Warning, /frameworks/kdelibs4support/po/fy/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Nederlands 0002 # translation of kdelibs4.po to 0003 # KTranslator Generated File 0004 # Fryske oersetting fan kdelibs. 0005 # Copyright (C) 2000,2001,2002,2003 KDE e.v.. 0006 # let op! het bestand bevat ter hoogte van string 2470 0007 # een gesplitste zinnen die mbv. %1 of %2 weer worden samengevoegd!! 0008 # Bauke Nicolai <mildaam@hotmail.com>, 2002. 0009 # KDE-oersetgroep Frysk <frysk@kde.nl>, 2000, 2001, 2002,2003. 0010 # Rinse de Vries <rinsedevries@kde.nl>, 2004, 2005, 2006, 2007. 0011 # Berend ytsma <berendy@bigfoot.com>, 2004. 0012 # Rinse de Vries <RinseDeVries@home.nl>, 2006, 2008. 0013 # Berend Ytsma <berendy@gmail.com>, 2008. 0014 msgid "" 0015 msgstr "" 0016 "Project-Id-Version: kdelibs4\n" 0017 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0018 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0019 "PO-Revision-Date: 2009-05-17 11:43+0100\n" 0020 "Last-Translator: Berend Ytsma <berendy@gmail.com>\n" 0021 "Language-Team: nl <kde-i18n-doc@lists.kde.org>\n" 0022 "Language: fy\n" 0023 "MIME-Version: 1.0\n" 0024 "Content-Type: text/plain; charset=UTF-8\n" 0025 "Content-Transfer-Encoding: 8bit\n" 0026 "X-Generator: KAider 0.1\n" 0027 "Plural-Forms: nplurals=2; plural=n != 1;\n" 0028 0029 #, kde-format 0030 msgctxt "NAME OF TRANSLATORS" 0031 msgid "Your names" 0032 msgstr "Berend Ytsma" 0033 0034 #, kde-format 0035 msgctxt "EMAIL OF TRANSLATORS" 0036 msgid "Your emails" 0037 msgstr "berendy@gmail.com" 0038 0039 #, kde-format 0040 msgctxt "color" 0041 msgid "AliceBlue" 0042 msgstr "Alice-blau" 0043 0044 #, kde-format 0045 msgctxt "color" 0046 msgid "AntiqueWhite" 0047 msgstr "Antyk-wyt" 0048 0049 #, kde-format 0050 msgctxt "color" 0051 msgid "AntiqueWhite1" 0052 msgstr "Antyk-wyt1" 0053 0054 #, kde-format 0055 msgctxt "color" 0056 msgid "AntiqueWhite2" 0057 msgstr "Antyk-wyt2" 0058 0059 #, kde-format 0060 msgctxt "color" 0061 msgid "AntiqueWhite3" 0062 msgstr "Antyk-wyt3" 0063 0064 #, kde-format 0065 msgctxt "color" 0066 msgid "AntiqueWhite4" 0067 msgstr "Antyk-wyt4" 0068 0069 #, kde-format 0070 msgctxt "color" 0071 msgid "BlanchedAlmond" 0072 msgstr "Mangelwyt" 0073 0074 #, fuzzy, kde-format 0075 #| msgctxt "color" 0076 #| msgid "PaleVioletRed" 0077 msgctxt "color" 0078 msgid "BlueViolet" 0079 msgstr "Bleekfioletrêd" 0080 0081 #, fuzzy, kde-format 0082 #| msgctxt "color" 0083 #| msgid "CadetBlue1" 0084 msgctxt "color" 0085 msgid "CadetBlue" 0086 msgstr "Kadetblau1" 0087 0088 #, kde-format 0089 msgctxt "color" 0090 msgid "CadetBlue1" 0091 msgstr "Kadetblau1" 0092 0093 #, kde-format 0094 msgctxt "color" 0095 msgid "CadetBlue2" 0096 msgstr "Kadetblau2" 0097 0098 #, kde-format 0099 msgctxt "color" 0100 msgid "CadetBlue3" 0101 msgstr "Kadetblau3" 0102 0103 #, fuzzy, kde-format 0104 #| msgctxt "color" 0105 #| msgid "CadetBlue1" 0106 msgctxt "color" 0107 msgid "CadetBlue4" 0108 msgstr "Kadetblau1" 0109 0110 #, kde-format 0111 msgctxt "color" 0112 msgid "CornflowerBlue" 0113 msgstr "Koarnblomblau" 0114 0115 #, fuzzy, kde-format 0116 #| msgctxt "color" 0117 #| msgid "SkyBlue" 0118 msgctxt "color" 0119 msgid "DarkBlue" 0120 msgstr "Himelsblau" 0121 0122 #, fuzzy, kde-format 0123 #| msgctxt "color" 0124 #| msgid "DarkSalmon" 0125 msgctxt "color" 0126 msgid "DarkCyan" 0127 msgstr "Donkersalmrôze" 0128 0129 #, fuzzy, kde-format 0130 #| msgctxt "color" 0131 #| msgid "PaleGoldenrod" 0132 msgctxt "color" 0133 msgid "DarkGoldenrod" 0134 msgstr "Bleekgoudenroede" 0135 0136 #, fuzzy, kde-format 0137 #| msgctxt "color" 0138 #| msgid "PaleGoldenrod" 0139 msgctxt "color" 0140 msgid "DarkGoldenrod1" 0141 msgstr "Bleekgoudenroede" 0142 0143 #, fuzzy, kde-format 0144 #| msgctxt "color" 0145 #| msgid "PaleGoldenrod" 0146 msgctxt "color" 0147 msgid "DarkGoldenrod2" 0148 msgstr "Bleekgoudenroede" 0149 0150 #, fuzzy, kde-format 0151 #| msgctxt "color" 0152 #| msgid "PaleGoldenrod" 0153 msgctxt "color" 0154 msgid "DarkGoldenrod3" 0155 msgstr "Bleekgoudenroede" 0156 0157 #, fuzzy, kde-format 0158 #| msgctxt "color" 0159 #| msgid "PaleGoldenrod" 0160 msgctxt "color" 0161 msgid "DarkGoldenrod4" 0162 msgstr "Bleekgoudenroede" 0163 0164 #, kde-format 0165 msgctxt "color" 0166 msgid "DarkGray" 0167 msgstr "Donkergriis" 0168 0169 #, fuzzy, kde-format 0170 #| msgctxt "color" 0171 #| msgid "DarkSeaGreen" 0172 msgctxt "color" 0173 msgid "DarkGreen" 0174 msgstr "Donkerseegrien" 0175 0176 #, kde-format 0177 msgctxt "color" 0178 msgid "DarkGrey" 0179 msgstr "Donkergriis" 0180 0181 #, kde-format 0182 msgctxt "color" 0183 msgid "DarkKhaki" 0184 msgstr "Donkerkaki" 0185 0186 #, fuzzy, kde-format 0187 #| msgctxt "color" 0188 #| msgid "DarkSeaGreen" 0189 msgctxt "color" 0190 msgid "DarkMagenta" 0191 msgstr "Donkerseegrien" 0192 0193 #, fuzzy, kde-format 0194 #| msgctxt "color" 0195 #| msgid "DarkOliveGreen1" 0196 msgctxt "color" 0197 msgid "DarkOliveGreen" 0198 msgstr "Donkeroliifgrien1" 0199 0200 #, kde-format 0201 msgctxt "color" 0202 msgid "DarkOliveGreen1" 0203 msgstr "Donkeroliifgrien1" 0204 0205 #, kde-format 0206 msgctxt "color" 0207 msgid "DarkOliveGreen2" 0208 msgstr "Donkeroliifgrien2" 0209 0210 #, fuzzy, kde-format 0211 #| msgctxt "color" 0212 #| msgid "DarkOliveGreen1" 0213 msgctxt "color" 0214 msgid "DarkOliveGreen3" 0215 msgstr "Donkeroliifgrien1" 0216 0217 #, fuzzy, kde-format 0218 #| msgctxt "color" 0219 #| msgid "DarkOliveGreen1" 0220 msgctxt "color" 0221 msgid "DarkOliveGreen4" 0222 msgstr "Donkeroliifgrien1" 0223 0224 #, fuzzy, kde-format 0225 #| msgctxt "color" 0226 #| msgid "DarkGray" 0227 msgctxt "color" 0228 msgid "DarkOrange" 0229 msgstr "Donkergriis" 0230 0231 #, fuzzy, kde-format 0232 #| msgctxt "color" 0233 #| msgid "DarkGray" 0234 msgctxt "color" 0235 msgid "DarkOrange1" 0236 msgstr "Donkergriis" 0237 0238 #, fuzzy, kde-format 0239 #| msgctxt "color" 0240 #| msgid "DarkGray" 0241 msgctxt "color" 0242 msgid "DarkOrange2" 0243 msgstr "Donkergriis" 0244 0245 #, fuzzy, kde-format 0246 #| msgctxt "color" 0247 #| msgid "DarkGray" 0248 msgctxt "color" 0249 msgid "DarkOrange3" 0250 msgstr "Donkergriis" 0251 0252 #, fuzzy, kde-format 0253 #| msgctxt "color" 0254 #| msgid "DarkGray" 0255 msgctxt "color" 0256 msgid "DarkOrange4" 0257 msgstr "Donkergriis" 0258 0259 #, fuzzy, kde-format 0260 #| msgctxt "color" 0261 #| msgid "DarkKhaki" 0262 msgctxt "color" 0263 msgid "DarkOrchid" 0264 msgstr "Donkerkaki" 0265 0266 #, fuzzy, kde-format 0267 #| msgctxt "color" 0268 #| msgid "orchid1" 0269 msgctxt "color" 0270 msgid "DarkOrchid1" 0271 msgstr "orchideepears1" 0272 0273 #, fuzzy, kde-format 0274 #| msgctxt "color" 0275 #| msgid "orchid2" 0276 msgctxt "color" 0277 msgid "DarkOrchid2" 0278 msgstr "orchideepears2" 0279 0280 #, fuzzy, kde-format 0281 #| msgctxt "color" 0282 #| msgid "orchid3" 0283 msgctxt "color" 0284 msgid "DarkOrchid3" 0285 msgstr "orchideepears3" 0286 0287 #, fuzzy, kde-format 0288 #| msgctxt "color" 0289 #| msgid "DarkKhaki" 0290 msgctxt "color" 0291 msgid "DarkOrchid4" 0292 msgstr "Donkerkaki" 0293 0294 #, fuzzy, kde-format 0295 #| msgctxt "color" 0296 #| msgid "DarkGrey" 0297 msgctxt "color" 0298 msgid "DarkRed" 0299 msgstr "Donkergriis" 0300 0301 #, kde-format 0302 msgctxt "color" 0303 msgid "DarkSalmon" 0304 msgstr "Donkersalmrôze" 0305 0306 #, kde-format 0307 msgctxt "color" 0308 msgid "DarkSeaGreen" 0309 msgstr "Donkerseegrien" 0310 0311 #, kde-format 0312 msgctxt "color" 0313 msgid "DarkSeaGreen1" 0314 msgstr "Donkerseegrien1" 0315 0316 #, kde-format 0317 msgctxt "color" 0318 msgid "DarkSeaGreen2" 0319 msgstr "Donkerseegrien2" 0320 0321 #, kde-format 0322 msgctxt "color" 0323 msgid "DarkSeaGreen3" 0324 msgstr "Donkerseegrien3" 0325 0326 #, kde-format 0327 msgctxt "color" 0328 msgid "DarkSeaGreen4" 0329 msgstr "Donkerseegrien4" 0330 0331 #, fuzzy, kde-format 0332 #| msgctxt "color" 0333 #| msgid "SlateBlue1" 0334 msgctxt "color" 0335 msgid "DarkSlateBlue" 0336 msgstr "Laaiblau1" 0337 0338 #, fuzzy, kde-format 0339 #| msgctxt "color" 0340 #| msgid "DarkSlateGray1" 0341 msgctxt "color" 0342 msgid "DarkSlateGray" 0343 msgstr "Donkerlaaigriis1" 0344 0345 #, kde-format 0346 msgctxt "color" 0347 msgid "DarkSlateGray1" 0348 msgstr "Donkerlaaigriis1" 0349 0350 #, kde-format 0351 msgctxt "color" 0352 msgid "DarkSlateGray2" 0353 msgstr "Donkerlaaigriis2" 0354 0355 #, kde-format 0356 msgctxt "color" 0357 msgid "DarkSlateGray3" 0358 msgstr "Donkerlaaigriis3" 0359 0360 #, fuzzy, kde-format 0361 #| msgctxt "color" 0362 #| msgid "DarkSlateGray1" 0363 msgctxt "color" 0364 msgid "DarkSlateGray4" 0365 msgstr "Donkerlaaigriis1" 0366 0367 #, fuzzy, kde-format 0368 #| msgctxt "color" 0369 #| msgid "DarkSlateGray1" 0370 msgctxt "color" 0371 msgid "DarkSlateGrey" 0372 msgstr "Donkerlaaigriis1" 0373 0374 #, fuzzy, kde-format 0375 #| msgctxt "color" 0376 #| msgid "PaleTurquoise" 0377 msgctxt "color" 0378 msgid "DarkTurquoise" 0379 msgstr "Bleekturkoaize" 0380 0381 #, fuzzy, kde-format 0382 #| msgctxt "color" 0383 #| msgid "violet" 0384 msgctxt "color" 0385 msgid "DarkViolet" 0386 msgstr "fiolet" 0387 0388 #, fuzzy, kde-format 0389 #| msgctxt "color" 0390 #| msgid "pink" 0391 msgctxt "color" 0392 msgid "DeepPink" 0393 msgstr "rôze" 0394 0395 #, fuzzy, kde-format 0396 #| msgctxt "color" 0397 #| msgid "pink1" 0398 msgctxt "color" 0399 msgid "DeepPink1" 0400 msgstr "rôze1" 0401 0402 #, fuzzy, kde-format 0403 #| msgctxt "color" 0404 #| msgid "pink2" 0405 msgctxt "color" 0406 msgid "DeepPink2" 0407 msgstr "rôze2" 0408 0409 #, fuzzy, kde-format 0410 #| msgctxt "color" 0411 #| msgid "pink3" 0412 msgctxt "color" 0413 msgid "DeepPink3" 0414 msgstr "rôze3" 0415 0416 #, fuzzy, kde-format 0417 #| msgctxt "color" 0418 #| msgid "pink" 0419 msgctxt "color" 0420 msgid "DeepPink4" 0421 msgstr "rôze" 0422 0423 #, fuzzy, kde-format 0424 #| msgctxt "color" 0425 #| msgid "SkyBlue" 0426 msgctxt "color" 0427 msgid "DeepSkyBlue" 0428 msgstr "Himelsblau" 0429 0430 #, fuzzy, kde-format 0431 #| msgctxt "color" 0432 #| msgid "SkyBlue1" 0433 msgctxt "color" 0434 msgid "DeepSkyBlue1" 0435 msgstr "Himelsblau1" 0436 0437 #, fuzzy, kde-format 0438 #| msgctxt "color" 0439 #| msgid "SkyBlue2" 0440 msgctxt "color" 0441 msgid "DeepSkyBlue2" 0442 msgstr "Himelsblau2" 0443 0444 #, fuzzy, kde-format 0445 #| msgctxt "color" 0446 #| msgid "SkyBlue3" 0447 msgctxt "color" 0448 msgid "DeepSkyBlue3" 0449 msgstr "Himelsblau3" 0450 0451 #, fuzzy, kde-format 0452 #| msgctxt "color" 0453 #| msgid "SkyBlue" 0454 msgctxt "color" 0455 msgid "DeepSkyBlue4" 0456 msgstr "Himelsblau" 0457 0458 #, kde-format 0459 msgctxt "color" 0460 msgid "DimGray" 0461 msgstr "Fealgriis" 0462 0463 #, kde-format 0464 msgctxt "color" 0465 msgid "DimGrey" 0466 msgstr "Fealgriis" 0467 0468 #, fuzzy, kde-format 0469 #| msgctxt "color" 0470 #| msgid "PowderBlue" 0471 msgctxt "color" 0472 msgid "DodgerBlue" 0473 msgstr "Poeierblau" 0474 0475 #, fuzzy, kde-format 0476 #| msgctxt "color" 0477 #| msgid "PowderBlue" 0478 msgctxt "color" 0479 msgid "DodgerBlue1" 0480 msgstr "Poeierblau" 0481 0482 #, fuzzy, kde-format 0483 #| msgctxt "color" 0484 #| msgid "PowderBlue" 0485 msgctxt "color" 0486 msgid "DodgerBlue2" 0487 msgstr "Poeierblau" 0488 0489 #, fuzzy, kde-format 0490 #| msgctxt "color" 0491 #| msgid "PowderBlue" 0492 msgctxt "color" 0493 msgid "DodgerBlue3" 0494 msgstr "Poeierblau" 0495 0496 #, fuzzy, kde-format 0497 #| msgctxt "color" 0498 #| msgid "PowderBlue" 0499 msgctxt "color" 0500 msgid "DodgerBlue4" 0501 msgstr "Poeierblau" 0502 0503 #, kde-format 0504 msgctxt "color" 0505 msgid "FloralWhite" 0506 msgstr "blossemwyt" 0507 0508 #, fuzzy, kde-format 0509 #| msgctxt "color" 0510 #| msgid "DarkSeaGreen" 0511 msgctxt "color" 0512 msgid "ForestGreen" 0513 msgstr "Donkerseegrien" 0514 0515 #, kde-format 0516 msgctxt "color" 0517 msgid "GhostWhite" 0518 msgstr "Lykwyt" 0519 0520 #, kde-format 0521 msgctxt "color" 0522 msgid "GreenYellow" 0523 msgstr "" 0524 0525 #, kde-format 0526 msgctxt "color" 0527 msgid "HotPink" 0528 msgstr "Felrôze" 0529 0530 #, kde-format 0531 msgctxt "color" 0532 msgid "HotPink1" 0533 msgstr "Felrôze1" 0534 0535 #, kde-format 0536 msgctxt "color" 0537 msgid "HotPink2" 0538 msgstr "Felrôze2" 0539 0540 #, fuzzy, kde-format 0541 #| msgctxt "color" 0542 #| msgid "HotPink" 0543 msgctxt "color" 0544 msgid "HotPink3" 0545 msgstr "Felrôze" 0546 0547 #, fuzzy, kde-format 0548 #| msgctxt "color" 0549 #| msgid "HotPink" 0550 msgctxt "color" 0551 msgid "HotPink4" 0552 msgstr "Felrôze" 0553 0554 #, fuzzy, kde-format 0555 #| msgctxt "color" 0556 #| msgid "IndianRed1" 0557 msgctxt "color" 0558 msgid "IndianRed" 0559 msgstr "Yndiaan-rêd1" 0560 0561 #, kde-format 0562 msgctxt "color" 0563 msgid "IndianRed1" 0564 msgstr "Yndiaan-rêd1" 0565 0566 #, fuzzy, kde-format 0567 #| msgctxt "color" 0568 #| msgid "IndianRed1" 0569 msgctxt "color" 0570 msgid "IndianRed2" 0571 msgstr "Yndiaan-rêd1" 0572 0573 #, fuzzy, kde-format 0574 #| msgctxt "color" 0575 #| msgid "IndianRed1" 0576 msgctxt "color" 0577 msgid "IndianRed3" 0578 msgstr "Yndiaan-rêd1" 0579 0580 #, fuzzy, kde-format 0581 #| msgctxt "color" 0582 #| msgid "IndianRed1" 0583 msgctxt "color" 0584 msgid "IndianRed4" 0585 msgstr "Yndiaan-rêd1" 0586 0587 #, kde-format 0588 msgctxt "color" 0589 msgid "LavenderBlush" 0590 msgstr "Lavindelrôze" 0591 0592 #, kde-format 0593 msgctxt "color" 0594 msgid "LavenderBlush1" 0595 msgstr "Lavindelrôze1" 0596 0597 #, kde-format 0598 msgctxt "color" 0599 msgid "LavenderBlush2" 0600 msgstr "Lavindelrôze2" 0601 0602 #, kde-format 0603 msgctxt "color" 0604 msgid "LavenderBlush3" 0605 msgstr "Lavindelrôze3" 0606 0607 #, kde-format 0608 msgctxt "color" 0609 msgid "LavenderBlush4" 0610 msgstr "Lavindelrôze4" 0611 0612 #, fuzzy, kde-format 0613 #| msgctxt "color" 0614 #| msgid "PaleGreen" 0615 msgctxt "color" 0616 msgid "LawnGreen" 0617 msgstr "Bleekgrien" 0618 0619 #, kde-format 0620 msgctxt "color" 0621 msgid "LemonChiffon" 0622 msgstr "Ljochtsitroengiel" 0623 0624 #, kde-format 0625 msgctxt "color" 0626 msgid "LemonChiffon1" 0627 msgstr "Ljochtsitroengiel1" 0628 0629 #, kde-format 0630 msgctxt "color" 0631 msgid "LemonChiffon2" 0632 msgstr "Ljochtsitroengiel2" 0633 0634 #, kde-format 0635 msgctxt "color" 0636 msgid "LemonChiffon3" 0637 msgstr "Ljochtsitroengiel3" 0638 0639 #, kde-format 0640 msgctxt "color" 0641 msgid "LemonChiffon4" 0642 msgstr "Ljochtsitroengiel4" 0643 0644 #, kde-format 0645 msgctxt "color" 0646 msgid "LightBlue" 0647 msgstr "Ljochtblau" 0648 0649 #, kde-format 0650 msgctxt "color" 0651 msgid "LightBlue1" 0652 msgstr "Ljochtblau1" 0653 0654 #, kde-format 0655 msgctxt "color" 0656 msgid "LightBlue2" 0657 msgstr "Ljochtblau2" 0658 0659 #, kde-format 0660 msgctxt "color" 0661 msgid "LightBlue3" 0662 msgstr "Ljochtblau3" 0663 0664 #, kde-format 0665 msgctxt "color" 0666 msgid "LightBlue4" 0667 msgstr "Ljochtblau4" 0668 0669 #, kde-format 0670 msgctxt "color" 0671 msgid "LightCoral" 0672 msgstr "Ljochtkoraalrêd" 0673 0674 #, kde-format 0675 msgctxt "color" 0676 msgid "LightCyan" 0677 msgstr "Ljochtsyaan" 0678 0679 #, kde-format 0680 msgctxt "color" 0681 msgid "LightCyan1" 0682 msgstr "Ljochtsyaan1" 0683 0684 #, kde-format 0685 msgctxt "color" 0686 msgid "LightCyan2" 0687 msgstr "Ljochtsyaan2" 0688 0689 #, kde-format 0690 msgctxt "color" 0691 msgid "LightCyan3" 0692 msgstr "Ljochtsyaan3" 0693 0694 #, kde-format 0695 msgctxt "color" 0696 msgid "LightCyan4" 0697 msgstr "Ljochtsyaan4" 0698 0699 #, kde-format 0700 msgctxt "color" 0701 msgid "LightGoldenrod" 0702 msgstr "Ljochtgoudenroede" 0703 0704 #, kde-format 0705 