asia/Samarkand" 12101 msgstr "એશિયા/સમરકંદ" 12102 12103 #. i18n: comment to the previous timezone 12104 #: kdecore/TIMEZONES:918 12105 #, kde-format 12106 msgid "west Uzbekistan" 12107 msgstr "પશ્ચિમ ઉઝબેકિસ્તાન" 12108 12109 #. i18n: comment to the previous timezone 12110 #: kdecore/TIMEZONES:920 12111 #, fuzzy, kde-format 12112 #| msgid "west Uzbekistan" 12113 msgid "Uzbekistan (west)" 12114 msgstr "પશ્ચિમ ઉઝબેકિસ્તાન" 12115 12116 #: kdecore/TIMEZONES:921 12117 #, kde-format 12118 msgid "Asia/Seoul" 12119 msgstr "એશિયા/સિઓલ" 12120 12121 #: kdecore/TIMEZONES:922 12122 #, kde-format 12123 msgid "Asia/Shanghai" 12124 msgstr "એશિયા/શાંગાઇ" 12125 12126 #. i18n: comment to the previous timezone 12127 #: kdecore/TIMEZONES:926 12128 #, kde-format 12129 msgid "China east" 12130 msgstr "" 12131 12132 #. i18n: comment to the previous timezone 12133 #: kdecore/TIMEZONES:928 12134 #, kde-format 12135 msgid "Beijing Time" 12136 msgstr "" 12137 12138 #: kdecore/TIMEZONES:929 12139 #, kde-format 12140 msgid "Asia/Singapore" 12141 msgstr "એશિયા/સિંગાપુર" 12142 12143 #: kdecore/TIMEZONES:930 12144 #, fuzzy, kde-format 12145 #| msgid "Asia/Krasnoyarsk" 12146 msgid "Asia/Srednekolymsk" 12147 msgstr "એશિયા/ક્રસ્નોયાર્સ્ક" 12148 12149 #. i18n: comment to the previous timezone 12150 #: kdecore/TIMEZONES:932 12151 #, kde-format 12152 msgid "MSK+08 - Sakha (E); North Kuril Is" 12153 msgstr "" 12154 12155 #: kdecore/TIMEZONES:933 12156 #, kde-format 12157 msgid "Asia/Taipei" 12158 msgstr "એશિયા/તાઇપેઇ" 12159 12160 #: kdecore/TIMEZONES:934 12161 #, kde-format 12162 msgid "Asia/Tashkent" 12163 msgstr "એશિયા/તાશ્કંદ" 12164 12165 #. i18n: comment to the previous timezone 12166 #: kdecore/TIMEZONES:936 12167 #, kde-format 12168 msgid "east Uzbekistan" 12169 msgstr "પૂર્વ ઉઝબેકિસ્તાન" 12170 12171 #. i18n: comment to the previous timezone 12172 #: kdecore/TIMEZONES:938 12173 #, fuzzy, kde-format 12174 #| msgid "east Uzbekistan" 12175 msgid "Uzbekistan (east)" 12176 msgstr "પૂર્વ ઉઝબેકિસ્તાન" 12177 12178 #: kdecore/TIMEZONES:939 12179 #, kde-format 12180 msgid "Asia/Tbilisi" 12181 msgstr "એશિયા/ત્બિલ્સિ" 12182 12183 #: kdecore/TIMEZONES:940 12184 #, kde-format 12185 msgid "Asia/Tehran" 12186 msgstr "એશિયા/તહેરાન" 12187 12188 #: kdecore/TIMEZONES:941 12189 #, kde-format 12190 msgid "Asia/Tel_Aviv" 12191 msgstr "એશિયા/તેલ_અવીવ" 12192 12193 #: kdecore/TIMEZONES:942 12194 #, kde-format 12195 msgid "Asia/Thimbu" 12196 msgstr "એશિયા/થિમ્બુ" 12197 12198 #: kdecore/TIMEZONES:943 12199 #, kde-format 12200 msgid "Asia/Thimphu" 12201 msgstr "એશિયા/થિમ્કુ" 12202 12203 #: kdecore/TIMEZONES:944 12204 #, kde-format 12205 msgid "Asia/Tokyo" 12206 msgstr "એશિયા/ટોક્યો" 12207 12208 #: kdecore/TIMEZONES:945 12209 #, fuzzy, kde-format 12210 #| msgid "Asia/Omsk" 12211 msgid "Asia/Tomsk" 12212 msgstr "એશિયા/ઓમસ્ક" 12213 12214 #. i18n: comment to the previous timezone 12215 #: kdecore/TIMEZONES:947 12216 #, kde-format 12217 msgid "MSK+04 - Tomsk" 12218 msgstr "" 12219 12220 #: kdecore/TIMEZONES:948 12221 #, kde-format 12222 msgid "Asia/Ujung_Pandang" 12223 msgstr "એશિયા/ઉજુન્ગ_પાન્ડાન્ગ" 12224 12225 #: kdecore/TIMEZONES:951 12226 #, kde-format 12227 msgid "Asia/Ulaanbaatar" 12228 msgstr "એશિયા/ઉલનબટોર" 12229 12230 #. i18n: comment to the previous timezone 12231 #: kdecore/TIMEZONES:955 12232 #, kde-format 12233 msgid "Mongolia (most areas)" 12234 msgstr "" 12235 12236 #: kdecore/TIMEZONES:956 12237 #, kde-format 12238 msgid "Asia/Ulan_Bator" 12239 msgstr "એશિયા/ઉલન_બટોર" 12240 12241 #: kdecore/TIMEZONES:959 12242 #, kde-format 12243 msgid "Asia/Urumqi" 12244 msgstr "એશિયા/ઉરુમ્કી" 12245 12246 #. i18n: comment to the previous timezone 12247 #: kdecore/TIMEZONES:961 12248 #, kde-format 12249 msgid "most of Tibet & Xinjiang" 12250 msgstr "" 12251 12252 #. i18n: comment to the previous timezone 12253 #: kdecore/TIMEZONES:963 12254 #, kde-format 12255 msgid "China Xinjiang-Tibet" 12256 msgstr "" 12257 12258 #. i18n: comment to the previous timezone 12259 #: kdecore/TIMEZONES:965 12260 #, fuzzy, kde-format 12261 #| msgid "Mountain Time" 12262 msgid "Xinjiang Time" 12263 msgstr "પર્વતીય સમય" 12264 12265 #: kdecore/TIMEZONES:966 12266 #, fuzzy, kde-format 12267 #| msgid "Asia/Tehran" 12268 msgid "Asia/Ust-Nera" 12269 msgstr "એશિયા/તહેરાન" 12270 12271 #. i18n: comment to the previous timezone 12272 #: kdecore/TIMEZONES:968 12273 #, kde-format 12274 msgid "MSK+07 - Oymyakonsky" 12275 msgstr "" 12276 12277 #: kdecore/TIMEZONES:969 12278 #, kde-format 12279 msgid "Asia/Vientiane" 12280 msgstr "એશિયા/વિન્ટિઆને" 12281 12282 #: kdecore/TIMEZONES:970 12283 #, kde-format 12284 msgid "Asia/Vladivostok" 12285 msgstr "એશિયા/વ્લાડિવોસ્ટોક" 12286 12287 #. i18n: comment to the previous timezone 12288 #: kdecore/TIMEZONES:972 12289 #, kde-format 12290 msgid "Moscow+07 - Amur River" 12291 msgstr "" 12292 12293 #. i18n: comment to the previous timezone 12294 #: kdecore/TIMEZONES:974 12295 #, kde-format 12296 msgid "MSK+07 - Amur River" 12297 msgstr "" 12298 12299 #: kdecore/TIMEZONES:975 12300 #, kde-format 12301 msgid "Asia/Yakutsk" 12302 msgstr "એશિયા/યાકુત્સ્ક" 12303 12304 #. i18n: comment to the previous timezone 12305 #: kdecore/TIMEZONES:977 12306 #, kde-format 12307 msgid "Moscow+06 - Lena River" 12308 msgstr "" 12309 12310 #. i18n: comment to the previous timezone 12311 #: kdecore/TIMEZONES:979 12312 #, fuzzy, kde-format 12313 #| msgid "Moscow+04 - Yenisei River" 12314 msgid "MSK+06 - Lena River" 12315 msgstr "મોસ્કો +૦૪ - યેનિસેઈ નદી" 12316 12317 #: kdecore/TIMEZONES:980 12318 #, fuzzy, kde-format 12319 #| msgid "Asia/Rangoon" 12320 msgid "Asia/Yangon" 12321 msgstr "એશિયા/રંગૂન" 12322 12323 #: kdecore/TIMEZONES:981 12324 #, kde-format 12325 msgid "Asia/Yekaterinburg" 12326 msgstr "એશિયા/યેકાટેરીનબર્ગ" 12327 12328 #. i18n: comment to the previous timezone 12329 #: kdecore/TIMEZONES:983 12330 #, kde-format 12331 msgid "Moscow+02 - Urals" 12332 msgstr "" 12333 12334 #. i18n: comment to the previous timezone 12335 #: kdecore/TIMEZONES:985 12336 #, kde-format 12337 msgid "MSK+02 - Urals" 12338 msgstr "" 12339 12340 #: kdecore/TIMEZONES:986 12341 #, kde-format 12342 msgid "Asia/Yerevan" 12343 msgstr "એશિયા/યેરેવાન" 12344 12345 #: kdecore/TIMEZONES:987 12346 #, kde-format 12347 msgid "Atlantic/Azores" 12348 msgstr "એટલાન્ટિક/એઝોરેસ" 12349 12350 #. i18n: comment to the previous timezone 12351 #: kdecore/TIMEZONES:989 12352 #, kde-format 12353 msgid "Azores" 12354 msgstr "એઝોરેસ" 12355 12356 #: kdecore/TIMEZONES:990 12357 #, kde-format 12358 msgid "Atlantic/Bermuda" 12359 msgstr "એટલાન્ટિક/બર્મુડા" 12360 12361 #: kdecore/TIMEZONES:991 12362 #, kde-format 12363 msgid "Atlantic/Canary" 12364 msgstr "એટલાન્ટિક/કેનેરી" 12365 12366 #. i18n: comment to the previous timezone 12367 #: kdecore/TIMEZONES:993 12368 #, kde-format 12369 msgid "Canary Islands" 12370 msgstr "કેનેરી ટાપુઓ" 12371 12372 #: kdecore/TIMEZONES:994 12373 #, kde-format 12374 msgid "Atlantic/Cape_Verde" 12375 msgstr "એટલાન્ટિક/કેપે_વર્દે" 12376 12377 #: kdecore/TIMEZONES:995 12378 #, kde-format 12379 msgid "Atlantic/Faeroe" 12380 msgstr "એટલાન્ટિક/ફાએરોએ" 12381 12382 #: kdecore/TIMEZONES:996 12383 #, kde-format 12384 msgid "Atlantic/Faroe" 12385 msgstr "એટલાન્ટિક/ફારોએ" 12386 12387 #: kdecore/TIMEZONES:997 12388 #, kde-format 12389 msgid "Atlantic/Jan_Mayen" 12390 msgstr "એટલાન્ટિક/જાન_માયેન" 12391 12392 #: kdecore/TIMEZONES:998 12393 #, kde-format 12394 msgid "Atlantic/Madeira" 12395 msgstr "એટલાન્ટિક/મેડૈરા" 12396 12397 #. i18n: comment to the previous timezone 12398 #: kdecore/TIMEZONES:1000 12399 #, kde-format 12400 msgid "Madeira Islands" 12401 msgstr "મેડીઇરા ટાપુઓ" 12402 12403 #: kdecore/TIMEZONES:1001 12404 #, kde-format 12405 msgid "Atlantic/Reykjavik" 12406 msgstr "એટલાન્ટિક/રિકજાવિક" 12407 12408 #: kdecore/TIMEZONES:1002 12409 #, kde-format 12410 msgid "Atlantic/South_Georgia" 12411 msgstr "એટલાન્ટિક/સાઉથ_જ્યોર્જિયા" 12412 12413 #: kdecore/TIMEZONES:1003 12414 #, kde-format 12415 msgid "Atlantic/St_Helena" 12416 msgstr "એટલાન્ટિક/સેન્ટ_હેલેના" 12417 12418 #: kdecore/TIMEZONES:1004 12419 #, kde-format 12420 msgid "Atlantic/Stanley" 12421 msgstr "એટલાન્ટિક/સ્ટેન્લી" 12422 12423 #: kdecore/TIMEZONES:1005 12424 #, kde-format 12425 msgid "Australia/ACT" 12426 msgstr "ઓસ્ટ્રેલિયા/ACT" 12427 12428 #. i18n: comment to the previous timezone 12429 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12430 #: kdecore/TIMEZONES:1073 12431 #, kde-format 12432 msgid "New South Wales - most locations" 12433 msgstr "" 12434 12435 #: kdecore/TIMEZONES:1008 12436 #, kde-format 12437 msgid "Australia/Adelaide" 12438 msgstr "ઓસ્ટ્રેલિયા/એડિલેડ" 12439 12440 #. i18n: comment to the previous timezone 12441 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12442 #, kde-format 12443 msgid "South Australia" 12444 msgstr "દક્ષિણ ઓસ્ટ્રેલિયા" 12445 12446 #: kdecore/TIMEZONES:1011 12447 #, kde-format 12448 msgid "Australia/Brisbane" 12449 msgstr "ઓસ્ટ્રેલિયા/બ્રિસબેન" 12450 12451 #. i18n: comment to the previous timezone 12452 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12453 #, kde-format 12454 msgid "Queensland - most locations" 12455 msgstr "" 12456 12457 #. i18n: comment to the previous timezone 12458 #: kdecore/TIMEZONES:1015 12459 #, kde-format 12460 msgid "Queensland (most areas)" 12461 msgstr "" 12462 12463 #: kdecore/TIMEZONES:1016 12464 #, kde-format 12465 msgid "Australia/Broken_Hill" 12466 msgstr "ઓસ્ટ્રેલિયા/બ્રોકન_હિલ" 12467 12468 #. i18n: comment to the previous timezone 12469 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12470 #, kde-format 12471 msgid "New South Wales - Yancowinna" 12472 msgstr "" 12473 12474 #. i18n: comment to the previous timezone 12475 #: kdecore/TIMEZONES:1020 12476 #, kde-format 12477 msgid "New South Wales (Yancowinna)" 12478 msgstr "" 12479 12480 #: kdecore/TIMEZONES:1021 12481 #, kde-format 12482 msgid "Australia/Canberra" 12483 msgstr "ઓસ્ટ્રેલિયા/કેનબેર્રા" 12484 12485 #: kdecore/TIMEZONES:1024 12486 #, kde-format 12487 msgid "Australia/Currie" 12488 msgstr "ઓસ્ટ્રેલિયા/કુર્રી" 12489 12490 #. i18n: comment to the previous timezone 12491 #: kdecore/TIMEZONES:1026 12492 #, kde-format 12493 msgid "Tasmania - King Island" 12494 msgstr "તાસ્માનિયા - કીંગ ટાપુ" 12495 12496 #: kdecore/TIMEZONES:1027 12497 #, kde-format 12498 msgid "Australia/Darwin" 12499 msgstr "ઓસ્ટ્રેલિયા/ડાર્વિન" 12500 12501 #. i18n: comment to the previous timezone 12502 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12503 #, kde-format 12504 msgid "Northern Territory" 12505 msgstr "" 12506 12507 #: kdecore/TIMEZONES:1030 12508 #, kde-format 12509 msgid "Australia/Eucla" 12510 msgstr "ઓસ્ટ્રેલિયા/ઇક્લા" 12511 12512 #. i18n: comment to the previous timezone 12513 #: kdecore/TIMEZONES:1032 12514 #, kde-format 12515 msgid "Western Australia - Eucla area" 12516 msgstr "પશ્ચિમ ઓસ્ટ્રેલિયા - ઇક્લા વિસ્તાર" 12517 12518 #. i18n: comment to the previous timezone 12519 #: kdecore/TIMEZONES:1034 12520 #, fuzzy, kde-format 12521 #| msgid "Western Australia - Eucla area" 12522 msgid "Western Australia (Eucla)" 12523 msgstr "પશ્ચિમ ઓસ્ટ્રેલિયા - ઇક્લા વિસ્તાર" 12524 12525 #: kdecore/TIMEZONES:1035 12526 #, kde-format 12527 msgid "Australia/Hobart" 12528 msgstr "ઓસ્ટ્રેલિયા/હોબાર્ટ" 12529 12530 #. i18n: comment to the previous timezone 12531 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12532 #, kde-format 12533 msgid "Tasmania - most locations" 12534 msgstr "" 12535 12536 #. i18n: comment to the previous timezone 12537 #: kdecore/TIMEZONES:1039 12538 #, fuzzy, kde-format 12539 #| msgid "Australia/Tasmania" 12540 msgid "Tasmania" 12541 msgstr "ઓસ્ટ્રેલિયા/તાસ્માનિઆ" 12542 12543 #: kdecore/TIMEZONES:1040 12544 #, kde-format 12545 msgid "Australia/LHI" 12546 msgstr "ઓસ્ટ્રેલિયા/LHI" 12547 12548 #. i18n: comment to the previous timezone 12549 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12550 #, kde-format 12551 msgid "Lord Howe Island" 12552 msgstr "લોર્ડ હોવે ટાપુ" 12553 12554 #: kdecore/TIMEZONES:1043 12555 #, kde-format 12556 msgid "Australia/Lindeman" 12557 msgstr "ઓસ્ટ્રેલિયા/લિન્ડેમાન" 12558 12559 #. i18n: comment to the previous timezone 12560 #: kdecore/TIMEZONES:1045 12561 #, kde-format 12562 msgid "Queensland - Holiday Islands" 12563 msgstr "" 12564 12565 #. i18n: comment to the previous timezone 12566 #: kdecore/TIMEZONES:1047 12567 #, kde-format 12568 msgid "Queensland (Whitsunday Islands)" 12569 msgstr "" 12570 12571 #: kdecore/TIMEZONES:1048 12572 #, kde-format 12573 msgid "Australia/Lord_Howe" 12574 msgstr "ઓસ્ટ્રેલિયા/લોર્ડ_હોવે" 12575 12576 #: kdecore/TIMEZONES:1051 12577 #, kde-format 12578 msgid "Australia/Melbourne" 12579 msgstr "ઓસ્ટ્રેલિયા/મેલબોર્ન" 12580 12581 #. i18n: comment to the previous timezone 12582 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12583 #, kde-format 12584 msgid "Victoria" 12585 msgstr "વિક્ટોરિઆ" 12586 12587 #: kdecore/TIMEZONES:1054 12588 #, kde-format 12589 msgid "Australia/NSW" 12590 msgstr "ઓસ્ટ્રેલિયા/NSW" 12591 12592 #: kdecore/TIMEZONES:1057 12593 #, kde-format 12594 msgid "Australia/North" 12595 msgstr "ઓસ્ટ્રેલિયા/ઉત્તર" 12596 12597 #: kdecore/TIMEZONES:1060 12598 #, kde-format 12599 msgid "Australia/Perth" 12600 msgstr "ઓસ્ટ્રેલિયા/પર્થ" 12601 12602 #. i18n: comment to the previous timezone 12603 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12604 #, kde-format 12605 msgid "Western Australia - most locations" 12606 msgstr "" 12607 12608 #. i18n: comment to the previous timezone 12609 #: kdecore/TIMEZONES:1064 12610 #, fuzzy, kde-format 12611 #| msgid "Western Australia - Eucla area" 12612 msgid "Western Australia (most areas)" 12613 msgstr "પશ્ચિમ ઓસ્ટ્રેલિયા - ઇક્લા વિસ્તાર" 12614 12615 #: kdecore/TIMEZONES:1065 12616 #, kde-format 12617 msgid "Australia/Queensland" 12618 msgstr "ઓસ્ટ્રેલિયા/ક્વિન્સલેન્ડ" 12619 12620 #: kdecore/TIMEZONES:1068 12621 #, kde-format 12622 msgid "Australia/South" 12623 msgstr "ઓસ્ટ્રેલિયા/દક્ષિણ" 12624 12625 #: kdecore/TIMEZONES:1071 12626 #, kde-format 12627 msgid "Australia/Sydney" 12628 msgstr "ઓસ્ટ્રેલિયા/સિડની" 12629 12630 #. i18n: comment to the previous timezone 12631 #: kdecore/TIMEZONES:1075 12632 #, kde-format 12633 msgid "New South Wales (most areas)" 12634 msgstr "" 12635 12636 #: kdecore/TIMEZONES:1076 12637 #, kde-format 12638 msgid "Australia/Tasmania" 12639 msgstr "ઓસ્ટ્રેલિયા/તાસ્માનિઆ" 12640 12641 #: kdecore/TIMEZONES:1079 12642 #, kde-format 12643 msgid "Australia/Victoria" 12644 msgstr "ઓસ્ટ્રેલિયા/વિક્ટોરીઆ" 12645 12646 #: kdecore/TIMEZONES:1082 12647 #, kde-format 12648 msgid "Australia/West" 12649 msgstr "ઓસ્ટ્રેલિયા/પશ્ચિમ" 12650 12651 #: kdecore/TIMEZONES:1085 12652 #, kde-format 12653 msgid "Australia/Yancowinna" 12654 msgstr "ઓસ્ટ્રેલિયા/યાન્કોવિન્ના" 12655 12656 #: kdecore/TIMEZONES:1088 12657 #, kde-format 12658 msgid "Brazil/Acre" 12659 msgstr "બ્રાઝિલ/એક્રે" 12660 12661 #: kdecore/TIMEZONES:1091 12662 #, kde-format 12663 msgid "Brazil/DeNoronha" 12664 msgstr "બ્રાઝિલ/ડિનોરોન્હા" 12665 12666 #: kdecore/TIMEZONES:1094 12667 #, kde-format 12668 msgid "Brazil/East" 12669 msgstr "" 12670 12671 #: kdecore/TIMEZONES:1097 12672 #, kde-format 12673 msgid "Brazil/West" 12674 msgstr "" 12675 12676 #: kdecore/TIMEZONES:1100 12677 #, kde-format 12678 msgid "Canada/Atlantic" 12679 msgstr "" 12680 12681 #: kdecore/TIMEZONES:1103 12682 #, kde-format 12683 msgid "Canada/Central" 12684 msgstr "" 12685 12686 #: kdecore/TIMEZONES:1106 12687 #, kde-format 12688 msgid "Canada/East-Saskatchewan" 12689 msgstr "" 12690 12691 #: kdecore/TIMEZONES:1109 12692 #, kde-format 12693 msgid "Canada/Eastern" 12694 msgstr "" 12695 12696 #: kdecore/TIMEZONES:1112 12697 #, kde-format 12698 msgid "Canada/Mountain" 12699 msgstr "" 12700 12701 #: kdecore/TIMEZONES:1115 12702 #, kde-format 12703 msgid "Canada/Newfoundland" 12704 msgstr "" 12705 12706 #: kdecore/TIMEZONES:1118 12707 #, kde-format 12708 msgid "Canada/Pacific" 12709 msgstr "" 12710 12711 #: kdecore/TIMEZONES:1121 12712 #, kde-format 12713 msgid "Canada/Saskatchewan" 12714 msgstr "" 12715 12716 #: kdecore/TIMEZONES:1124 12717 #, kde-format 12718 msgid "Canada/Yukon" 12719 msgstr "કેનેડા/યુકોન" 12720 12721 #: kdecore/TIMEZONES:1127 12722 #, kde-format 12723 msgid "Chile/Continental" 12724 msgstr "" 12725 12726 #: kdecore/TIMEZONES:1130 12727 #, kde-format 12728 msgid "Chile/EasterIsland" 12729 msgstr "" 12730 12731 #. i18n: comment to the previous timezone 12732 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12733 #, kde-format 12734 msgid "Easter Island & Sala y Gomez" 12735 msgstr "" 12736 12737 #: kdecore/TIMEZONES:1133 12738 #, kde-format 12739 msgid "Cuba" 12740 msgstr "ક્યુબા" 12741 12742 #: kdecore/TIMEZONES:1134 12743 #, kde-format 12744 msgid "Egypt" 12745 msgstr "ઇજિપ્ત" 12746 12747 #: kdecore/TIMEZONES:1135 12748 #, kde-format 12749 msgid "Eire" 12750 msgstr "ઇરે" 12751 12752 #: kdecore/TIMEZONES:1136 12753 #, kde-format 12754 msgid "Europe/Amsterdam" 12755 msgstr "યુરોપ/આર્મસ્ટરડેમ" 12756 12757 #: kdecore/TIMEZONES:1137 12758 #, kde-format 12759 msgid "Europe/Andorra" 12760 msgstr "યુરોપ/એન્ડોરા" 12761 12762 #: kdecore/TIMEZONES:1138 12763 #, fuzzy, kde-format 12764 #| msgid "Europe/Athens" 12765 msgid "Europe/Astrakhan" 12766 msgstr "યુરોપ/એથેન્સ" 12767 12768 #. i18n: comment to the previous timezone 12769 #: kdecore/TIMEZONES:1140 12770 #, kde-format 12771 msgid "MSK+01 - Astrakhan" 12772 msgstr "" 12773 12774 #: kdecore/TIMEZONES:1141 12775 #, kde-format 12776 msgid "Europe/Athens" 12777 msgstr "યુરોપ/એથેન્સ" 12778 12779 #: kdecore/TIMEZONES:1142 12780 #, kde-format 12781 msgid "Europe/Belfast" 12782 msgstr "યુરોપ/બેલફાસ્ટ" 12783 12784 #: kdecore/TIMEZONES:1143 12785 #, kde-format 12786 msgid "Europe/Belgrade" 12787 msgstr "યુરોપ/બેલગ્રેડ" 12788 12789 #: kdecore/TIMEZONES:1144 12790 #, kde-format 12791 msgid "Europe/Berlin" 12792 msgstr "યુરોપ/બર્લિન" 12793 12794 #. i18n: comment to the previous timezone 12795 #: kdecore/TIMEZONES:1146 12796 #, kde-format 12797 msgid "Germany (most areas)" 12798 msgstr "" 12799 12800 #: kdecore/TIMEZONES:1147 12801 #, kde-format 12802 msgid "Europe/Bratislava" 12803 msgstr "યુરોપ/બ્રાટિસ્લાવા" 12804 12805 #: kdecore/TIMEZONES:1148 12806 #, kde-format 12807 msgid "Europe/Brussels" 12808 msgstr "યુરોપ/બ્રસેલ્સ" 12809 12810 #: kdecore/TIMEZONES:1149 12811 #, kde-format 12812 msgid "Europe/Bucharest" 12813 msgstr "યુરોપ/બુખારેસ્ટ" 12814 12815 #: kdecore/TIMEZONES:1150 12816 #, kde-format 12817 msgid "Europe/Budapest" 12818 msgstr "યુરોપ/બુડાપેસ્ટ" 12819 12820 #: kdecore/TIMEZONES:1151 12821 #, fuzzy, kde-format 12822 #| msgid "Europe/Brussels" 12823 msgid "Europe/Busingen" 12824 msgstr "યુરોપ/બ્રસેલ્સ" 12825 12826 #. i18n: comment to the previous timezone 12827 #: kdecore/TIMEZONES:1153 12828 #, kde-format 12829 msgid "Busingen" 12830 msgstr "" 12831 12832 #: kdecore/TIMEZONES:1154 12833 #, kde-format 12834 msgid "Europe/Chisinau" 12835 msgstr "યુરોપ/ચિસિનાઉ" 12836 12837 #: kdecore/TIMEZONES:1155 12838 #, kde-format 12839 msgid "Europe/Copenhagen" 12840 msgstr "યુરોપ/કોપનહેગન" 12841 12842 #: kdecore/TIMEZONES:1156 12843 #, kde-format 12844 msgid "Europe/Dublin" 12845 msgstr "યુરોપ/ડબ્લિન" 12846 12847 #: kdecore/TIMEZONES:1157 12848 #, kde-format 12849 msgid "Europe/Gibraltar" 12850 msgstr "યુરોપ/જીબ્રાલ્ટર" 12851 12852 #: kdecore/TIMEZONES:1158 12853 #, kde-format 12854 msgid "Europe/Guernsey" 12855 msgstr "યુરોપ/ગુર્નસે" 12856 12857 #: kdecore/TIMEZONES:1159 12858 #, kde-format 12859 msgid "Europe/Helsinki" 12860 msgstr "યુરોપ/હેલિન્સ્કી" 12861 12862 #: kdecore/TIMEZONES:1160 12863 #, kde-format 12864 msgid "Europe/Isle_of_Man" 12865 msgstr "યુરોપ/આઇસ્લે_ઓફ_મેન" 12866 12867 #: kdecore/TIMEZONES:1161 12868 #, kde-format 12869 msgid "Europe/Istanbul" 12870 msgstr "યુરોપ/ઇસ્તમબુલ" 12871 12872 #: kdecore/TIMEZONES:1162 12873 #, kde-format 12874 msgid "Europe/Jersey" 12875 msgstr "યુરોપ/જર્સી" 12876 12877 #: kdecore/TIMEZONES:1163 12878 #, kde-format 12879 msgid "Europe/Kaliningrad" 12880 msgstr "યુરોપ/ક્લાલિનગ્રાડ" 12881 12882 #. i18n: comment to the previous timezone 12883 #: kdecore/TIMEZONES:1165 12884 #, kde-format 12885 msgid "Moscow-01 - Kaliningrad" 12886 msgstr "" 12887 12888 #. i18n: comment to the previous timezone 12889 #: kdecore/TIMEZONES:1167 12890 #, kde-format 12891 msgid "MSK-01 - Kaliningrad" 12892 msgstr "" 12893 12894 #: kdecore/TIMEZONES:1168 12895 #, kde-format 12896 msgid "Europe/Kiev" 12897 msgstr "યુરોપ/કિવ" 12898 12899 #. i18n: comment to the previous timezone 12900 #: kdecore/TIMEZONES:1172 12901 #, kde-format 12902 msgid "Ukraine (most areas)" 12903 msgstr "" 12904 12905 #: kdecore/TIMEZONES:1173 12906 #, fuzzy, kde-format 12907 #| msgid "Europe/Kiev" 12908 msgid "Europe/Kirov" 12909 msgstr "યુરોપ/કિવ" 12910 12911 #. i18n: comment to the previous timezone 12912 #: kdecore/TIMEZONES:1175 12913 #, kde-format 12914 msgid "MSK+00 - Kirov" 12915 msgstr "" 12916 12917 #: kdecore/TIMEZONES:1176 12918 #, kde-format 12919 msgid "Europe/Lisbon" 12920 msgstr "યુરોપ/લિસ્બન" 12921 12922 #. i18n: comment to the previous timezone 12923 #: kdecore/TIMEZONES:1180 12924 #, kde-format 12925 msgid "Portugal (mainland)" 12926 msgstr "" 12927 12928 #: kdecore/TIMEZONES:1181 12929 #, kde-format 12930 msgid "Europe/Ljubljana" 12931 msgstr "યુરોપ/લજુબ્લિજાના" 12932 12933 #: kdecore/TIMEZONES:1182 12934 #, kde-format 12935 msgid "Europe/London" 12936 msgstr "યુરોપ/લંડન" 12937 12938 #: kdecore/TIMEZONES:1183 12939 #, kde-format 12940 msgid "Europe/Luxembourg" 12941 msgstr "યુરોપ/લક્સમબર્ગ" 12942 12943 #: kdecore/TIMEZONES:1184 12944 #, kde-format 12945 msgid "Europe/Madrid" 12946 msgstr "યુરોપ/મેડ્રિડ" 12947 12948 #. i18n: comment to the previous timezone 12949 #: kdecore/TIMEZONES:1188 12950 #, fuzzy, kde-format 12951 #| msgid "mainland" 12952 msgid "Spain (mainland)" 12953 msgstr "મુખ્યજમીન" 12954 12955 #: kdecore/TIMEZONES:1189 12956 #, kde-format 12957 msgid "Europe/Malta" 