msgctxt "color" 0706 msgid "LightGoldenrod1" 0707 msgstr "Ljochtgoudenroede1" 0708 0709 #, kde-format 0710 msgctxt "color" 0711 msgid "LightGoldenrod2" 0712 msgstr "Ljochtgoudenroede2" 0713 0714 #, kde-format 0715 msgctxt "color" 0716 msgid "LightGoldenrod3" 0717 msgstr "Ljochtgoudenroede3" 0718 0719 #, fuzzy, kde-format 0720 #| msgctxt "color" 0721 #| msgid "LightGoldenrod" 0722 msgctxt "color" 0723 msgid "LightGoldenrod4" 0724 msgstr "Ljochtgoudenroede" 0725 0726 #, kde-format 0727 msgctxt "color" 0728 msgid "LightGoldenrodYellow" 0729 msgstr "Ljochtgoudenroedegiel" 0730 0731 #, kde-format 0732 msgctxt "color" 0733 msgid "LightGray" 0734 msgstr "Ljochtgriis" 0735 0736 #, kde-format 0737 msgctxt "color" 0738 msgid "LightGreen" 0739 msgstr "Ljochtgrien" 0740 0741 #, kde-format 0742 msgctxt "color" 0743 msgid "LightGrey" 0744 msgstr "Ljochtgriis" 0745 0746 #, kde-format 0747 msgctxt "color" 0748 msgid "LightPink" 0749 msgstr "Ljochtrôze" 0750 0751 #, kde-format 0752 msgctxt "color" 0753 msgid "LightPink1" 0754 msgstr "Ljochtrôze1" 0755 0756 #, kde-format 0757 msgctxt "color" 0758 msgid "LightPink2" 0759 msgstr "Ljochtrôze2" 0760 0761 #, kde-format 0762 msgctxt "color" 0763 msgid "LightPink3" 0764 msgstr "Ljochtrôze3" 0765 0766 #, fuzzy, kde-format 0767 #| msgctxt "color" 0768 #| msgid "LightPink" 0769 msgctxt "color" 0770 msgid "LightPink4" 0771 msgstr "Ljochtrôze" 0772 0773 #, kde-format 0774 msgctxt "color" 0775 msgid "LightSalmon" 0776 msgstr "Ljochtsalmrôze" 0777 0778 #, kde-format 0779 msgctxt "color" 0780 msgid "LightSalmon1" 0781 msgstr "Ljochtsalmrôze1" 0782 0783 #, kde-format 0784 msgctxt "color" 0785 msgid "LightSalmon2" 0786 msgstr "Ljochtsalmrôze2" 0787 0788 #, fuzzy, kde-format 0789 #| msgctxt "color" 0790 #| msgid "LightSalmon" 0791 msgctxt "color" 0792 msgid "LightSalmon3" 0793 msgstr "Ljochtsalmrôze" 0794 0795 #, fuzzy, kde-format 0796 #| msgctxt "color" 0797 #| msgid "LightSalmon" 0798 msgctxt "color" 0799 msgid "LightSalmon4" 0800 msgstr "Ljochtsalmrôze" 0801 0802 #, fuzzy, kde-format 0803 #| msgctxt "color" 0804 #| msgid "LightGreen" 0805 msgctxt "color" 0806 msgid "LightSeaGreen" 0807 msgstr "Ljochtgrien" 0808 0809 #, kde-format 0810 msgctxt "color" 0811 msgid "LightSkyBlue" 0812 msgstr "Ljochthimelblau" 0813 0814 #, kde-format 0815 msgctxt "color" 0816 msgid "LightSkyBlue1" 0817 msgstr "Ljochthimelblau1" 0818 0819 #, kde-format 0820 msgctxt "color" 0821 msgid "LightSkyBlue2" 0822 msgstr "Ljochthimelblau2" 0823 0824 #, kde-format 0825 msgctxt "color" 0826 msgid "LightSkyBlue3" 0827 msgstr "Ljochthimelblau3" 0828 0829 #, fuzzy, kde-format 0830 #| msgctxt "color" 0831 #| msgid "LightSkyBlue" 0832 msgctxt "color" 0833 msgid "LightSkyBlue4" 0834 msgstr "Ljochthimelblau" 0835 0836 #, kde-format 0837 msgctxt "color" 0838 msgid "LightSlateBlue" 0839 msgstr "Ljochtlaaiblau" 0840 0841 #, kde-format 0842 msgctxt "color" 0843 msgid "LightSlateGray" 0844 msgstr "Ljochtlaaigriis" 0845 0846 #, kde-format 0847 msgctxt "color" 0848 msgid "LightSlateGrey" 0849 msgstr "Ljochtlaaigriis" 0850 0851 #, kde-format 0852 msgctxt "color" 0853 msgid "LightSteelBlue" 0854 msgstr "Ljochtstielblau" 0855 0856 #, kde-format 0857 msgctxt "color" 0858 msgid "LightSteelBlue1" 0859 msgstr "Ljochtstielblau1" 0860 0861 #, kde-format 0862 msgctxt "color" 0863 msgid "LightSteelBlue2" 0864 msgstr "Ljochtstielblau2" 0865 0866 #, kde-format 0867 msgctxt "color" 0868 msgid "LightSteelBlue3" 0869 msgstr "Ljochtstielblau3" 0870 0871 #, kde-format 0872 msgctxt "color" 0873 msgid "LightSteelBlue4" 0874 msgstr "Ljochtstielblau4" 0875 0876 #, kde-format 0877 msgctxt "color" 0878 msgid "LightYellow" 0879 msgstr "Ljochtgiel" 0880 0881 #, kde-format 0882 msgctxt "color" 0883 msgid "LightYellow1" 0884 msgstr "Ljochtgiel1" 0885 0886 #, kde-format 0887 msgctxt "color" 0888 msgid "LightYellow2" 0889 msgstr "Ljochtgiel2" 0890 0891 #, kde-format 0892 msgctxt "color" 0893 msgid "LightYellow3" 0894 msgstr "Ljochtgiel3" 0895 0896 #, kde-format 0897 msgctxt "color" 0898 msgid "LightYellow4" 0899 msgstr "Ljochtgiel4" 0900 0901 #, fuzzy, kde-format 0902 #| msgctxt "color" 0903 #| msgid "LightGreen" 0904 msgctxt "color" 0905 msgid "LimeGreen" 0906 msgstr "Ljochtgrien" 0907 0908 #, kde-format 0909 msgctxt "color" 0910 msgid "MediumAquamarine" 0911 msgstr "Middelaquamarijn" 0912 0913 #, fuzzy, kde-format 0914 #| msgctxt "color" 0915 #| msgid "MediumSlateBlue" 0916 msgctxt "color" 0917 msgid "MediumBlue" 0918 msgstr "Middellaaiblau" 0919 0920 #, fuzzy, kde-format 0921 #| msgctxt "color" 0922 #| msgid "MediumOrchid1" 0923 msgctxt "color" 0924 msgid "MediumOrchid" 0925 msgstr "Middelorchideepears1" 0926 0927 #, kde-format 0928 msgctxt "color" 0929 msgid "MediumOrchid1" 0930 msgstr "Middelorchideepears1" 0931 0932 #, fuzzy, kde-format 0933 #| msgctxt "color" 0934 #| msgid "MediumOrchid1" 0935 msgctxt "color" 0936 msgid "MediumOrchid2" 0937 msgstr "Middelorchideepears1" 0938 0939 #, fuzzy, kde-format 0940 #| msgctxt "color" 0941 #| msgid "MediumOrchid1" 0942 msgctxt "color" 0943 msgid "MediumOrchid3" 0944 msgstr "Middelorchideepears1" 0945 0946 #, fuzzy, kde-format 0947 #| msgctxt "color" 0948 #| msgid "MediumOrchid1" 0949 msgctxt "color" 0950 msgid "MediumOrchid4" 0951 msgstr "Middelorchideepears1" 0952 0953 #, kde-format 0954 msgctxt "color" 0955 msgid "MediumPurple" 0956 msgstr "Middelpears" 0957 0958 #, kde-format 0959 msgctxt "color" 0960 msgid "MediumPurple1" 0961 msgstr "Middelpears1" 0962 0963 #, kde-format 0964 msgctxt "color" 0965 msgid "MediumPurple2" 0966 msgstr "Middelpears2" 0967 0968 #, kde-format 0969 msgctxt "color" 0970 msgid "MediumPurple3" 0971 msgstr "Middelpears3" 0972 0973 #, fuzzy, kde-format 0974 #| msgctxt "color" 0975 #| msgid "MediumPurple" 0976 msgctxt "color" 0977 msgid "MediumPurple4" 0978 msgstr "Middelpears" 0979 0980 #, fuzzy, kde-format 0981 #| msgctxt "color" 0982 #| msgid "MediumSlateBlue" 0983 msgctxt "color" 0984 msgid "MediumSeaGreen" 0985 msgstr "Middellaaiblau" 0986 0987 #, kde-format 0988 msgctxt "color" 0989 msgid "MediumSlateBlue" 0990 msgstr "Middellaaiblau" 0991 0992 #, fuzzy, kde-format 0993 #| msgctxt "color" 0994 #| msgid "MediumAquamarine" 0995 msgctxt "color" 0996 msgid "MediumSpringGreen" 0997 msgstr "Middelaquamarijn" 0998 0999 #, fuzzy, kde-format 1000 #| msgctxt "color" 1001 #| msgid "PaleTurquoise" 1002 msgctxt "color" 1003 msgid "MediumTurquoise" 1004 msgstr "Bleekturkoaize" 1005 1006 #, fuzzy, kde-format 1007 #| msgctxt "color" 1008 #| msgid "PaleVioletRed" 1009 msgctxt "color" 1010 msgid "MediumVioletRed" 1011 msgstr "Bleekfioletrêd" 1012 1013 #, fuzzy, kde-format 1014 #| msgctxt "color" 1015 #| msgid "LightBlue" 1016 msgctxt "color" 1017 msgid "MidnightBlue" 1018 msgstr "Ljochtblau" 1019 1020 #, kde-format 1021 msgctxt "color" 1022 msgid "MintCream" 1023 msgstr "Ljochtmintgrien" 1024 1025 #, kde-format 1026 msgctxt "color" 1027 msgid "MistyRose" 1028 msgstr "Aldrôze" 1029 1030 #, kde-format 1031 msgctxt "color" 1032 msgid "MistyRose1" 1033 msgstr "Aldrôze1" 1034 1035 #, kde-format 1036 msgctxt "color" 1037 msgid "MistyRose2" 1038 msgstr "Aldrôze2" 1039 1040 #, kde-format 1041 msgctxt "color" 1042 msgid "MistyRose3" 1043 msgstr "Aldrôze3" 1044 1045 #, kde-format 1046 msgctxt "color" 1047 msgid "MistyRose4" 1048 msgstr "Aldrôze4" 1049 1050 #, kde-format 1051 msgctxt "color" 1052 msgid "NavajoWhite" 1053 msgstr "Navajo-wyt" 1054 1055 #, kde-format 1056 msgctxt "color" 1057 msgid "NavajoWhite1" 1058 msgstr "Navajo-wyt1" 1059 1060 #, kde-format 1061 msgctxt "color" 1062 msgid "NavajoWhite2" 1063 msgstr "Navajo-wyt2" 1064 1065 #, kde-format 1066 msgctxt "color" 1067 msgid "NavajoWhite3" 1068 msgstr "Navajo-wyt3" 1069 1070 #, fuzzy, kde-format 1071 #| msgctxt "color" 1072 #| msgid "NavajoWhite" 1073 msgctxt "color" 1074 msgid "NavajoWhite4" 1075 msgstr "Navajo-wyt" 1076 1077 #, fuzzy, kde-format 1078 #| msgctxt "color" 1079 #| msgid "SkyBlue" 1080 msgctxt "color" 1081 msgid "NavyBlue" 1082 msgstr "Himelsblau" 1083 1084 #, kde-format 1085 msgctxt "color" 1086 msgid "OldLace" 1087 msgstr "Gielwyt" 1088 1089 #, kde-format 1090 msgctxt "color" 1091 msgid "OliveDrab" 1092 msgstr "" 1093 1094 #, kde-format 1095 msgctxt "color" 1096 msgid "OliveDrab1" 1097 msgstr "" 1098 1099 #, kde-format 1100 msgctxt "color" 1101 msgid "OliveDrab2" 1102 msgstr "" 1103 1104 #, kde-format 1105 msgctxt "color" 1106 msgid "OliveDrab3" 1107 msgstr "" 1108 1109 #, kde-format 1110 msgctxt "color" 1111 msgid "OliveDrab4" 1112 msgstr "" 1113 1114 #, kde-format 1115 msgctxt "color" 1116 msgid "OrangeRed" 1117 msgstr "" 1118 1119 #, fuzzy, kde-format 1120 #| msgctxt "color" 1121 #| msgid "IndianRed1" 1122 msgctxt "color" 1123 msgid "OrangeRed1" 1124 msgstr "Yndiaan-rêd1" 1125 1126 #, kde-format 1127 msgctxt "color" 1128 msgid "OrangeRed2" 1129 msgstr "" 1130 1131 #, kde-format 1132 msgctxt "color" 1133 msgid "OrangeRed3" 1134 msgstr "" 1135 1136 #, kde-format 1137 msgctxt "color" 1138 msgid "OrangeRed4" 1139 msgstr "" 1140 1141 #, kde-format 1142 msgctxt "color" 1143 msgid "PaleGoldenrod" 1144 msgstr "Bleekgoudenroede" 1145 1146 #, kde-format 1147 msgctxt "color" 1148 msgid "PaleGreen" 1149 msgstr "Bleekgrien" 1150 1151 #, kde-format 1152 msgctxt "color" 1153 msgid "PaleGreen1" 1154 msgstr "Bleekgrien1" 1155 1156 #, kde-format 1157 msgctxt "color" 1158 msgid "PaleGreen2" 1159 msgstr "Bleekgrien2" 1160 1161 #, kde-format 1162 msgctxt "color" 1163 msgid "PaleGreen3" 1164 msgstr "Bleekgrien3" 1165 1166 #, fuzzy, kde-format 1167 #| msgctxt "color" 1168 #| msgid "PaleGreen" 1169 msgctxt "color" 1170 msgid "PaleGreen4" 1171 msgstr "Bleekgrien" 1172 1173 #, kde-format 1174 msgctxt "color" 1175 msgid "PaleTurquoise" 1176 msgstr "Bleekturkoaize" 1177 1178 #, kde-format 1179 msgctxt "color" 1180 msgid "PaleTurquoise1" 1181 msgstr "Bleekturkoaize1" 1182 1183 #, kde-format 1184 msgctxt "color" 1185 msgid "PaleTurquoise2" 1186 msgstr "Bleekturkoaize2" 1187 1188 #, kde-format 1189 msgctxt "color" 1190 msgid "PaleTurquoise3" 1191 msgstr "Bleekturkoaize3" 1192 1193 #, kde-format 1194 msgctxt "color" 1195 msgid "PaleTurquoise4" 1196 msgstr "Bleekturkoaize4" 1197 1198 #, kde-format 1199 msgctxt "color" 1200 msgid "PaleVioletRed" 1201 msgstr "Bleekfioletrêd" 1202 1203 #, kde-format 1204 msgctxt "color" 1205 msgid "PaleVioletRed1" 1206 msgstr "Bleekfioletrêd1" 1207 1208 #, kde-format 