12958 msgstr "યુરોપ/માલ્ટા" 12959 12960 #: kdecore/TIMEZONES:1190 12961 #, kde-format 12962 msgid "Europe/Mariehamn" 12963 msgstr "યુરોપ/મારિહામન" 12964 12965 #: kdecore/TIMEZONES:1191 12966 #, kde-format 12967 msgid "Europe/Minsk" 12968 msgstr "યુરોપ/મિન્સ્ક" 12969 12970 #: kdecore/TIMEZONES:1192 12971 #, kde-format 12972 msgid "Europe/Monaco" 12973 msgstr "યુરોપ/મોનેકો" 12974 12975 #: kdecore/TIMEZONES:1193 12976 #, kde-format 12977 msgid "Europe/Moscow" 12978 msgstr "યુરોપ/મોસ્કો" 12979 12980 #. i18n: comment to the previous timezone 12981 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12982 #, kde-format 12983 msgid "Moscow+00 - west Russia" 12984 msgstr "" 12985 12986 #. i18n: comment to the previous timezone 12987 #: kdecore/TIMEZONES:1197 12988 #, kde-format 12989 msgid "MSK+00 - Moscow area" 12990 msgstr "" 12991 12992 #: kdecore/TIMEZONES:1198 12993 #, kde-format 12994 msgid "Europe/Oslo" 12995 msgstr "યુરોપ/ઓસ્લો" 12996 12997 #: kdecore/TIMEZONES:1199 12998 #, kde-format 12999 msgid "Europe/Paris" 13000 msgstr "યુરોપ/પેરિસ" 13001 13002 #: kdecore/TIMEZONES:1200 13003 #, kde-format 13004 msgid "Europe/Podgorica" 13005 msgstr "યુરોપ/પોડ્ગોરિકા" 13006 13007 #: kdecore/TIMEZONES:1201 13008 #, kde-format 13009 msgid "Europe/Prague" 13010 msgstr "યુરોપ/પ્રાગ" 13011 13012 #: kdecore/TIMEZONES:1202 13013 #, kde-format 13014 msgid "Europe/Riga" 13015 msgstr "યુરોપ/રિગા" 13016 13017 #: kdecore/TIMEZONES:1203 13018 #, kde-format 13019 msgid "Europe/Rome" 13020 msgstr "યુરોપ/રોમ" 13021 13022 #: kdecore/TIMEZONES:1204 13023 #, kde-format 13024 msgid "Europe/Samara" 13025 msgstr "યુરોપ/સમારા" 13026 13027 #. i18n: comment to the previous timezone 13028 #: kdecore/TIMEZONES:1206 13029 #, kde-format 13030 msgid "Moscow+01 - Samara, Udmurtia" 13031 msgstr "" 13032 13033 #. i18n: comment to the previous timezone 13034 #: kdecore/TIMEZONES:1208 13035 #, fuzzy, kde-format 13036 #| msgid "Moscow+09 - Kamchatka" 13037 msgid "Moscow+00 - Samara, Udmurtia" 13038 msgstr "મોસ્કો +૦૯ - કામચાટ્કા" 13039 13040 #. i18n: comment to the previous timezone 13041 #: kdecore/TIMEZONES:1210 13042 #, fuzzy, kde-format 13043 #| msgid "Moscow+09 - Kamchatka" 13044 msgid "MSK+01 - Samara, Udmurtia" 13045 msgstr "મોસ્કો +૦૯ - કામચાટ્કા" 13046 13047 #: kdecore/TIMEZONES:1211 13048 #, kde-format 13049 msgid "Europe/San_Marino" 13050 msgstr "યુરોપ/સાન_મરિનો" 13051 13052 #: kdecore/TIMEZONES:1212 13053 #, kde-format 13054 msgid "Europe/Sarajevo" 13055 msgstr "યુરોપ/સારાજેવો" 13056 13057 #: kdecore/TIMEZONES:1213 13058 #, fuzzy, kde-format 13059 #| msgid "Europe/Sarajevo" 13060 msgid "Europe/Saratov" 13061 msgstr "યુરોપ/સારાજેવો" 13062 13063 #. i18n: comment to the previous timezone 13064 #: kdecore/TIMEZONES:1215 13065 #, kde-format 13066 msgid "MSK+01 - Saratov" 13067 msgstr "" 13068 13069 #: kdecore/TIMEZONES:1216 13070 #, kde-format 13071 msgid "Europe/Simferopol" 13072 msgstr "યુરોપ/સિમ્ફરપોલ" 13073 13074 #. i18n: comment to the previous timezone 13075 #: kdecore/TIMEZONES:1218 13076 #, kde-format 13077 msgid "central Crimea" 13078 msgstr "" 13079 13080 #. i18n: comment to the previous timezone 13081 #: kdecore/TIMEZONES:1220 13082 #, fuzzy, kde-format 13083 #| msgid "Prime: " 13084 msgid "Crimea" 13085 msgstr "મુખ્ય: " 13086 13087 #: kdecore/TIMEZONES:1221 13088 #, kde-format 13089 msgid "Europe/Skopje" 13090 msgstr "યુરોપ/સ્કોપજે" 13091 13092 #: kdecore/TIMEZONES:1222 13093 #, kde-format 13094 msgid "Europe/Sofia" 13095 msgstr "યુરોપ/સોફિઆ" 13096 13097 #: kdecore/TIMEZONES:1223 13098 #, kde-format 13099 msgid "Europe/Stockholm" 13100 msgstr "યુરોપ/સ્ટોકહોમ" 13101 13102 #: kdecore/TIMEZONES:1224 13103 #, kde-format 13104 msgid "Europe/Tallinn" 13105 msgstr "યુરોપ/તાલિલિન" 13106 13107 #: kdecore/TIMEZONES:1225 13108 #, kde-format 13109 msgid "Europe/Tirane" 13110 msgstr "યુરોપ/ટિરાને" 13111 13112 #: kdecore/TIMEZONES:1226 13113 #, kde-format 13114 msgid "Europe/Tiraspol" 13115 msgstr "યુરોપ/તિરાસ્પોલ" 13116 13117 #: kdecore/TIMEZONES:1227 13118 #, fuzzy, kde-format 13119 #| msgid "Europe/Minsk" 13120 msgid "Europe/Ulyanovsk" 13121 msgstr "યુરોપ/મિન્સ્ક" 13122 13123 #. i18n: comment to the previous timezone 13124 #: kdecore/TIMEZONES:1229 13125 #, kde-format 13126 msgid "MSK+01 - Ulyanovsk" 13127 msgstr "" 13128 13129 #: kdecore/TIMEZONES:1230 13130 #, kde-format 13131 msgid "Europe/Uzhgorod" 13132 msgstr "યુરોપ/ઉઝગોરોડ" 13133 13134 #. i18n: comment to the previous timezone 13135 #: kdecore/TIMEZONES:1232 13136 #, kde-format 13137 msgid "Ruthenia" 13138 msgstr "" 13139 13140 #. i18n: comment to the previous timezone 13141 #: kdecore/TIMEZONES:1234 13142 #, kde-format 13143 msgid "Transcarpathia" 13144 msgstr "" 13145 13146 #: kdecore/TIMEZONES:1235 13147 #, kde-format 13148 msgid "Europe/Vaduz" 13149 msgstr "યુરોપ/વાડુઝ" 13150 13151 #: kdecore/TIMEZONES:1236 13152 #, kde-format 13153 msgid "Europe/Vatican" 13154 msgstr "યુરોપ/વેટિકન" 13155 13156 #: kdecore/TIMEZONES:1237 13157 #, kde-format 13158 msgid "Europe/Vienna" 13159 msgstr "યુરોપ/વિએના" 13160 13161 #: kdecore/TIMEZONES:1238 13162 #, kde-format 13163 msgid "Europe/Vilnius" 13164 msgstr "યુરોપ/વિલ્નિઅસ" 13165 13166 #: kdecore/TIMEZONES:1239 13167 #, kde-format 13168 msgid "Europe/Volgograd" 13169 msgstr "યુરોપ/વોલ્ગોગ્રાડ" 13170 13171 #. i18n: comment to the previous timezone 13172 #: kdecore/TIMEZONES:1241 13173 #, kde-format 13174 msgid "Moscow+00 - Caspian Sea" 13175 msgstr "" 13176 13177 #. i18n: comment to the previous timezone 13178 #: kdecore/TIMEZONES:1243 13179 #, kde-format 13180 msgid "MSK+00 - Volgograd" 13181 msgstr "" 13182 13183 #: kdecore/TIMEZONES:1244 13184 #, kde-format 13185 msgid "Europe/Warsaw" 13186 msgstr "યુરોપ/વોર્સો" 13187 13188 #: kdecore/TIMEZONES:1245 13189 #, kde-format 13190 msgid "Europe/Zagreb" 13191 msgstr "યુરોપ/ઝાગ્રેબ" 13192 13193 #: kdecore/TIMEZONES:1246 13194 #, kde-format 13195 msgid "Europe/Zaporozhye" 13196 msgstr "યુરોપ/ઝાપોરોજ્યે" 13197 13198 #. i18n: comment to the previous timezone 13199 #: kdecore/TIMEZONES:1248 13200 #, kde-format 13201 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 13202 msgstr "" 13203 13204 #. i18n: comment to the previous timezone 13205 #: kdecore/TIMEZONES:1250 13206 #, kde-format 13207 msgid "Zaporozhye and east Lugansk" 13208 msgstr "" 13209 13210 #: kdecore/TIMEZONES:1251 13211 #, kde-format 13212 msgid "Europe/Zurich" 13213 msgstr "યુરોપ/ઝ્યુરિચ" 13214 13215 #: kdecore/TIMEZONES:1252 13216 #, kde-format 13217 msgid "GB" 13218 msgstr "GB" 13219 13220 #: kdecore/TIMEZONES:1253 13221 #, kde-format 13222 msgid "GB-Eire" 13223 msgstr "" 13224 13225 #: kdecore/TIMEZONES:1254 13226 #, kde-format 13227 msgid "Hongkong" 13228 msgstr "હોંગકોંગ" 13229 13230 #: kdecore/TIMEZONES:1255 13231 #, kde-format 13232 msgid "Iceland" 13233 msgstr "આઇસલેન્ડ" 13234 13235 #: kdecore/TIMEZONES:1256 13236 #, kde-format 13237 msgid "Indian/Antananarivo" 13238 msgstr "હિંદ/એન્ટાનાનારિવો" 13239 13240 #: kdecore/TIMEZONES:1257 13241 #, kde-format 13242 msgid "Indian/Chagos" 13243 msgstr "હિંદ/ચાગોસ" 13244 13245 #: kdecore/TIMEZONES:1258 13246 #, kde-format 13247 msgid "Indian/Christmas" 13248 msgstr "હિંદ/ક્રિસમસ" 13249 13250 #: kdecore/TIMEZONES:1259 13251 #, kde-format 13252 msgid "Indian/Cocos" 13253 msgstr "હિંદ/કોકોસ" 13254 13255 #: kdecore/TIMEZONES:1260 13256 #, kde-format 13257 msgid "Indian/Comoro" 13258 msgstr "હિંદ/કોમોરો" 13259 13260 #: kdecore/TIMEZONES:1261 13261 #, kde-format 13262 msgid "Indian/Kerguelen" 13263 msgstr "હિંદ/કિર્ગુએલેન" 13264 13265 #: kdecore/TIMEZONES:1262 13266 #, kde-format 13267 msgid "Indian/Mahe" 13268 msgstr "હિંદ/માહે" 13269 13270 #: kdecore/TIMEZONES:1263 13271 #, kde-format 13272 msgid "Indian/Maldives" 13273 msgstr "હિંદ/માલ્દિવ્સ" 13274 13275 #: kdecore/TIMEZONES:1264 13276 #, kde-format 13277 msgid "Indian/Mauritius" 13278 msgstr "હિંદ/મોરિશિઅસ" 13279 13280 #: kdecore/TIMEZONES:1265 13281 #, kde-format 13282 msgid "Indian/Mayotte" 13283 msgstr "હિંદ/માયોટ્ટે" 13284 13285 #: kdecore/TIMEZONES:1266 13286 #, fuzzy, kde-format 13287 #| msgctxt "@item Calendar system" 13288 #| msgid "Indian National" 13289 msgid "Indian/Reunion" 13290 msgstr "ભારતીય રાષ્ટ્રીય" 13291 13292 #: kdecore/TIMEZONES:1267 13293 #, kde-format 13294 msgid "Iran" 13295 msgstr "ઇરાન" 13296 13297 #: kdecore/TIMEZONES:1268 13298 #, kde-format 13299 msgid "Israel" 13300 msgstr "ઇઝરાયેલ" 13301 13302 #: kdecore/TIMEZONES:1269 13303 #, kde-format 13304 msgid "Jamaica" 13305 msgstr "જમૈકા" 13306 13307 #: kdecore/TIMEZONES:1270 13308 #, kde-format 13309 msgid "Japan" 13310 msgstr "જાપાન" 13311 13312 #. i18n: comment to the previous timezone 13313 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 13314 #, kde-format 13315 msgid "Kwajalein" 13316 msgstr "ક્વાજાલેન" 13317 13318 #: kdecore/TIMEZONES:1274 13319 #, kde-format 13320 msgid "Libya" 13321 msgstr "લિબિયા" 13322 13323 #: kdecore/TIMEZONES:1275 13324 #, kde-format 13325 msgid "Mexico/BajaNorte" 13326 msgstr "" 13327 13328 #: kdecore/TIMEZONES:1278 13329 #, kde-format 13330 msgid "Mexico/BajaSur" 13331 msgstr "" 13332 13333 #: kdecore/TIMEZONES:1281 13334 #, kde-format 13335 msgid "Mexico/General" 13336 msgstr "મેક્સિકો/સામાન્ય" 13337 13338 #: kdecore/TIMEZONES:1284 13339 #, kde-format 13340 msgid "NZ" 13341 msgstr "NZ" 13342 13343 #: kdecore/TIMEZONES:1287 13344 #, kde-format 13345 msgid "NZ-CHAT" 13346 msgstr "NZ-CHAT" 13347 13348 #. i18n: comment to the previous timezone 13349 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 13350 #, kde-format 13351 msgid "Chatham Islands" 13352 msgstr "" 13353 13354 #: kdecore/TIMEZONES:1290 13355 #, kde-format 13356 msgid "Navajo" 13357 msgstr "નાવાજો" 13358 13359 #: kdecore/TIMEZONES:1293 13360 #, kde-format 13361 msgid "PRC" 13362 msgstr "PRC" 13363 13364 #: kdecore/TIMEZONES:1296 13365 #, kde-format 13366 msgid "Pacific/Apia" 13367 msgstr "પેસફિક/અપીઆ" 13368 13369 #: kdecore/TIMEZONES:1297 13370 #, kde-format 13371 msgid "Pacific/Auckland" 13372 msgstr "પેસફિક/ઓકલેન્ડ" 13373 13374 #. i18n: comment to the previous timezone 13375 #: kdecore/TIMEZONES:1301 13376 #, kde-format 13377 msgid "New Zealand (most areas)" 13378 msgstr "" 13379 13380 #: kdecore/TIMEZONES:1302 13381 #, fuzzy, kde-format 13382 #| msgid "Pacific/Honolulu" 13383 msgid "Pacific/Bougainville" 13384 msgstr "પેસફિક/હોનોલુલુ" 13385 13386 #. i18n: comment to the previous timezone 13387 #: kdecore/TIMEZONES:1304 13388 #, kde-format 13389 msgid "Bougainville" 13390 msgstr "" 13391 13392 #: kdecore/TIMEZONES:1305 13393 #, kde-format 13394 msgid "Pacific/Chatham" 13395 msgstr "પેસફિક/ચાટહામ" 13396 13397 #: kdecore/TIMEZONES:1308 13398 #, fuzzy, kde-format 13399 #| msgid "Pacific/Truk" 13400 msgid "Pacific/Chuuk" 13401 msgstr "પેસફિક/ટુર્ક" 13402 13403 #. i18n: comment to the previous timezone 13404 #: kdecore/TIMEZONES:1310 13405 #, kde-format 13406 msgid "Chuuk (Truk) and Yap" 13407 msgstr "" 13408 13409 #. i18n: comment to the previous