1209 msgctxt "color" 1210 msgid "PaleVioletRed2" 1211 msgstr "Bleekfioletrêd2" 1212 1213 #, kde-format 1214 msgctxt "color" 1215 msgid "PaleVioletRed3" 1216 msgstr "Bleekfioletrêd3" 1217 1218 #, fuzzy, kde-format 1219 #| msgctxt "color" 1220 #| msgid "PaleVioletRed" 1221 msgctxt "color" 1222 msgid "PaleVioletRed4" 1223 msgstr "Bleekfioletrêd" 1224 1225 #, kde-format 1226 msgctxt "color" 1227 msgid "PapayaWhip" 1228 msgstr "Papajakrêm" 1229 1230 #, kde-format 1231 msgctxt "color" 1232 msgid "PeachPuff" 1233 msgstr "Perzikrôze" 1234 1235 #, kde-format 1236 msgctxt "color" 1237 msgid "PeachPuff1" 1238 msgstr "Perzikrôze1" 1239 1240 #, kde-format 1241 msgctxt "color" 1242 msgid "PeachPuff2" 1243 msgstr "Perzikrôze2" 1244 1245 #, kde-format 1246 msgctxt "color" 1247 msgid "PeachPuff3" 1248 msgstr "Perzikrôze3" 1249 1250 #, kde-format 1251 msgctxt "color" 1252 msgid "PeachPuff4" 1253 msgstr "Perzikrôze4" 1254 1255 #, kde-format 1256 msgctxt "color" 1257 msgid "PowderBlue" 1258 msgstr "Poeierblau" 1259 1260 #, kde-format 1261 msgctxt "color" 1262 msgid "RosyBrown" 1263 msgstr "Rôzebrûn" 1264 1265 #, kde-format 1266 msgctxt "color" 1267 msgid "RosyBrown1" 1268 msgstr "Rôzebrûn1" 1269 1270 #, kde-format 1271 msgctxt "color" 1272 msgid "RosyBrown2" 1273 msgstr "Rôzebrûn2" 1274 1275 #, kde-format 1276 msgctxt "color" 1277 msgid "RosyBrown3" 1278 msgstr "Rôzebrûn3" 1279 1280 #, kde-format 1281 msgctxt "color" 1282 msgid "RosyBrown4" 1283 msgstr "Rôzebrûn4" 1284 1285 #, fuzzy, kde-format 1286 #| msgctxt "color" 1287 #| msgid "SkyBlue" 1288 msgctxt "color" 1289 msgid "RoyalBlue" 1290 msgstr "Himelsblau" 1291 1292 #, fuzzy, kde-format 1293 #| msgctxt "color" 1294 #| msgid "SkyBlue1" 1295 msgctxt "color" 1296 msgid "RoyalBlue1" 1297 msgstr "Himelsblau1" 1298 1299 #, fuzzy, kde-format 1300 #| msgctxt "color" 1301 #| msgid "SkyBlue2" 1302 msgctxt "color" 1303 msgid "RoyalBlue2" 1304 msgstr "Himelsblau2" 1305 1306 #, fuzzy, kde-format 1307 #| msgctxt "color" 1308 #| msgid "SkyBlue3" 1309 msgctxt "color" 1310 msgid "RoyalBlue3" 1311 msgstr "Himelsblau3" 1312 1313 #, kde-format 1314 msgctxt "color" 1315 msgid "RoyalBlue4" 1316 msgstr "" 1317 1318 #, kde-format 1319 msgctxt "color" 1320 msgid "SaddleBrown" 1321 msgstr "" 1322 1323 #, fuzzy, kde-format 1324 #| msgctxt "color" 1325 #| msgid "RosyBrown" 1326 msgctxt "color" 1327 msgid "SandyBrown" 1328 msgstr "Rôzebrûn" 1329 1330 #, fuzzy, kde-format 1331 #| msgctxt "color" 1332 #| msgid "DarkSeaGreen" 1333 msgctxt "color" 1334 msgid "SeaGreen" 1335 msgstr "Donkerseegrien" 1336 1337 #, fuzzy, kde-format 1338 #| msgctxt "color" 1339 #| msgid "DarkSeaGreen1" 1340 msgctxt "color" 1341 msgid "SeaGreen1" 1342 msgstr "Donkerseegrien1" 1343 1344 #, fuzzy, kde-format 1345 #| msgctxt "color" 1346 #| msgid "DarkSeaGreen2" 1347 msgctxt "color" 1348 msgid "SeaGreen2" 1349 msgstr "Donkerseegrien2" 1350 1351 #, fuzzy, kde-format 1352 #| msgctxt "color" 1353 #| msgid "DarkSeaGreen3" 1354 msgctxt "color" 1355 msgid "SeaGreen3" 1356 msgstr "Donkerseegrien3" 1357 1358 #, fuzzy, kde-format 1359 #| msgctxt "color" 1360 #| msgid "DarkSeaGreen4" 1361 msgctxt "color" 1362 msgid "SeaGreen4" 1363 msgstr "Donkerseegrien4" 1364 1365 #, kde-format 1366 msgctxt "color" 1367 msgid "SkyBlue" 1368 msgstr "Himelsblau" 1369 1370 #, kde-format 1371 msgctxt "color" 1372 msgid "SkyBlue1" 1373 msgstr "Himelsblau1" 1374 1375 #, kde-format 1376 msgctxt "color" 1377 msgid "SkyBlue2" 1378 msgstr "Himelsblau2" 1379 1380 #, kde-format 1381 msgctxt "color" 1382 msgid "SkyBlue3" 1383 msgstr "Himelsblau3" 1384 1385 #, fuzzy, kde-format 1386 #| msgctxt "color" 1387 #| msgid "SkyBlue" 1388 msgctxt "color" 1389 msgid "SkyBlue4" 1390 msgstr "Himelsblau" 1391 1392 #, fuzzy, kde-format 1393 #| msgctxt "color" 1394 #| msgid "SlateBlue1" 1395 msgctxt "color" 1396 msgid "SlateBlue" 1397 msgstr "Laaiblau1" 1398 1399 #, kde-format 1400 msgctxt "color" 1401 msgid "SlateBlue1" 1402 msgstr "Laaiblau1" 1403 1404 #, kde-format 1405 msgctxt "color" 1406 msgid "SlateBlue2" 1407 msgstr "Laaiblau2" 1408 1409 #, fuzzy, kde-format 1410 #| msgctxt "color" 1411 #| msgid "SlateBlue1" 1412 msgctxt "color" 1413 msgid "SlateBlue3" 1414 msgstr "Laaiblau1" 1415 1416 #, fuzzy, kde-format 1417 #| msgctxt "color" 1418 #| msgid "SlateBlue1" 1419 msgctxt "color" 1420 msgid "SlateBlue4" 1421 msgstr "Laaiblau1" 1422 1423 #, kde-format 1424 msgctxt "color" 1425 msgid "SlateGray" 1426 msgstr "Laaigriis" 1427 1428 #, kde-format 1429 msgctxt "color" 1430 msgid "SlateGray1" 1431 msgstr "Laaigriis1" 1432 1433 #, kde-format 1434 msgctxt "color" 1435 msgid "SlateGray2" 1436 msgstr "Laaigriis2" 1437 1438 #, kde-format 1439 msgctxt "color" 1440 msgid "SlateGray3" 1441 msgstr "Laaigriis3" 1442 1443 #, kde-format 1444 msgctxt "color" 1445 msgid "SlateGray4" 1446 msgstr "Laaigriis4" 1447 1448 #, kde-format 1449 msgctxt "color" 1450 msgid "SlateGrey" 1451 msgstr "Laaigriis" 1452 1453 #, fuzzy, kde-format 1454 #| msgctxt "color" 1455 #| msgid "LightGreen" 1456 msgctxt "color" 1457 msgid "SpringGreen" 1458 msgstr "Ljochtgrien" 1459 1460 #, fuzzy, kde-format 1461 #| msgctxt "color" 1462 #| msgid "LightGreen" 1463 msgctxt "color" 1464 msgid "SpringGreen1" 1465 msgstr "Ljochtgrien" 1466 1467 #, fuzzy, kde-format 1468 #| msgctxt "color" 1469 #| msgid "LightGreen" 1470 msgctxt "color" 1471 msgid "SpringGreen2" 1472 msgstr "Ljochtgrien" 1473 1474 #, fuzzy, kde-format 1475 #| msgctxt "color" 1476 #| msgid "LightGreen" 1477 msgctxt "color" 1478 msgid "SpringGreen3" 1479 msgstr "Ljochtgrien" 1480 1481 #, fuzzy, kde-format 1482 #| msgctxt "color" 1483 #| msgid "LightGreen" 1484 msgctxt "color" 1485 msgid "SpringGreen4" 1486 msgstr "Ljochtgrien" 1487 1488 #, fuzzy, kde-format 1489 #| msgctxt "color" 1490 #| msgid "LightSteelBlue" 1491 msgctxt "color" 1492 msgid "SteelBlue" 1493 msgstr "Ljochtstielblau" 1494 1495 #, fuzzy, kde-format 1496 #| msgctxt "color" 1497 #| msgid "LightSteelBlue1" 1498 msgctxt "color" 1499 msgid "SteelBlue1" 1500 msgstr "Ljochtstielblau1" 1501 1502 #, fuzzy, kde-format 1503 #| msgctxt "color" 1504 #| msgid "LightSteelBlue2" 1505 msgctxt "color" 1506 msgid "SteelBlue2" 1507 msgstr "Ljochtstielblau2" 1508 1509 #, fuzzy, kde-format 1510 #| msgctxt "color" 1511 #| msgid "LightSteelBlue3" 1512 msgctxt "color" 1513 msgid "SteelBlue3" 1514 msgstr "Ljochtstielblau3" 1515 1516 #, fuzzy, kde-format 1517 #| msgctxt "color" 1518 #| msgid "LightSteelBlue4" 1519 msgctxt "color" 1520 msgid "SteelBlue4" 1521 msgstr "Ljochtstielblau4" 1522 1523 #, fuzzy, kde-format 1524 #| msgctxt "color" 1525 #| msgid "PaleVioletRed" 1526 msgctxt "color" 1527 msgid "VioletRed" 1528 msgstr "Bleekfioletrêd" 1529 1530 #, fuzzy, kde-format 1531 #| msgctxt "color" 1532 #| msgid "PaleVioletRed1" 1533 msgctxt "color" 1534 msgid "VioletRed1" 1535 msgstr "Bleekfioletrêd1" 1536 1537 #, fuzzy, kde-format 1538 #| msgctxt "color" 1539 #| msgid "PaleVioletRed2" 1540 msgctxt "color" 1541 msgid "VioletRed2" 1542 msgstr "Bleekfioletrêd2" 1543 1544 #, fuzzy, kde-format 1545 #| msgctxt "color" 1546 #| msgid "PaleVioletRed3" 1547 msgctxt "color" 1548 msgid "VioletRed3" 1549 msgstr "Bleekfioletrêd3" 1550 1551 #, fuzzy, kde-format 1552 #| msgctxt "color" 1553 #| msgid "PaleVioletRed" 1554 msgctxt "color" 1555 msgid "VioletRed4" 1556 msgstr "Bleekfioletrêd" 1557 1558 #, kde-format 1559 msgctxt "color" 1560 msgid "WhiteSmoke" 1561 msgstr "Griiswyt" 1562 1563 #, fuzzy, kde-format 1564 #| msgctxt "color" 1565 #| msgid "PaleGreen" 1566 msgctxt "color" 1567 msgid "YellowGreen" 1568 msgstr "Bleekgrien" 1569 1570 #, kde-format 1571 msgctxt "color" 1572 msgid "aquamarine" 1573 msgstr "aquamarijn" 1574 1575 #, kde-format 1576 msgctxt "color" 1577 msgid "aquamarine1" 1578 msgstr "aquamarijn1" 1579 1580 #, kde-format 1581 msgctxt "color" 1582 msgid "aquamarine2" 1583 msgstr "aquamarijn2" 1584 1585 #, kde-format 1586 msgctxt "color" 1587 msgid "aquamarine3" 1588 msgstr "aquamarijn3" 1589 1590 #, fuzzy, kde-format 1591 #| msgctxt "color" 1592 #| msgid "aquamarine" 1593 msgctxt "color" 1594 msgid "aquamarine4" 1595 msgstr "aquamarijn" 1596 1597 #, kde-format 1598 msgctxt "color" 1599 msgid "azure" 1600 msgstr "Azuerblau" 1601 1602 #, kde-format 1603 msgctxt "color" 1604 msgid "azure1" 1605 msgstr "Azuerblau1" 1606 1607 #, kde-format 1608 msgctxt "color" 1609 msgid "azure2" 1610 msgstr "Azuerblau2" 1611 1612 #, kde-format 1613 msgctxt "color" 1614 msgid "azure3" 1615 msgstr "Azuerblau3" 1616 1617 #, kde-format 1618 msgctxt "color" 1619 msgid "azure4" 1620 msgstr "Azuerblau4" 1621 1622 #, kde-format 1623 msgctxt "color" 1624 msgid "beige" 1625 msgstr "bêzje" 1626 1627 #, kde-format 1628 msgctxt "color" 1629 msgid "bisque" 1630 msgstr "beskútgiel" 1631 1632 #, kde-format 1633 msgctxt "color" 1634 msgid "bisque1" 1635 msgstr "beskútgiel1" 1636 1637 #, kde-format 1638 msgctxt "color" 1639 msgid "bisque2" 1640 msgstr "beskútgiel2" 1641 1642 #, kde-format 1643 msgctxt "color" 1644 msgid "bisque3" 1645 msgstr "beskútgiel3" 1646 1647 #, kde-format 1648 msgctxt "color" 1649 msgid "bisque4" 1650 msgstr "beskútgiel4" 1651 1652 #, kde-format 1653 msgctxt "color" 1654 msgid "black" 1655 msgstr "" 1656 1657 #, fuzzy, kde-format 1658 #| msgctxt "color" 1659 #| msgid "bisque" 1660 msgctxt "color" 1661 msgid "blue" 1662 msgstr "beskútgiel" 1663 1664 #, fuzzy, kde-format 1665 #| msgctxt "color" 1666 #| msgid "bisque1" 1667 msgctxt "color" 1668 msgid "blue1" 1669 msgstr "beskútgiel1" 1670 1671 #, fuzzy, kde-format 1672 #| msgctxt "color" 1673 #| msgid "bisque2" 1674 msgctxt "color" 1675 msgid "blue2" 1676 msgstr "beskútgiel2" 1677 1678 #, fuzzy, kde-format 1679 #| msgctxt "color" 1680 #| msgid "bisque3" 1681 msgctxt "color" 1682 msgid "blue3" 1683 msgstr "beskútgiel3" 1684 1685 #, fuzzy, kde-format 1686 #| msgctxt "color" 1687 #| msgid "bisque4" 1688 msgctxt "color" 1689 msgid "blue4" 1690 msgstr "beskútgiel4" 1691 1692 #, kde-format 1693 msgctxt "color" 1694 msgid "brown" 1695 msgstr "" 1696 1697 #, fuzzy, kde-format 1698 #| msgctxt "color" 1699 #| msgid "RosyBrown1" 1700 msgctxt "color" 1701 msgid "brown1" 1702 msgstr "Rôzebrûn1" 1703 1704 #, fuzzy, kde-format 1705 #| msgctxt "color" 1706 #| msgid "RosyBrown2" 1707 msgctxt "color" 1708 msgid "brown2" 1709 msgstr "Rôzebrûn2" 1710 1711 #, fuzzy, kde-format 1712 #| msgctxt "color" 1713 #| msgid "RosyBrown3" 1714 msgctxt "color" 1715 