timezone 13410 #: kdecore/TIMEZONES:1312 13411 #, kde-format 13412 msgid "Chuuk/Truk, Yap" 13413 msgstr "" 13414 13415 #: kdecore/TIMEZONES:1313 13416 #, kde-format 13417 msgid "Pacific/Easter" 13418 msgstr "પેસફિક/ઇસ્ટર" 13419 13420 #. i18n: comment to the previous timezone 13421 #: kdecore/TIMEZONES:1317 13422 #, fuzzy, kde-format 13423 #| msgid "Wake Island" 13424 msgid "Easter Island" 13425 msgstr "વેક ટાપુ" 13426 13427 #: kdecore/TIMEZONES:1318 13428 #, kde-format 13429 msgid "Pacific/Efate" 13430 msgstr "પેસફિક/ઇફાટે" 13431 13432 #: kdecore/TIMEZONES:1319 13433 #, kde-format 13434 msgid "Pacific/Enderbury" 13435 msgstr "પેસફિક/એન્ડરબરી" 13436 13437 #. i18n: comment to the previous timezone 13438 #: kdecore/TIMEZONES:1321 13439 #, kde-format 13440 msgid "Phoenix Islands" 13441 msgstr "ફિનિક્સ ટાપુઓ" 13442 13443 #: kdecore/TIMEZONES:1322 13444 #, kde-format 13445 msgid "Pacific/Fakaofo" 13446 msgstr "પેસફિક/ફાકાઓફો" 13447 13448 #: kdecore/TIMEZONES:1323 13449 #, kde-format 13450 msgid "Pacific/Fiji" 13451 msgstr "પેસફિક/ફિજી" 13452 13453 #: kdecore/TIMEZONES:1324 13454 #, kde-format 13455 msgid "Pacific/Funafuti" 13456 msgstr "પેસફિક/ફુનાફુટી" 13457 13458 #: kdecore/TIMEZONES:1325 13459 #, kde-format 13460 msgid "Pacific/Galapagos" 13461 msgstr "પેસફિક/ગાલાપાગોસ" 13462 13463 #. i18n: comment to the previous timezone 13464 #: kdecore/TIMEZONES:1327 13465 #, kde-format 13466 msgid "Galapagos Islands" 13467 msgstr "ગાલાપાગોસ ટાપુઓ" 13468 13469 #: kdecore/TIMEZONES:1328 13470 #, kde-format 13471 msgid "Pacific/Gambier" 13472 msgstr "પેસફિક/ગામ્બિઅર" 13473 13474 #. i18n: comment to the previous timezone 13475 #: kdecore/TIMEZONES:1330 13476 #, kde-format 13477 msgid "Gambier Islands" 13478 msgstr "ગેમ્બેઇર ટાપુઓ" 13479 13480 #: kdecore/TIMEZONES:1331 13481 #, kde-format 13482 msgid "Pacific/Guadalcanal" 13483 msgstr "પેસફિક/ગુઆડાલ્કાનાલ" 13484 13485 #: kdecore/TIMEZONES:1332 13486 #, kde-format 13487 msgid "Pacific/Guam" 13488 msgstr "પેસફિક/ગુઆમ" 13489 13490 #: kdecore/TIMEZONES:1333 13491 #, kde-format 13492 msgid "Pacific/Honolulu" 13493 msgstr "પેસફિક/હોનોલુલુ" 13494 13495 #. i18n: comment to the previous timezone 13496 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13497 #, kde-format 13498 msgid "Hawaii" 13499 msgstr "હવાઇ" 13500 13501 #: kdecore/TIMEZONES:1336 13502 #, kde-format 13503 msgid "Pacific/Johnston" 13504 msgstr "પેસફિક/જ્હોન્સ્ટોન" 13505 13506 #. i18n: comment to the previous timezone 13507 #: kdecore/TIMEZONES:1338 13508 #, kde-format 13509 msgid "Johnston Atoll" 13510 msgstr "જોહ્નસ્ટન અટોલ" 13511 13512 #: kdecore/TIMEZONES:1339 13513 #, kde-format 13514 msgid "Pacific/Kiritimati" 13515 msgstr "પેસફિક/કિરિમાટી" 13516 13517 #. i18n: comment to the previous timezone 13518 #: kdecore/TIMEZONES:1341 13519 #, kde-format 13520 msgid "Line Islands" 13521 msgstr "લાઇન ટાપુઓ" 13522 13523 #: kdecore/TIMEZONES:1342 13524 #, kde-format 13525 msgid "Pacific/Kosrae" 13526 msgstr "પેસફિક/કોસ્રાએ" 13527 13528 #. i18n: comment to the previous timezone 13529 #: kdecore/TIMEZONES:1344 13530 #, kde-format 13531 msgid "Kosrae" 13532 msgstr "કોસ્રાએ" 13533 13534 #: kdecore/TIMEZONES:1345 13535 #, kde-format 13536 msgid "Pacific/Kwajalein" 13537 msgstr "પેસફિક/ક્વાજાલેન" 13538 13539 #: kdecore/TIMEZONES:1348 13540 #, kde-format 13541 msgid "Pacific/Majuro" 13542 msgstr "પેસફિક/માજુરો" 13543 13544 #. i18n: comment to the previous timezone 13545 #: kdecore/TIMEZONES:1352 13546 #, kde-format 13547 msgid "Marshall Islands (most areas)" 13548 msgstr "" 13549 13550 #: kdecore/TIMEZONES:1353 13551 #, kde-format 13552 msgid "Pacific/Marquesas" 13553 msgstr "પેસફિક/માર્કુસાસ" 13554 13555 #. i18n: comment to the previous timezone 13556 #: kdecore/TIMEZONES:1355 13557 #, kde-format 13558 msgid "Marquesas Islands" 13559 msgstr "માર્કેસસ ટાપુઓ" 13560 13561 #: kdecore/TIMEZONES:1356 13562 #, kde-format 13563 msgid "Pacific/Midway" 13564 msgstr "પેસફિક/મિડવે" 13565 13566 #. i18n: comment to the previous timezone 13567 #: kdecore/TIMEZONES:1358 13568 #, kde-format 13569 msgid "Midway Islands" 13570 msgstr "મિડવે ટાપુઓ" 13571 13572 #: kdecore/TIMEZONES:1359 13573 #, kde-format 13574 msgid "Pacific/Nauru" 13575 msgstr "પેસફિક/નાઉરુ" 13576 13577 #: kdecore/TIMEZONES:1360 13578 #, kde-format 13579 msgid "Pacific/Niue" 13580 msgstr "પેસફિક/નિઉ" 13581 13582 #: kdecore/TIMEZONES:1361 13583 #, kde-format 13584 msgid "Pacific/Norfolk" 13585 msgstr "પેસફિક/નોર્ફોક" 13586 13587 #: kdecore/TIMEZONES:1362 13588 #, kde-format 13589 msgid "Pacific/Noumea" 13590 msgstr "પેસફિક/નાઉમિઆ" 13591 13592 #: kdecore/TIMEZONES:1363 13593 #, kde-format 13594 msgid "Pacific/Pago_Pago" 13595 msgstr "પેસફિક/પેગો_પેગો" 13596 13597 #: kdecore/TIMEZONES:1364 13598 #, kde-format 13599 msgid "Pacific/Palau" 13600 msgstr "પેસફિક/પાલાઉ" 13601 13602 #: kdecore/TIMEZONES:1365 13603 #, kde-format 13604 msgid "Pacific/Pitcairn" 13605 msgstr "પેસફિક/પીટકાર્ન" 13606 13607 #: kdecore/TIMEZONES:1366 13608 #, fuzzy, kde-format 13609 #| msgid "Pacific/Ponape" 13610 msgid "Pacific/Pohnpei" 13611 msgstr "પેસફિક/પોનાપે" 13612 13613 #. i18n: comment to the previous timezone 13614 #: kdecore/TIMEZONES:1368 13615 #, kde-format 13616 msgid "Pohnpei (Ponape)" 13617 msgstr "" 13618 13619 #. i18n: comment to the previous timezone 13620 #: kdecore/TIMEZONES:1370 13621 #, fuzzy, kde-format 13622 #| msgid "Pacific/Ponape" 13623 msgid "Pohnpei/Ponape" 13624 msgstr "પેસફિક/પોનાપે" 13625 13626 #: kdecore/TIMEZONES:1371 13627 #, kde-format 13628 msgid "Pacific/Ponape" 13629 msgstr "પેસફિક/પોનાપે" 13630 13631 #. i18n: comment to the previous timezone 13632 #: kdecore/TIMEZONES:1373 13633 #, kde-format 13634 msgid "Ponape (Pohnpei)" 13635 msgstr "" 13636 13637 #: kdecore/TIMEZONES:1374 13638 #, kde-format 13639 msgid "Pacific/Port_Moresby" 13640 msgstr "પેસફિક/પોર્ટ_મોરેસ્બાય" 13641 13642 #. i18n: comment to the previous timezone 13643 #: kdecore/TIMEZONES:1376 13644 #, kde-format 13645 msgid "Papua New Guinea (most areas)" 13646 msgstr "" 13647 13648 #: kdecore/TIMEZONES:1377 13649 #, kde-format 13650 msgid "Pacific/Rarotonga" 13651 msgstr "પેસફિક/રારોટોન્ગા" 13652 13653 #: kdecore/TIMEZONES:1378 13654 #, kde-format 13655 msgid "Pacific/Saipan" 13656 msgstr "પેસફિક/સૈપાન" 13657 13658 #: kdecore/TIMEZONES:1379 13659 #, kde-format 13660 msgid "Pacific/Samoa" 13661 msgstr "પેસફિક/સામોઆ" 13662 13663 #: kdecore/TIMEZONES:1380 13664 #, kde-format 13665 msgid "Pacific/Tahiti" 13666 msgstr "પેસફિક/તાહિટી" 13667 13668 #. i18n: comment to the previous timezone 13669 #: kdecore/TIMEZONES:1382 13670 #, kde-format 13671 msgid "Society Islands" 13672 msgstr "સોસાયટી ટાપુઓ" 13673 13674 #: kdecore/TIMEZONES:1383 13675 #, kde-format 13676 msgid "Pacific/Tarawa" 13677 msgstr "પેસફિક/તારાવા" 13678 13679 #. i18n: comment to the previous timezone 13680 #: kdecore/TIMEZONES:1385 13681 #, kde-format 13682 msgid "Gilbert Islands" 13683 msgstr "ગિલ્બર્ટ ટાપુઓ" 13684 13685 #: kdecore/TIMEZONES:1386 13686 #, kde-format 13687 msgid "Pacific/Tongatapu" 13688 msgstr "પેસફિક/ટોન્ગાટાપુ" 13689 13690 #: kdecore/TIMEZONES:1387 13691 #, kde-format 13692 msgid "Pacific/Truk" 13693 msgstr "પેસફિક/ટુર્ક" 13694 13695 #. i18n: comment to the previous timezone 13696 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13697 #, kde-format 13698 msgid "Truk (Chuuk) and Yap" 13699 msgstr "" 13700 13701 #: kdecore/TIMEZONES:1390 13702 #, kde-format 13703 msgid "Pacific/Wake" 13704 msgstr "પેસફિક/વાકે" 13705 13706 #. i18n: comment to the previous timezone 13707 #: kdecore/TIMEZONES:1392 13708 #, kde-format 13709 msgid "Wake Island" 13710 msgstr "વેક ટાપુ" 13711 13712 #: kdecore/TIMEZONES:1393 13713 #, kde-format 13714 msgid "Pacific/Wallis" 13715 msgstr "પેસફિક/વાલીસ" 13716 13717 #: kdecore/TIMEZONES:1394 13718 #, kde-format 13719 msgid "Pacific/Yap" 13720 msgstr "પેસફિક/યેપ" 13721 13722 #: kdecore/TIMEZONES:1397 13723 #, kde-format 13724 msgid "Poland" 13725 msgstr "પોલેન્ડ" 13726 13727 #: kdecore/TIMEZONES:1398 13728 #, kde-format 13729 msgid "Portugal" 13730 msgstr "પોર્ટુગલ" 13731 13732 #: kdecore/TIMEZONES:1401 13733 #, kde-format 13734 msgid "ROC" 13735 msgstr "ROC" 13736 13737 #: kdecore/TIMEZONES:1402 13738 #, kde-format 13739 msgid "ROK" 13740 msgstr "ROK" 13741 13742 #: kdecore/TIMEZONES:1403 13743 #, kde-format 13744 msgid "Singapore" 13745 msgstr "સિંગાપુર" 13746 13747 #: kdecore/TIMEZONES:1404 13748 #, kde-format 13749 msgid "Turkey" 13750 msgstr "તુર્કી" 13751 13752 #: kdecore/TIMEZONES:1405 13753 #, kde-format 13754 msgid "US/Alaska" 13755 msgstr "યુએસ/અલાસ્કા" 13756 13757 #: kdecore/TIMEZONES:1408 13758 #, kde-format 13759 msgid "US/Aleutian" 13760 msgstr "" 13761 13762 #: kdecore/TIMEZONES:1411 13763 #, kde-format 13764 msgid "US/Arizona" 13765 msgstr "US/એરિઝોના" 13766 13767 #: kdecore/TIMEZONES:1414 13768 #, kde-format 13769 msgid "US/Central" 13770 msgstr "યુએસ/મધ્ય" 13771 13772 #: kdecore/TIMEZONES:1417 13773 #, kde-format 13774 msgid "US/East-Indiana" 13775 msgstr "" 13776 13777 #: kdecore/TIMEZONES:1420 13778 #, kde-format 13779 msgid "US/Eastern" 13780 msgstr "યુએસ/પૂર્વીય" 13781 13782 #: kdecore/TIMEZONES:1423 13783 #, kde-format 13784 msgid "US/Hawaii" 13785 msgstr "US/હવાઇ" 13786 13787 #: kdecore/TIMEZONES:1426 13788 #, kde-format 13789 msgid "US/Indiana-Starke" 13790 msgstr "" 13791 13792 #: kdecore/TIMEZONES:1429 13793 #, kde-format 13794 msgid "US/Michigan" 13795 msgstr "યુએસ/મિશિગન" 13796 13797 #: kdecore/TIMEZONES:1432 13798 #, kde-format 13799 msgid "US/Mountain" 13800 msgstr "યુએસ/પર્વતીય" 13801 13802 #: kdecore/TIMEZONES:1435 13803 #, kde-format 13804 msgid "US/Pacific" 13805 msgstr "અમેરિકા/પેસફિક" 13806 13807 #: kdecore/TIMEZONES:1438 13808 #, kde-format 13809 msgid "US/Samoa" 13810 msgstr "US/સામોઆ" 13811 13812 #: kdecore/TIMEZONES:1439 13813 #, kde-format 13814 msgid "W-SU" 13815 msgstr "W-SU" 13816 13817 #. i18n: Generic sans serif font presented in font choosers. When selected, 13818 #. the system will choose a real font, mandated by distro settings. 13819 #: kdeui/fonthelpers.cpp:29 13820 #, kde-format 13821 msgctxt "@item Font name" 13822 msgid "Sans Serif" 13823 msgstr "સાન્સ સેરીફ" 13824 13825 #. i18n: Generic serif font presented in font choosers. When selected, 13826 #. the system will choose a real font, mandated by distro settings. 13827 #: kdeui/fonthelpers.cpp:32 13828 #, kde-format 13829 msgctxt "@item Font name" 13830 msgid "Serif" 13831 msgstr "સેરીફ" 13832 13833 #. i18n: Generic monospace font presented in font choosers. When selected, 13834 #. the system will choose a real font, mandated by distro settings. 13835 #: kdeui/fonthelpers.cpp:35 13836 #, kde-format 13837 msgctxt "@item Font name" 13838 msgid "Monospace" 13839 msgstr "મોનોસ્પેસ" 13840 13841 #: kdeui/k4timezonewidget.cpp:62 13842 #, kde-format 13843 msgctxt "Define an area in the time zone, like a town area" 13844 msgid "Area" 13845 msgstr "વિસ્તાર" 13846 13847 #: kdeui/k4timezonewidget.cpp:62 13848 #, kde-format 13849 msgctxt "Time zone" 13850 msgid "Region" 13851 msgstr "પ્રદેશ" 13852 13853 #: kdeui/k4timezonewidget.cpp:62 13854 #, fuzzy, kde-format 13855 #| msgctxt "Coptic weekday 2 - LongDayName" 13856 #| msgid "Pshoment" 13857 msgid "Comment" 13858 msgstr "હોમેન્ત" 13859 13860 #: kdeui/kapplication.cpp:741 13861 #, kde-format 13862 msgid "The style '%1' was not found" 13863 msgstr "શૈલી '%1' મળી નહી" 13864 13865 #: kdeui/kcolordialog.cpp:102 13866 #, kde-format 13867 msgctxt "palette name" 13868 msgid "* Recent Colors *" 13869 msgstr "* તાજેતરનાં રંગો *" 13870 13871 #: kdeui/kcolordialog.cpp:103 13872 #, kde-format 13873 msgctxt "palette name" 13874 msgid "* Custom Colors *" 13875 msgstr "* વૈવિધ્યપૂર્ણ રંગો *" 13876 13877 #: kdeui/kcolordialog.cpp:104 13878 #, kde-format 13879 msgctxt "palette name" 13880 msgid "Forty Colors" 13881 msgstr "ચાલીસ રંગો" 13882 13883 #: kdeui/kcolordialog.cpp:105 13884 #, kde-format 13885 msgctxt "palette name" 13886 msgid "Oxygen Colors" 13887 msgstr "ઓક્સિજન રંગો" 13888 13889 #: kdeui/kcolordialog.cpp:106 13890 #, kde-format 13891 msgctxt "palette name" 13892 msgid "Rainbow Colors" 13893 msgstr "મેઘધનુષ રંગો" 13894 13895 #: kdeui/kcolordialog.cpp:107 13896 #, kde-format 13897 msgctxt "palette name" 13898 msgid "Royal Colors" 13899 msgstr "રાજવી રંગો" 13900 13901 #: kdeui/kcolordialog.cpp:108 13902 #, kde-format 13903 msgctxt "palette name" 13904 msgid "Web Colors" 13905 msgstr "વેબ રંગો" 13906 13907 #: kdeui/kcolordialog.cpp:572 13908 #, kde-format 13909 msgid "Named Colors" 13910 msgstr "નામવાળા રંગો" 13911 13912 #: kdeui/kcolordialog.cpp:746 13913 #, kde-format 13914 msgctxt "" 13915 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13916 "them)" 13917 msgid "" 13918 "Unable to read X11 RGB color strings. The following file location was " 13919 "examined:\n" 13920 "%2" 13921 msgid_plural "" 13922 "Unable to read X11 RGB color strings. The following file locations were " 13923 "examined:\n" 13924 "%2" 13925 msgstr[0] "" 13926 msgstr[1] "" 13927 13928 #: kdeui/kcolordialog.cpp:997 13929 #, kde-format 13930 msgid "Select Color" 13931 msgstr "રંગ પસંદ કરો" 13932 13933 #: kdeui/kcolordialog.cpp:1077 13934 #, kde-format 13935 msgid "Hue:" 13936 msgstr "હુએ:" 13937 13938 #: kdeui/kcolordialog.cpp:1083 13939 #, kde-format 13940 msgctxt "The angular degree unit (for hue)" 13941 msgid "°" 13942 msgstr "" 13943 13944 #: kdeui/kcolordialog.cpp:1088 13945 #, fuzzy, kde-format 13946 #| msgid "Saturday" 13947 msgid "Saturation:" 13948 msgstr "શનિવાર" 13949 13950 #: kdeui/kcolordialog.cpp:1098 13951 #, kde-format 13952 msgctxt "This is the V of HSV" 13953 msgid "Value:" 13954 msgstr "કિંમત:" 13955 13956 #: kdeui/kcolordialog.cpp:1111 13957 #, kde-format 13958 msgid "Red:" 13959 msgstr "લાલ:" 13960 13961 #: kdeui/kcolordialog.cpp:1121 13962 #, kde-format 13963 msgid "Green:" 13964 msgstr "લીલો:" 13965 13966 #: kdeui/kcolordialog.cpp:1131 13967 #, kde-format 13968 msgid "Blue:" 13969 msgstr "ભૂરો:" 13970 13971 #: kdeui/kcolordialog.cpp:1152 13972 #, kde-format 13973 msgid "Alpha:" 13974 msgstr "" 13975 13976 #: kdeui/kcolordialog.cpp:1206 13977 #, kde-format 13978 msgid "&Add to Custom Colors" 13979 msgstr "વૈવિધ્યપૂર્ણ રંગોમાં ઉમેરો (&A)" 13980 13981 #: kdeui/kcolordialog.cpp:1234 13982 #, kde-format 13983 msgid "Name:" 13984 msgstr "નામ:" 13985 13986 #: kdeui/kcolordialog.cpp:1241 13987 #, kde-format 13988 msgid "HTML:" 13989 msgstr "HTML:" 13990 13991 #: kdeui/kcolordialog.cpp:1328 13992 #, kde-format 13993 msgid "Default color" 13994 msgstr "મૂળભૂત રંગ" 13995 13996 #: kdeui/kcolordialog.cpp:1393 13997 #, kde-format 13998 msgid "-default-" 13999 msgstr "-મૂળભૂત-" 14000 14001 #: kdeui/kcolordialog.cpp:1668 14002 #, kde-format 14003 msgid "-unnamed-" 14004 msgstr "-નામવિહિન-" 14005 14006 #: kdeui/kdeprintdialog.cpp:40 14007 #, kde-format 14008 msgctxt "@title:window" 14009 msgid "Print" 14010 msgstr "છાપો" 14011 14012 #: kdeui/kdialog.cpp:271 14013 #, kde-format 14014 msgid "&Try" 14015 msgstr "પ્રયત્ન કરો (&T)" 14016 14017 #: kdeui/kdialog.cpp:484 14018 #, kde-format 14019 msgid "modified" 14020 msgstr "બદલેલ" 14021 14022 #: kdeui/kdialog.cpp:495 14023 #, kde-format 14024 msgctxt "Document/application separator in titlebar" 14025 msgid " – " 14026 msgstr " – " 14027 14028 #: kdeui/kdialog.cpp:896 14029 #, kde-format 14030 msgid "&Details" 14031 msgstr "વિગતો (&D)" 14032 14033 #: kdeui/kdialog.cpp:1054 14034 #, kde-format 14035 msgid "Get help..." 14036 msgstr "મદદ મેળવો..." 14037 14038 #: kdeui/keditlistbox.cpp:324 14039 #, kde-format 14040 msgid "&Add" 14041 msgstr "ઉમેરો (&A)" 14042 14043 #: kdeui/keditlistbox.cpp:336 14044 #, kde-format 14045 msgid "&Remove" 14046 msgstr "દૂર કરો (&R)" 14047 14048 #: kdeui/keditlistbox.cpp:348 14049 #, kde-format 14050 msgid "Move &Up" 14051 msgstr "ઉપર કરો (&U)" 14052 14053 #: kdeui/keditlistbox.cpp:353 14054 #, kde-format 14055 msgid "Move &Down" 14056 msgstr "નીચે કરો (&D)" 14057 14058 #. i18n: A shorter version of the alphabet test phrase translated in 14059 #. another message. It is displayed in the dropdown list of font previews 14060 #. (the font selection combo box), so keep it under the length equivalent 14061 #. to 60 or so proportional Latin characters. 14062 #: kdeui/kfontcombobox.cpp:48 14063 #, kde-format 14064 msgctxt "short" 14065 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 14066 msgstr "The Quick Brown Fox Jumps Over The Lazy Dog" 14067 14068 #. i18n: Integer which indicates the script you used in the sample text 14069 #. for font previews in your language. For the possible values, see 14070 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 14071 #. If the sample text contains several scripts, their IDs can be given 14072 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 14073 #: kdeui/kfontcombobox.cpp:119 14074 #, kde-format 14075 msgctxt "Numeric IDs of scripts for font previews" 14076 msgid "1" 14077 msgstr "12" 14078 14079 #: kdeui/kfontdialog.cpp:51 14080 #, kde-format 14081 msgid "Select Font" 14082 msgstr "ફોન્ટ પસંદ કરો" 14083 14084 #: kdeui/kprintpreview.cpp:118 14085 #, kde-format 14086 msgid "Could not load print preview part" 14087 msgstr "છાપકામ પૂર્વદર્શન લાવી શકાયું નહી" 14088 14089 #: kdeui/kprintpreview.cpp:135 14090 #, kde-format 14091 msgid "Print Preview" 14092 msgstr "છાપકામ પૂર્વદર્શન" 14093 14094 #: kdeui/ksystemtrayicon.cpp:153 14095 #, kde-format 14096 msgid "Minimize" 14097 msgstr "ન્યુનતમ કરો" 14098 14099 #: kdeui/ksystemtrayicon.cpp:205 14100 #, kde-format 14101 msgid "&Minimize" 14102 msgstr "ન્યૂનતમ કરો (&M)" 14103 14104 #: kdeui/ksystemtrayicon.cpp:207 14105 #, kde-format 14106 msgid "&Restore" 14107 msgstr "ફરી સ્થિતિમાં લાવો (&R)" 14108 14109 #: kdeui/ksystemtrayicon.cpp:226 14110 #, kde-format 14111 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 14112 msgstr "<qt>શું તમે ખરેખર <b>%1</b> થી બહાર નીકળવા માંગો છો?</qt>" 14113 14114 #: kdeui/ksystemtrayicon.cpp:229 14115 #, kde-format 14116 msgid "Confirm Quit From System Tray" 14117 msgstr "સિસ્ટમ ટ્રે માંથી બહાર નીકળવા માટે ખાતરી કરો" 14118 14119 #: kdeui/kundostack.cpp:47 14120 #, kde-format 14121 msgid "Redo" 14122 msgstr "ફરીકરો" 14123 14124 #: kdeui/kundostack.cpp:66 14125 #, kde-format 14126 msgid "Undo" 14127 msgstr "પાછું લાવો" 14128 14129 #: kdeui/kuniqueapplication.cpp:79 14130 #, kde-format 14131 msgid "Do not run in the background." 14132 msgstr "પાશ્વભાગમાં ચલાવશો નહી." 14133 14134 #: kdeui/kuniqueapplication.cpp:81 14135 #, kde-format 14136 msgid "Internally added if launched from Finder" 14137 msgstr "આંતરિક રીતે ઉમેરવામાં આવેલ જો શોધકમાંથી ઉમેરેલ હોય" 14138 14139 #: kio/kcommentwidget.cpp:68 14140 #, fuzzy, kde-format 14141 #| msgid "Add Entry..." 14142 msgctxt "@label" 14143 msgid "Add Comment..." 14144 msgstr "દાખલો ઉમેરો..." 14145 14146 #: kio/kcommentwidget.cpp:74 14147 #, kde-format 14148 msgctxt "@label" 14149 msgid "Change..." 14150 msgstr "બદલો..." 14151 14152 #: kio/kcommentwidget.cpp:128 14153 #, fuzzy, kde-format 14154 #| msgid "Comment" 14155 msgctxt "@title:window" 14156 msgid "Change Comment" 14157 msgstr "ટીપ્પણી" 14158 14159 #: kio/kcommentwidget.cpp:129 14160 #, fuzzy, kde-format 14161 #| msgid "Comment" 14162 msgctxt "@title:window" 14163 msgid "Add Comment" 14164 msgstr "ટીપ્પણી" 14165 14166 #: kio/kdevicelistmodel.cpp:115 14167 #, kde-format 14168 msgid "Device name" 14169 msgstr "ઉપકરણ નામ" 14170 14171 #: kio/kdirselectdialog.cpp:136 14172 #, kde-format 14173 msgctxt "folder name" 14174 msgid "New Folder" 14175 msgstr "નવું ફોલ્ડર" 14176 14177 #: kio/kdirselectdialog.cpp:141 14178 #, kde-format 14179 msgctxt "@title:window" 14180 msgid "New Folder" 14181 msgstr "નવું ફોલ્ડર" 14182 14183 #: kio/kdirselectdialog.cpp:142 14184 #, kde-format 14185 msgctxt "@label:textbox" 14186 msgid "" 14187 "Create new folder in:\n" 14188 "%1" 14189 msgstr "" 14190 "અહીં નવું ફોલ્ડર બનાવો:\n" 14191 "%1" 14192 14193 #: kio/kdirselectdialog.cpp:172 14194 #, kde-format 14195 msgid "A file or folder named %1 already exists." 14196 msgstr "%1 નામ ધરાવતી ફાઇલ અથવા ફોલ્ડર પહેલેથી હાજર છે." 14197 14198 #: kio/kdirselectdialog.cpp:175 14199 #, kde-format 14200 msgid "You do not have permission to create that folder." 14201 msgstr "તમને તે ફોલ્ડર બનાવવાની પરવાનગી નથી." 14202 14203 #: kio/kdirselectdialog.cpp:290 14204 #, kde-format 14205 msgctxt "@title:window" 14206 msgid "Select Folder" 14207 msgstr "ફોલ્ડર પસંદ કરો" 14208 14209 #: kio/kdirselectdialog.cpp:299 14210 #, kde-format 14211 msgctxt "@action:button" 14212 msgid "New Folder..." 14213 msgstr "નવું ફોલ્ડર..." 14214 14215 #: kio/kdirselectdialog.cpp:345 14216 #, kde-format 14217 msgctxt "@action:inmenu" 14218 msgid "New Folder..." 14219 msgstr "નવું ફોલ્ડર.." 14220 14221 #: kio/kdirselectdialog.cpp:352 14222 #, fuzzy, kde-format 14223 #| msgid "Move to Trash" 14224 msgctxt "@action:inmenu" 14225 msgid "Move to Trash" 14226 msgstr "કચરાપેટીમાં ખસેડો" 14227 14228 #: kio/kdirselectdialog.cpp:359 14229 #, kde-format 14230 msgctxt "@action:inmenu" 14231 msgid "Delete" 14232 msgstr "દૂર કરો" 14233 14234 #: kio/kdirselectdialog.cpp:368 14235 #, kde-format 14236 msgctxt "@option:check" 14237 msgid "Show Hidden Folders" 14238 msgstr "છુપાવેલાં ફોલ્ડરો બતાવો" 14239 14240 #: kio/kdirselectdialog.cpp:375 14241 #, kde-format 14242 msgctxt "@action:inmenu" 14243 msgid "Properties" 14244 msgstr "ગુણધર્મો" 14245 14246 #: kio/kfiledialog.cpp:132 14247 #, kde-format 14248 msgid "*|All files" 14249 msgstr "*|બધી ફાઇલો" 14250 14251 #: kio/kfiledialog.cpp:332 14252 #, kde-format 14253 msgid "All Supported Files" 14254 msgstr "બધી આધારિત ફાઇલો" 14255 14256 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 14257 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 14258 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 14259 #, kde-format 14260 msgid "Open" 14261 msgstr "ખોલો" 14262 14263 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 14264 #: kio/kfiledialog.cpp:838 14265 #, kde-format 14266 msgid "Save As" 14267 msgstr "આ રીતે સંગ્રહ કરો" 14268 14269 #: kio/kfilemetadataprovider.cpp:245 14270 #, kde-format 14271 msgctxt "@item:intable" 14272 msgid "%1 item" 14273 msgid_plural "%1 items" 14274 msgstr[0] "" 14275 msgstr[1] "" 14276 14277 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 14278 #, fuzzy, kde-format 14279 #| msgctxt "Coptic weekday 2 - LongDayName" 14280 #| msgid "Pshoment" 14281 msgctxt "@label" 14282 msgid "Comment" 14283 msgstr "હોમેન્ત" 14284 14285 #: kio/kfilemetadataprovider.cpp:447 14286 #, fuzzy, kde-format 14287 #| msgid "Modified:" 14288 msgctxt "@label" 14289 msgid "Modified" 14290 msgstr "બદલેલ:" 14291 14292 #: kio/kfilemetadataprovider.cpp:448 14293 #, fuzzy, kde-format 14294 #| msgid "Owner" 14295 msgctxt "@label" 14296 msgid "Owner" 14297 msgstr "માલિક" 14298 14299 #: kio/kfilemetadataprovider.cpp:449 14300 #, fuzzy, kde-format 14301 #| msgctxt "@title:column" 14302 #| msgid "Permissions" 14303 msgctxt "@label" 14304 msgid "Permissions" 14305 msgstr "પરવાનગીઓ" 14306 14307 #: kio/kfilemetadataprovider.cpp:450 14308 #, fuzzy, kde-format 14309 #| msgid "Sorting" 14310 msgctxt "@label" 14311 msgid "Rating" 14312 msgstr "ગોઠવણી" 14313 14314 #: kio/kfilemetadataprovider.cpp:451 14315 #, fuzzy, kde-format 14316 #| msgctxt "@title:column" 14317 #| msgid "Size" 14318 msgctxt "@label" 14319 msgid "Size" 14320 msgstr "કદ" 14321 14322 #: kio/kfilemetadataprovider.cpp:452 14323 #, fuzzy, kde-format 14324 #| msgctxt "KFile System Bookmarks" 14325 #| msgid "Trash" 14326 msgctxt "@label" 14327 msgid "Tags" 14328 msgstr "કચરાપેટી" 14329 14330 #: kio/kfilemetadataprovider.cpp:453 14331 #, fuzzy, kde-format 14332 #| msgid "Size:" 14333 msgctxt "@label" 14334 msgid "Total Size" 14335 msgstr "કદ:" 14336 14337 #: kio/kfilemetadataprovider.cpp:454 14338 #, fuzzy, kde-format 14339 #| msgid "Type" 14340 msgctxt "@label" 14341 msgid "Type" 14342 msgstr "પ્રકાર" 14343 14344 #: kio/kfilemetadatareaderprocess.cpp:234 14345 #, kde-format 14346 msgid "KFileMetaDataReader" 14347 msgstr "" 14348 14349 #: kio/kfilemetadatareaderprocess.cpp:236 14350 #, kde-format 14351 msgid "KFileMetaDataReader can be used to read metadata from a file" 14352 msgstr "" 14353 14354 #: kio/kfilemetadatareaderprocess.cpp:238 14355 #, kde-format 14356 msgid "(C) 2011, Peter Penz" 14357 msgstr "" 14358 14359 #: kio/kfilemetadatareaderprocess.cpp:239 14360 #, kde-format 14361 msgid "Peter Penz" 14362 msgstr "" 14363 14364 #: kio/kfilemetadatareaderprocess.cpp:239 14365 #, kde-format 14366 msgid "Current maintainer" 14367 msgstr "" 14368 14369 #: kio/kfilemetadatareaderprocess.cpp:244 14370 #, kde-format 14371 msgid "Only the meta data that is part of the file is read" 14372 msgstr "" 14373 14374 #: kio/kfilemetadatareaderprocess.cpp:245 14375 #, kde-format 14376 msgid "List of URLs where the meta-data should be read from" 14377 msgstr "" 14378 14379 #: kio/kfilemetainfowidget.cpp:161 14380 #, kde-format 14381 msgid "<Error>" 14382 msgstr "<ક્ષતિ>" 14383 14384 #: kio/kfiletreeview.cpp:192 14385 #, kde-format 14386 msgid "Show Hidden Folders" 14387 msgstr "છુપાવેલાં ફોલ્ડરો બતાવો" 14388 14389 #: kio/kimageio.cpp:46 14390 #, kde-format 14391 msgid "All Pictures" 14392 msgstr "બધા ચિત્રો" 14393 14394 #: kio/kmetaprops.cpp:57 14395 #, kde-format 14396 msgctxt "@title:window" 14397 msgid "Configure Shown Data" 14398 msgstr "" 14399 14400 #: kio/kmetaprops.cpp:60 14401 #, kde-format 14402 msgctxt "@label::textbox" 14403 msgid "Select which data should be shown:" 14404 msgstr "" 14405 14406 #: kio/kmetaprops.cpp:123 14407 #, fuzzy, kde-format 14408 #| msgid "Calculating..." 14409 msgctxt "@action:button" 14410 msgid "Configure..." 14411 msgstr "ગણતરી કરે છે..." 14412 14413 #: kio/kmetaprops.cpp:133 14414 #, fuzzy, kde-format 14415 #| msgid "Information" 14416 msgctxt "@title:tab" 14417 msgid "Information" 14418 msgstr "માહિતી" 14419 14420 #: kio/knfotranslator.cpp:40 14421 #, fuzzy, kde-format 14422 #| msgid "Created:" 14423 msgctxt "@label creation date" 14424 msgid "Created" 14425 msgstr "બનાવેલ:" 14426 14427 #: kio/knfotranslator.cpp:41 14428 #, fuzzy, kde-format 14429 #| msgctxt "@title:column" 14430 #| msgid "Size" 14431 msgctxt "@label file content size" 14432 msgid "Size" 14433 msgstr "કદ" 14434 14435 #: kio/knfotranslator.cpp:42 14436 #, kde-format 14437 msgctxt "@label file depends from" 14438 msgid "Depends" 14439 msgstr "" 14440 14441 #: kio/knfotranslator.cpp:43 14442 #, fuzzy, kde-format 14443 #| msgid "Description" 14444 msgctxt "@label" 14445 msgid "Description" 14446 msgstr "વર્ણન" 14447 14448 #: kio/knfotranslator.cpp:44 14449 #, fuzzy, kde-format 14450 #| msgctxt "@title:tab File properties" 14451 #| msgid "&General" 14452 msgctxt "@label Software used to generate content" 14453 msgid "Generator" 14454 msgstr "સામાન્ય (&G)" 14455 14456 #: kio/knfotranslator.cpp:45 14457 #, kde-format 14458 msgctxt "" 14459 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14460 msgid "Has Part" 14461 msgstr "" 14462 14463 #: kio/knfotranslator.cpp:46 14464 #, kde-format 14465 msgctxt "" 14466 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14467 "nie#hasLogicalPart" 14468 msgid "Has Logical Part" 14469 msgstr "" 14470 14471 #: kio/knfotranslator.cpp:47 14472 #, fuzzy, kde-format 14473 #| msgid "Parent Folder" 14474 msgctxt "@label parent directory" 14475 msgid "Part of" 14476 msgstr "પિતૃ ફોલ્ડર" 14477 14478 #: kio/knfotranslator.cpp:48 14479 #, kde-format 14480 msgctxt "@label" 14481 msgid "Keyword" 14482 msgstr "" 14483 14484 #: kio/knfotranslator.cpp:49 14485 #, fuzzy, kde-format 14486 #| msgid "Modified:" 14487 msgctxt "@label modified date of file" 14488 msgid "Modified" 14489 msgstr "બદલેલ:" 14490 14491 #: kio/knfotranslator.cpp:50 14492 #, fuzzy, kde-format 14493 #| msgid "Mime Type" 14494 msgctxt "@label" 14495 msgid "MIME Type" 14496 msgstr "માઇમ પ્રકાર" 14497 14498 #: kio/knfotranslator.cpp:51 14499 #, fuzzy, kde-format 14500 #| msgid "Contents:" 14501 msgctxt "@label" 14502 msgid "Content" 14503 msgstr "વિગતો" 14504 14505 #: kio/knfotranslator.cpp:52 14506 #, fuzzy, kde-format 14507 #| msgid "created on %1" 14508 msgctxt "@label" 14509 msgid "Related To" 14510 msgstr "%1 પર બનાવેલ" 14511 14512 #: kio/knfotranslator.cpp:53 14513 #, fuzzy, kde-format 14514 #| msgctxt "The receiver of the SSL certificate" 14515 #| msgid "Subject" 14516 msgctxt "@label" 14517 msgid "Subject" 14518 msgstr "વિષય" 14519 14520 #: kio/knfotranslator.cpp:54 14521 #, fuzzy, kde-format 14522 #| msgid "File" 14523 msgctxt "@label music title" 14524 msgid "Title" 14525 msgstr "ફાઇલ" 14526 14527 #: kio/knfotranslator.cpp:55 14528 #, kde-format 14529 msgctxt "@label file URL" 14530 msgid "File Location" 14531 msgstr "" 14532 14533 #: kio/knfotranslator.cpp:56 14534 #, fuzzy, kde-format 14535 #| msgid "Created:" 14536 msgctxt "@label" 14537 msgid "Creator" 14538 msgstr "બનાવેલ:" 14539 14540 #: kio/knfotranslator.cpp:57 14541 #, kde-format 14542 msgctxt "@label" 14543 msgid "Average Bitrate" 14544 msgstr "" 14545 14546 #: kio/knfotranslator.cpp:58 14547 #, kde-format 14548 msgctxt "@label" 14549 msgid "Channels" 14550 msgstr "" 14551 14552 #: kio/knfotranslator.cpp:59 14553 #, fuzzy, kde-format 14554 #| msgid "Categories" 14555 msgctxt "@label number of characters" 14556 msgid "Characters" 14557 msgstr "વર્ગો" 14558 14559 #: kio/knfotranslator.cpp:60 14560 #, fuzzy, kde-format 14561 #| msgid "C&onnect" 14562 msgctxt "@label" 14563 msgid "Codec" 14564 msgstr "જોડાઓ (&o)" 14565 14566 #: kio/knfotranslator.cpp:61 14567 #, kde-format 14568 msgctxt "@label" 14569 msgid "Color Depth" 14570 msgstr "" 14571 14572 #: kio/knfotranslator.cpp:62 14573 #, fuzzy, kde-format 14574 #| msgctxt "The destination of a file operation" 14575 #| msgid "Destination" 14576 msgctxt "@label" 14577 msgid "Duration" 14578 msgstr "લક્ષ્ય" 14579 14580 #: kio/knfotranslator.cpp:63 14581 #, fuzzy, kde-format 14582 #| msgid "Device name" 14583 msgctxt "@label" 14584 msgid "Filename" 14585 msgstr "ઉપકરણ નામ" 14586 14587 #: kio/knfotranslator.cpp:64 14588 #, kde-format 14589 msgctxt "@label" 14590 msgid "Hash" 14591 msgstr "" 14592 14593 #: kio/knfotranslator.cpp:65 14594 #, kde-format 14595 msgctxt "@label" 14596 msgid "Height" 14597 msgstr "" 14598 14599 #: kio/knfotranslator.cpp:66 14600 #, kde-format 14601 msgctxt "@label" 14602 msgid "Interlace Mode" 14603 msgstr "" 14604 14605 #: kio/knfotranslator.cpp:67 14606 #, fuzzy, kde-format 14607 #| msgid "Link" 14608 msgctxt "@label number of lines" 14609 msgid "Lines" 14610 msgstr "કડી" 14611 14612 #: kio/knfotranslator.cpp:68 14613 #, kde-format 14614 msgctxt "@label" 14615 msgid "Programming Language" 14616 msgstr "" 14617 14618 #: kio/knfotranslator.cpp:69 14619 #, kde-format 14620 msgctxt "@label" 14621 msgid "Sample Rate" 14622 msgstr "" 14623 14624 #: kio/knfotranslator.cpp:70 14625 #, fuzzy, kde-format 14626 #| msgid "Write" 14627 msgctxt "@label" 14628 msgid "Width" 14629 msgstr "લખો" 14630 14631 #: kio/knfotranslator.cpp:71 14632 #, kde-format 14633 msgctxt "@label number of words" 14634 msgid "Words" 14635 msgstr "" 14636 14637 #: kio/knfotranslator.cpp:72 14638 #, kde-format 14639 msgctxt "@label EXIF aperture value" 14640 msgid "Aperture" 14641 msgstr "" 14642 14643 #: kio/knfotranslator.cpp:73 14644 #, kde-format 14645 msgctxt "@label EXIF" 14646 msgid "Exposure Bias Value" 14647 msgstr "" 14648 14649 #: kio/knfotranslator.cpp:74 14650 #, fuzzy, kde-format 14651 #| msgid "Exposure:" 14652 msgctxt "@label EXIF" 14653 msgid "Exposure Time" 14654 msgstr "ઉજાસ:" 14655 14656 #: kio/knfotranslator.cpp:75 14657 #, fuzzy, kde-format 14658 #| msgid "Class" 14659 msgctxt "@label EXIF" 14660 msgid "Flash" 14661 msgstr "વર્ગ" 14662 14663 #: kio/knfotranslator.cpp:76 14664 #, kde-format 14665 msgctxt "@label EXIF" 14666 msgid "Focal Length" 14667 msgstr "" 14668 14669 #: kio/knfotranslator.cpp:77 14670 #, kde-format 14671 msgctxt "@label EXIF" 14672 msgid "Focal Length 35 mm" 14673 msgstr "" 14674 14675 #: kio/knfotranslator.cpp:78 14676 #, kde-format 14677 msgctxt "@label EXIF" 14678 msgid "ISO Speed Ratings" 14679 msgstr "" 14680 14681 #: kio/knfotranslator.cpp:79 14682 #, fuzzy, kde-format 14683 #| msgid "Mask" 14684 msgctxt "@label EXIF" 14685 msgid "Make" 14686 msgstr "માસ્ક" 14687 14688 #: kio/knfotranslator.cpp:80 14689 #, kde-format 14690 msgctxt "@label EXIF" 14691 msgid "Metering Mode" 14692 msgstr "" 14693 14694 #: kio/knfotranslator.cpp:81 14695 #, kde-format 14696 msgctxt "@label EXIF" 14697 msgid "Model" 14698 msgstr "" 14699 14700 #: kio/knfotranslator.cpp:82 14701 #, fuzzy, kde-format 14702 #| msgid "Organization:" 14703 msgctxt "@label EXIF" 14704 msgid "Orientation" 14705 msgstr "સંસ્થા:" 14706 14707 #: kio/knfotranslator.cpp:83 14708 #, kde-format 14709 msgctxt "@label EXIF" 14710 msgid "White Balance" 14711 msgstr "" 14712 14713 #: kio/knfotranslator.cpp:84 14714 #, fuzzy, kde-format 14715 #| msgid "Directory" 14716 msgctxt "@label video director" 14717 msgid "Director" 14718 msgstr "ડિરેક્ટરી" 14719 14720 #: kio/knfotranslator.cpp:85 14721 #, fuzzy, kde-format 14722 #| msgctxt "@title:tab File properties" 14723 #| msgid "&General" 14724 msgctxt "@label music genre" 14725 msgid "Genre" 14726 msgstr "સામાન્ય (&G)" 14727 14728 #: kio/knfotranslator.cpp:86 14729 #, kde-format 14730 msgctxt "@label music album" 14731 msgid "Album" 14732 msgstr "" 14733 14734 #: kio/knfotranslator.cpp:87 14735 #, kde-format 14736 msgctxt "@label" 14737 msgid "Performer" 14738 msgstr "" 14739 14740 #: kio/knfotranslator.cpp:88 14741 #, fuzzy, kde-format 14742 #| msgid "&Release '%1'" 14743 msgctxt "@label" 14744 msgid "Release Date" 14745 msgstr "'%1' છોડો (&R)" 14746 14747 #: kio/knfotranslator.cpp:89 14748 #, kde-format 14749 msgctxt "@label music track number" 14750 msgid "Track" 14751 msgstr "" 14752 14753 #: kio/knfotranslator.cpp:90 14754 #, fuzzy, kde-format 14755 #| msgid "URL Resource Invalid" 14756 msgctxt "@label resource created time" 14757 msgid "Resource Created" 14758 msgstr "URL સ્ત્રોત અયોગ્ય" 14759 14760 #: kio/knfotranslator.cpp:91 14761 #, fuzzy, kde-format 14762 #| msgctxt "The source of a file operation" 14763 #| msgid "Source" 14764 msgctxt "@label" 14765 msgid "Sub Resource" 14766 msgstr "સ્ત્રોત" 14767 14768 #: kio/knfotranslator.cpp:92 14769 #, fuzzy, kde-format 14770 #| msgid "Modified:" 14771 msgctxt "@label resource last modified" 14772 msgid "Resource Modified" 14773 msgstr "બદલેલ:" 14774 14775 #: kio/knfotranslator.cpp:93 14776 #, fuzzy, kde-format 14777 #| msgid "Sorting" 14778 msgctxt "@label" 14779 msgid "Numeric Rating" 14780 msgstr "ગોઠવણી" 14781 14782 #: kio/knfotranslator.cpp:94 14783 #, kde-format 14784 msgctxt "@label" 14785 msgid "Copied From" 14786 msgstr "" 14787 14788 #: kio/knfotranslator.cpp:95 14789 #, kde-format 14790 msgctxt "@label" 14791 msgid "First Usage" 14792 msgstr "" 14793 14794 #: kio/knfotranslator.cpp:96 14795 #, kde-format 14796 msgctxt "@label" 14797 msgid "Last Usage" 14798 msgstr "" 14799 14800 #: kio/knfotranslator.cpp:97 14801 #, fuzzy, kde-format 14802 #| msgid "Comment" 14803 msgctxt "@label" 14804 msgid "Usage Count" 14805 msgstr "ટીપ્પણી" 14806 14807 #: kio/knfotranslator.cpp:98 14808 #, kde-format 14809 msgctxt "@label" 14810 msgid "Unix File Group" 14811 msgstr "" 14812 14813 #: kio/knfotranslator.cpp:99 14814 #, kde-format 14815 msgctxt "@label" 14816 msgid "Unix File Mode" 14817 msgstr "" 14818 14819 #: kio/knfotranslator.cpp:100 14820 #, fuzzy, kde-format 14821 #| msgid "Open file dialog" 14822 msgctxt "@label" 14823 msgid "Unix File Owner" 14824 msgstr "ફાઇલ સંવાદ ખોલો" 14825 14826 #: kio/knfotranslator.cpp:101 14827 #, fuzzy, kde-format 14828 #| msgid "Type" 14829 msgctxt "@label file type" 14830 msgid "Type" 14831 msgstr "પ્રકાર" 14832 14833 #: kio/knfotranslator.cpp:102 14834 #, kde-format 14835 msgctxt "@label Number of fuzzy translations" 14836 msgid "Fuzzy Translations" 14837 msgstr "" 14838 14839 #: kio/knfotranslator.cpp:103 14840 #, kde-format 14841 msgctxt "@label Name of last translator" 14842 msgid "Last Translator" 14843 msgstr "" 14844 14845 #: kio/knfotranslator.cpp:104 14846 #, kde-format 14847 msgctxt "@label Number of obsolete translations" 14848 msgid "Obsolete Translations" 14849 msgstr "" 14850 14851 #: kio/knfotranslator.cpp:105 14852 #, kde-format 14853 msgctxt "@label" 14854 msgid "Translation Source Date" 14855 msgstr "" 14856 14857 #: kio/knfotranslator.cpp:106 14858 #, kde-format 14859 msgctxt "@label Number of total translations" 14860 msgid "Total Translations" 14861 msgstr "" 14862 14863 #: kio/knfotranslator.cpp:107 14864 #, fuzzy, kde-format 14865 #| msgid "Trusted:" 14866 msgctxt "@label Number of translated strings" 14867 msgid "Translated" 14868 msgstr "વિશ્વાસપાત્ર:" 14869 14870 #: kio/knfotranslator.cpp:108 14871 #, kde-format 14872 msgctxt "@label" 14873 msgid "Translation Date" 14874 msgstr "" 14875 14876 #: kio/knfotranslator.cpp:109 14877 #, kde-format 14878 msgctxt "@label Number of untranslated strings" 14879 msgid "Untranslated" 14880 msgstr "" 14881 14882 #: kio/kpreviewprops.cpp:51 14883 #, kde-format 14884 msgid "P&review" 14885 msgstr "પૂર્વદર્શન (&r)" 14886 14887 #: kio/kscan.cpp:49 14888 #, kde-format 14889 msgid "Acquire Image" 14890 msgstr "ચિત્ર મેળવો" 14891 14892 #: kio/kscan.cpp:97 14893 #, kde-format 14894 msgid "OCR Image" 14895 msgstr "OCR ચિત્ર" 14896 14897 #: kio/netaccess.cpp:102 14898 #, kde-format 14899 msgid "File '%1' is not readable" 14900 msgstr "ફાઇલ '%1' વાંચી શકાય તેમ નથી" 14901 14902 #: kio/netaccess.cpp:435 14903 #, kde-format 14904 msgid "ERROR: Unknown protocol '%1'" 14905 msgstr "ક્ષતિ: અજાણ્યો પ્રોટોકોલ '%1'" 14906 14907 #: kio/passworddialog.cpp:56 14908 #, kde-format 14909 msgid "Authorization Dialog" 14910 msgstr "પરવાનગી સંવાદ" 14911 14912 #: kioslave/metainfo/metainfo.cpp:98 14913 #, kde-format 14914 msgid "No metainfo for %1" 14915 msgstr "%1 માટે કોઇ મેટામાહિતી નહી" 14916 14917 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14918 #: kssl/kcm/cacertificates.ui:24 14919 #, fuzzy, kde-format 14920 #| msgid "Organization:" 14921 msgid "Organization / Common Name" 14922 msgstr "સંસ્થા:" 14923 14924 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14925 #: kssl/kcm/cacertificates.ui:29 14926 #, fuzzy, kde-format 14927 #| msgid "Organizational unit:" 14928 msgid "Organizational Unit" 14929 msgstr "સંસ્થા એકમ:" 14930 14931 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14932 #: kssl/kcm/cacertificates.ui:42 14933 #, kde-format 14934 msgid "Display..." 14935 msgstr "" 14936 14937 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14938 #: kssl/kcm/cacertificates.ui:68 14939 #, fuzzy, kde-format 14940 #| msgid "disable XIM" 14941 msgid "Disable" 14942 msgstr "XIM નિષ્ક્રિય કરો" 14943 14944 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14945 #: kssl/kcm/cacertificates.ui:78 14946 #, fuzzy, kde-format 14947 #| msgid "Emblems" 14948 msgid "Enable" 14949 msgstr "નિશાનીઓ" 14950 14951 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14952 #: kssl/kcm/cacertificates.ui:104 14953 #, kde-format 14954 msgid "Remove" 14955 msgstr "દૂર કરો" 14956 14957 #. i18n: ectx: property (text), widget (QPushButton, add) 14958 #: kssl/kcm/cacertificates.ui:111 14959 #, kde-format 14960 msgid "Add..." 14961 msgstr "ઉમેરો..." 14962 14963 #: kssl/kcm/cacertificatespage.cpp:140 14964 #, fuzzy, kde-format 14965 #| msgid "Send certificate" 14966 msgid "System certificates" 14967 msgstr "પ્રમાણપત્ર મોકલો" 14968 14969 #: kssl/kcm/cacertificatespage.cpp:147 14970 #, fuzzy, kde-format 14971 #| msgid "Send certificate" 14972 msgid "User-added certificates" 14973 msgstr "પ્રમાણપત્ર મોકલો" 14974 14975 #: kssl/kcm/cacertificatespage.cpp:302 14976 #, fuzzy, kde-format 14977 #| msgid "Certificate" 14978 msgid "Pick Certificates" 14979 msgstr "પ્રમાણપત્ર" 14980 14981 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14982 #: kssl/kcm/displaycert.ui:23 14983 #, fuzzy, kde-format 14984 #| msgid "Security Information" 14985 msgid "<b>Subject Information</b>" 14986 msgstr "સુરક્ષા માહિતી" 14987 14988 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14989 #: kssl/kcm/displaycert.ui:39 14990 #, fuzzy, kde-format 14991 #| msgid " <b>[Cross Domain]</b>" 14992 msgid "<b>Issuer Information</b>" 14993 msgstr " <b>[ક્રોસ ડોમેઇન]</b>" 14994 14995 #. i18n: ectx: property (text), widget (QLabel, label) 14996 #: kssl/kcm/displaycert.ui:55 14997 #, fuzzy, kde-format 14998 #| msgid "<b>%1</b>" 14999 msgid "<b>Other</b>" 15000 msgstr "<b>%1</b>" 15001 15002 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 15003 #: kssl/kcm/displaycert.ui:64 15004 #, fuzzy, kde-format 15005 #| msgid "Validity period:" 15006 msgid "Validity period" 15007 msgstr "યોગ્યતા સમય:" 15008 15009 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 15010 #: kssl/kcm/displaycert.ui:78 15011 #, fuzzy, kde-format 15012 #| msgid "Serial number:" 15013 msgid "Serial number" 15014 msgstr "સીરિયલ ક્રમ:" 15015 15016 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 15017 #: kssl/kcm/displaycert.ui:92 15018 #, fuzzy, kde-format 15019 #| msgid "MD5 digest:" 15020 msgid "MD5 digest" 15021 msgstr "MD5 ડાયજેસ્ટ:" 15022 15023 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 15024 #: kssl/kcm/displaycert.ui:106 15025 #, fuzzy, kde-format 15026 #| msgid "SHA1 digest:" 15027 msgid "SHA1 digest" 15028 msgstr "SHA1 ડાયજેસ્ટ:" 15029 15030 #: kssl/kcm/displaycertdialog.cpp:73 15031 #, fuzzy, kde-format 15032 #| msgctxt "%1 is the effective data of the certificate, %2 is the expiry date" 15033 #| msgid "%1 to %2" 15034 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 15035 msgid "%1 to %2" 15036 msgstr "%1 થી %2" 15037 15038 #: kssl/kcm/kcmssl.cpp:37 15039 #, fuzzy, kde-format 15040 #| msgid "Reload configuration file" 15041 msgid "SSL Configuration Module" 15042 msgstr "રૂપરેખાંકન ફાઇલ ફરી લાવો" 15043 15044 #: kssl/kcm/kcmssl.cpp:39 15045 #, kde-format 15046 msgid "Copyright 2010 Andreas Hartmetz" 15047 msgstr "" 15048 15049 #: kssl/kcm/kcmssl.cpp:40 15050 #, kde-format 15051 msgid "Andreas Hartmetz" 15052 msgstr "" 15053 15054 #: kssl/kcm/kcmssl.cpp:52 15055 #, fuzzy, kde-format 15056 #| msgid "Link" 15057 msgid "SSL Signers" 15058 msgstr "કડી" 15059 15060 #: kssl/ksslcertificate.cpp:202 15061 #, kde-format 15062 msgid "Signature Algorithm: " 15063 msgstr "સહી અલગોરિથમ: " 15064 15065 #: kssl/ksslcertificate.cpp:203 15066 #, kde-format 15067 msgid "Unknown" 15068 msgstr "અજ્ઞાત" 15069 15070 #: kssl/ksslcertificate.cpp:206 15071 #, kde-format 15072 msgid "Signature Contents:" 15073 msgstr "સહી વિગતો:" 15074 15075 #: kssl/ksslcertificate.cpp:341 15076 #, kde-format 15077 msgctxt "Unknown" 15078 msgid "Unknown key algorithm" 15079 msgstr "અજાણ્યો કળ અલગોરિથમ" 15080 15081 #: kssl/ksslcertificate.cpp:347 15082 #, kde-format 15083 msgid "Key type: RSA (%1 bit)" 15084 msgstr "કળ પ્રકાર: RSA (%1 bit)" 15085 15086 #: kssl/ksslcertificate.cpp:349 15087 #, kde-format 15088 msgid "Modulus: " 15089 msgstr "મોડ્યુલો: " 15090 15091 #: kssl/ksslcertificate.cpp:362 15092 #, kde-format 15093 msgid "Exponent: 0x" 15094 msgstr "" 15095 15096 #: kssl/ksslcertificate.cpp:374 15097 #, kde-format 15098 msgid "Key type: DSA (%1 bit)" 15099 msgstr "કળ પ્રકાર: DSA (%1 બીટ)" 15100 15101 #: kssl/ksslcertificate.cpp:376 15102 #, kde-format 15103 msgid "Prime: " 15104 msgstr "મુખ્ય: " 15105 15106 #: kssl/ksslcertificate.cpp:389 15107 #, kde-format 15108 msgid "160 bit prime factor: " 15109 msgstr "૧૬૦ બીટ મુખ્ય ઘટક: " 15110 15111 #: kssl/ksslcertificate.cpp:417 15112 #, kde-format 15113 msgid "Public key: " 15114 msgstr "જાહેર કળ: " 15115 15116 #: kssl/ksslcertificate.cpp:1065 15117 #, kde-format 15118 msgid "The certificate is valid." 15119 msgstr "પ્રમાણપત્ર માન્ય છે." 15120 15121 #: kssl/ksslcertificate.cpp:1067 15122 #, kde-format 15123 msgid "" 15124 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 15125 "Authority) certificate can not be found." 15126 msgstr "" 15127 15128 #: kssl/ksslcertificate.cpp:1069 15129 #, kde-format 15130 msgid "" 15131 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 15132 "CA's (Certificate Authority) CRL can not be found." 15133 msgstr "" 15134 15135 #: kssl/ksslcertificate.cpp:1071 15136 #, kde-format 15137 msgid "" 15138 "The decryption of the certificate's signature failed. This means it could " 15139 "not even be calculated as opposed to just not matching the expected result." 15140 msgstr "" 15141 15142 #: kssl/ksslcertificate.cpp:1073 15143 #, kde-format 15144 msgid "" 15145 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 15146 "This means it could not even be calculated as opposed to just not matching " 15147 "the expected result." 15148 msgstr "" 15149 15150 #: kssl/ksslcertificate.cpp:1075 15151 #, kde-format 15152 msgid "" 15153 "The decoding of the public key of the issuer failed. This means that the " 15154 "CA's (Certificate Authority) certificate can not be used to verify the " 15155 "certificate you wanted to use." 15156 msgstr "" 15157 15158 #: kssl/ksslcertificate.cpp:1077 15159 #, kde-format 15160 msgid "" 15161 "The certificate's signature is invalid. This means that the certificate can " 15162 "not be verified." 15163 msgstr "" 15164 15165 #: kssl/ksslcertificate.cpp:1079 15166 #, kde-format 15167 msgid "" 15168 "The CRL's (Certificate Revocation List) signature is invalid. This means " 15169 "that the CRL can not be verified." 15170 msgstr "" 15171 15172 #: kssl/ksslcertificate.cpp:1081 15173 #, kde-format 15174 msgid "The certificate is not valid, yet." 15175 msgstr "પ્રમાણપત્ર હજી સુધી માન્ય નથી." 15176 15177 #: kssl/ksslcertificate.cpp:1083 15178 #, kde-format 15179 msgid "The certificate is not valid, any more." 15180 msgstr "પ્રમાણપત્ર હવે પછી માન્ય નથી." 15181 15182 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 15183 #, kde-format 15184 msgid "The CRL (Certificate Revocation List) is not valid, yet." 15185 msgstr "CRL (પ્રમાણપત્ર પાછી ખેંચવાની યાદી) માન્ય નથી, હજી સુધી." 15186 15187 #: kssl/ksslcertificate.cpp:1089 15188 #, kde-format 15189 msgid "The time format of the certificate's 'notBefore' field is invalid." 15190 msgstr "" 15191 15192 #: kssl/ksslcertificate.cpp:1091 15193 #, kde-format 15194 msgid "The time format of the certificate's 'notAfter' field is invalid." 15195 msgstr "" 15196 15197 #: kssl/ksslcertificate.cpp:1093 15198 #, kde-format 15199 msgid "" 15200 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 15201 "field is invalid." 15202 msgstr "" 15203 15204 #: kssl/ksslcertificate.cpp:1095 15205 #, kde-format 15206 msgid "" 15207 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 15208 "field is invalid." 15209 msgstr "" 15210 15211 #: kssl/ksslcertificate.cpp:1097 15212 #, kde-format 15213 msgid "The OpenSSL process ran out of memory." 15214 msgstr "OpenSSL પ્રક્રિયા મેમરીની બહાર જતી રહી." 15215 15216 #: kssl/ksslcertificate.cpp:1099 15217 #, kde-format 15218 msgid "" 15219 "The certificate is self-signed and not in the list of trusted certificates. " 15220 "If you want to accept this certificate, import it into the list of trusted " 15221 "certificates." 15222 msgstr "" 15223 15224 #: kssl/ksslcertificate.cpp:1102 15225 #, kde-format 15226 msgid "" 15227 "The certificate is self-signed. While the trust chain could be built up, the " 15228 "root CA's (Certificate Authority) certificate can not be found." 15229 msgstr "" 15230 15231 #: kssl/ksslcertificate.cpp:1104 15232 #, kde-format 15233 msgid "" 15234 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 15235 "your trust chain is broken." 15236 msgstr "" 15237 15238 #: kssl/ksslcertificate.cpp:1106 15239 #, kde-format 15240 msgid "" 15241 "The certificate can not be verified as it is the only certificate in the " 15242 "trust chain and not self-signed. If you self-sign the certificate, make sure " 15243 "to import it into the list of trusted certificates." 15244 msgstr "" 15245 15246 #: kssl/ksslcertificate.cpp:1108 15247 #, kde-format 15248 msgid "The certificate chain is longer than the maximum depth specified." 15249 msgstr "" 15250 15251 #: kssl/ksslcertificate.cpp:1111 15252 #, kde-format 15253 msgid "The certificate has been revoked." 15254 msgstr "પ્રમાણપત્ર પાછું લેવામાં આવ્યું છે." 15255 15256 #: kssl/ksslcertificate.cpp:1113 15257 #, kde-format 15258 msgid "The certificate's CA (Certificate Authority) is invalid." 15259 msgstr "" 15260 15261 #: kssl/ksslcertificate.cpp:1115 15262 #, kde-format 15263 msgid "" 15264 "The length of the trust chain exceeded one of the CA's (Certificate " 15265 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 15266 msgstr "" 15267 15268 #: kssl/ksslcertificate.cpp:1117 15269 #, kde-format 15270 msgid "" 15271 "The certificate has not been signed for the purpose you tried to use it for. " 15272 "This means the CA (Certificate Authority) does not allow this usage." 15273 msgstr "" 15274 15275 #: kssl/ksslcertificate.cpp:1120 15276 #, kde-format 15277 msgid "" 15278 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 15279 "to use this certificate for." 15280 msgstr "" 15281 15282 #: kssl/ksslcertificate.cpp:1123 15283 #, kde-format 15284 msgid "" 15285 "The root CA (Certificate Authority) has been marked to be rejected for the " 15286 "purpose you tried to use it for." 15287 msgstr "" 15288 15289 #: kssl/ksslcertificate.cpp:1125 15290 #, kde-format 15291 msgid "" 15292 "The certificate's CA (Certificate Authority) does not match the CA name of " 15293 "the certificate." 15294 msgstr "" 15295 15296 #: kssl/ksslcertificate.cpp:1127 15297 #, kde-format 15298 msgid "" 15299 "The CA (Certificate Authority) certificate's key ID does not match the key " 15300 "ID in the 'Issuer' section of the certificate you are trying to use." 15301 msgstr "" 15302 15303 #: kssl/ksslcertificate.cpp:1129 15304 #, kde-format 15305 msgid "" 15306 "The CA (Certificate Authority) certificate's key ID and name do not match " 15307 "the key ID and name in the 'Issuer' section of the certificate you are " 15308 "trying to use." 15309 msgstr "" 15310 15311 #: kssl/ksslcertificate.cpp:1131 15312 #, kde-format 15313 msgid "" 15314 "The certificate's CA (Certificate Authority) is not allowed to sign " 15315 "certificates." 15316 msgstr "" 15317 15318 #: kssl/ksslcertificate.cpp:1133 15319 #, kde-format 15320 msgid "OpenSSL could not be verified." 15321 msgstr "OpenSSL ચકાસી શકાયું નહી." 15322 15323 #: kssl/ksslcertificate.cpp:1137 15324 #, kde-format 15325 msgid "" 15326 "The signature test for this certificate failed. This could mean that the " 15327 "signature of this certificate or any in its trust path are invalid, could " 15328 "not be decoded or that the CRL (Certificate Revocation List) could not be " 15329 "verified. If you see this message, please let the author of the software you " 15330 "are using know that he or she should use the new, more specific error " 15331 "messages." 15332 msgstr "" 15333 15334 #: kssl/ksslcertificate.cpp:1139 15335 #, kde-format 15336 msgid "" 15337 "This certificate, any in its trust path or its CA's (Certificate Authority) " 15338 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 15339 "valid yet or not valid any more. If you see this message, please let the " 15340 "author of the software you are using know that he or she should use the new, " 15341 "more specific error messages." 15342 msgstr "" 15343 15344 #: kssl/ksslcertificate.cpp:1145 15345 #, kde-format 15346 msgid "" 15347 "Certificate signing authority root files could not be found so the " 15348 "certificate is not verified." 15349 msgstr "" 15350 15351 #: kssl/ksslcertificate.cpp:1147 15352 #, kde-format 15353 msgid "SSL support was not found." 15354 msgstr "SSL આધાર મળ્યો નહી." 15355 15356 #: kssl/ksslcertificate.cpp:1149 15357 #, kde-format 15358 msgid "Private key test failed." 15359 msgstr "અંગત કળ ચકાસણી નિષ્ફળ ગઇ." 15360 15361 #: kssl/ksslcertificate.cpp:1151 15362 #, kde-format 15363 msgid "The certificate has not been issued for this host." 15364 msgstr "પ્રમાણપત્ર આ યજમાનમાં રજૂ કરવામાં આવ્યું નથી." 15365 15366 #: kssl/ksslcertificate.cpp:1153 15367 #, kde-format 15368 msgid "This certificate is not relevant." 15369 msgstr "પ્રમાણપત્ર સંબંધિત નથી." 15370 15371 #: kssl/ksslcertificate.cpp:1158 15372 #, kde-format 15373 msgid "The certificate is invalid." 15374 msgstr "પ્રમાણપત્ર અયોગ્ય છે." 15375 15376 #: kssl/ksslutils.cpp:90 15377 #, kde-format 15378 msgid "GMT" 15379 msgstr "GMT" 15380 15381 #, fuzzy 15382 #~| msgctxt "Coptic month 1 - ShortName" 15383 #~| msgid "Tho" 15384 #~ msgctxt "color" 15385 #~ msgid "hot" 15386 #~ msgstr "થો" 15387 15388 #, fuzzy 15389 #~| msgctxt "Coptic weekday 6 - ShortDayName" 15390 #~| msgid "Psa" 15391 #~ msgctxt "color" 15392 #~ msgid "sea" 15393 #~ msgstr "સા" 15394 15395 #, fuzzy 15396 #~| msgctxt "Coptic weekday 7 - ShortDayName" 15397 #~| msgid "Tky" 15398 #~ msgctxt "color" 15399 #~ msgid "sky" 15400 #~ msgstr "કિ" 15401 15402 #~ msgctxt "@item Calendar system" 15403 #~ msgid "Gregorian (Proleptic)" 15404 #~ msgstr "જ્યોર્જિયન (પ્રોલેપ્ટિક)" 15405 15406 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15407 #~ msgid "of Mes" 15408 #~ msgstr "મેસનું" 15409 15410 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15411 #~ msgid "of Ter" 15412 #~ msgstr "તેરનું" 15413 15414 #~ msgctxt "Ethiopian month 1 - ShortName" 15415 #~ msgid "Mes" 15416 #~ msgstr "મેસ" 15417 15418 #~ msgctxt "Ethiopian month 5 - LongName" 15419 #~ msgid "Ter" 15420 #~ msgstr "તેર" 15421 15422 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15423 #~ msgid "Ham" 15424 #~ msgstr "હેમ" 15425 15426 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15427 #~ msgid "Arb" 15428 #~ msgstr "અર્બ" 15429 15430 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15431 #~ msgid "Rob" 15432 #~ msgstr "રોબ" 15433 15434 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15435 #~ msgid "Arb" 15436 #~ msgstr "અર્બ" 15437 15438 #~ msgctxt "of May long" 15439 #~ msgid "of May" 15440 #~ msgstr "મે નું" 15441 15442 #~ msgctxt "May long" 15443 #~ msgid "May" 15444 #~ msgstr "મે" 15445 15446 #~ msgid "R. Thaani" 15447 #~ msgstr "ર. થાની" 15448 15449 #~ msgid "J. Thaani" 15450 #~ msgstr "જ. થાની" 15451 15452 #~ msgid "Hijjah" 15453 #~ msgstr "હિજાહ" 15454 15455 #~ msgctxt "of Tir long" 15456 #~ msgid "of Tir" 15457 #~ msgstr "તિરનું" 15458 15459 #~ msgctxt "of Dei long" 15460 #~ msgid "of Dei" 15461 #~ msgstr "ડેઇનું" 15462 15463 #~ msgctxt "Tir long" 15464 #~ msgid "Tir" 15465 #~ msgstr "તિર" 15466 15467 #~ msgctxt "Dei long" 15468 #~ msgid "Dei" 15469 #~ msgstr "ડેઇ" 15470 15471 #~ msgctxt "Shanbe short" 15472 #~ msgid "shn" 15473 #~ msgstr "શન"