msgid "brown3" 1716 msgstr "Rôzebrûn3" 1717 1718 #, fuzzy, kde-format 1719 #| msgctxt "color" 1720 #| msgid "RosyBrown4" 1721 msgctxt "color" 1722 msgid "brown4" 1723 msgstr "Rôzebrûn4" 1724 1725 #, kde-format 1726 msgctxt "color" 1727 msgid "burlywood" 1728 msgstr "houtbrûn" 1729 1730 #, kde-format 1731 msgctxt "color" 1732 msgid "burlywood1" 1733 msgstr "houtbrûn1" 1734 1735 #, kde-format 1736 msgctxt "color" 1737 msgid "burlywood2" 1738 msgstr "houtbrûn2" 1739 1740 #, kde-format 1741 msgctxt "color" 1742 msgid "burlywood3" 1743 msgstr "houtbrûn3" 1744 1745 #, fuzzy, kde-format 1746 #| msgctxt "color" 1747 #| msgid "burlywood" 1748 msgctxt "color" 1749 msgid "burlywood4" 1750 msgstr "houtbrûn" 1751 1752 #, kde-format 1753 msgctxt "color" 1754 msgid "chartreuse" 1755 msgstr "" 1756 1757 #, kde-format 1758 msgctxt "color" 1759 msgid "chartreuse1" 1760 msgstr "" 1761 1762 #, kde-format 1763 msgctxt "color" 1764 msgid "chartreuse2" 1765 msgstr "" 1766 1767 #, kde-format 1768 msgctxt "color" 1769 msgid "chartreuse3" 1770 msgstr "" 1771 1772 #, kde-format 1773 msgctxt "color" 1774 msgid "chartreuse4" 1775 msgstr "" 1776 1777 #, kde-format 1778 msgctxt "color" 1779 msgid "chocolate" 1780 msgstr "" 1781 1782 #, kde-format 1783 msgctxt "color" 1784 msgid "chocolate1" 1785 msgstr "" 1786 1787 #, kde-format 1788 msgctxt "color" 1789 msgid "chocolate2" 1790 msgstr "" 1791 1792 #, kde-format 1793 msgctxt "color" 1794 msgid "chocolate3" 1795 msgstr "" 1796 1797 #, kde-format 1798 msgctxt "color" 1799 msgid "chocolate4" 1800 msgstr "" 1801 1802 #, fuzzy, kde-format 1803 #| msgctxt "color" 1804 #| msgid "cornsilk" 1805 msgctxt "color" 1806 msgid "coral" 1807 msgstr "maisgiel" 1808 1809 #, fuzzy, kde-format 1810 #| msgctxt "color" 1811 #| msgid "cornsilk1" 1812 msgctxt "color" 1813 msgid "coral1" 1814 msgstr "maisgiel1" 1815 1816 #, fuzzy, kde-format 1817 #| msgctxt "color" 1818 #| msgid "cornsilk2" 1819 msgctxt "color" 1820 msgid "coral2" 1821 msgstr "maisgiel2" 1822 1823 #, fuzzy, kde-format 1824 #| msgctxt "color" 1825 #| msgid "cornsilk3" 1826 msgctxt "color" 1827 msgid "coral3" 1828 msgstr "maisgiel3" 1829 1830 #, fuzzy, kde-format 1831 #| msgctxt "color" 1832 #| msgid "cornsilk4" 1833 msgctxt "color" 1834 msgid "coral4" 1835 msgstr "maisgiel4" 1836 1837 #, kde-format 1838 msgctxt "color" 1839 msgid "cornsilk" 1840 msgstr "maisgiel" 1841 1842 #, kde-format 1843 msgctxt "color" 1844 msgid "cornsilk1" 1845 msgstr "maisgiel1" 1846 1847 #, kde-format 1848 msgctxt "color" 1849 msgid "cornsilk2" 1850 msgstr "maisgiel2" 1851 1852 #, kde-format 1853 msgctxt "color" 1854 msgid "cornsilk3" 1855 msgstr "maisgiel3" 1856 1857 #, kde-format 1858 msgctxt "color" 1859 msgid "cornsilk4" 1860 msgstr "maisgiel4" 1861 1862 #, kde-format 1863 msgctxt "color" 1864 msgid "cyan" 1865 msgstr "" 1866 1867 #, kde-format 1868 msgctxt "color" 1869 msgid "cyan1" 1870 msgstr "" 1871 1872 #, kde-format 1873 msgctxt "color" 1874 msgid "cyan2" 1875 msgstr "" 1876 1877 #, kde-format 1878 msgctxt "color" 1879 msgid "cyan3" 1880 msgstr "" 1881 1882 #, kde-format 1883 msgctxt "color" 1884 msgid "cyan4" 1885 msgstr "" 1886 1887 #, kde-format 1888 msgctxt "color" 1889 msgid "firebrick" 1890 msgstr "" 1891 1892 #, kde-format 1893 msgctxt "color" 1894 msgid "firebrick1" 1895 msgstr "" 1896 1897 #, kde-format 1898 msgctxt "color" 1899 msgid "firebrick2" 1900 msgstr "" 1901 1902 #, kde-format 1903 msgctxt "color" 1904 msgid "firebrick3" 1905 msgstr "" 1906 1907 #, kde-format 1908 msgctxt "color" 1909 msgid "firebrick4" 1910 msgstr "" 1911 1912 #, kde-format 1913 msgctxt "color" 1914 msgid "gainsboro" 1915 msgstr "gainsboro" 1916 1917 #, kde-format 1918 msgctxt "color" 1919 msgid "gold" 1920 msgstr "" 1921 1922 #, kde-format 1923 msgctxt "color" 1924 msgid "gold1" 1925 msgstr "" 1926 1927 #, kde-format 1928 msgctxt "color" 1929 msgid "gold2" 1930 msgstr "" 1931 1932 #, kde-format 1933 msgctxt "color" 1934 msgid "gold3" 1935 msgstr "" 1936 1937 #, kde-format 1938 msgctxt "color" 1939 msgid "gold4" 1940 msgstr "" 1941 1942 #, fuzzy, kde-format 1943 #| msgctxt "color" 1944 #| msgid "LightGoldenrod" 1945 msgctxt "color" 1946 msgid "goldenrod" 1947 msgstr "Ljochtgoudenroede" 1948 1949 #, fuzzy, kde-format 1950 #| msgctxt "color" 1951 #| msgid "LightGoldenrod1" 1952 msgctxt "color" 1953 msgid "goldenrod1" 1954 msgstr "Ljochtgoudenroede1" 1955 1956 #, fuzzy, kde-format 1957 #| msgctxt "color" 1958 #| msgid "LightGoldenrod2" 1959 msgctxt "color" 1960 msgid "goldenrod2" 1961 msgstr "Ljochtgoudenroede2" 1962 1963 #, fuzzy, kde-format 1964 #| msgctxt "color" 1965 #| msgid "LightGoldenrod3" 1966 msgctxt "color" 1967 msgid "goldenrod3" 1968 msgstr "Ljochtgoudenroede3" 1969 1970 #, fuzzy, kde-format 1971 #| msgctxt "color" 1972 #| msgid "LightGoldenrod" 1973 msgctxt "color" 1974 msgid "goldenrod4" 1975 msgstr "Ljochtgoudenroede" 1976 1977 #, fuzzy, kde-format 1978 #| msgctxt "color" 1979 #| msgid "LightGreen" 1980 msgctxt "color" 1981 msgid "green" 1982 msgstr "Ljochtgrien" 1983 1984 #, fuzzy, kde-format 1985 #| msgctxt "color" 1986 #| msgid "LightGreen" 1987 msgctxt "color" 1988 msgid "green1" 1989 msgstr "Ljochtgrien" 1990 1991 #, fuzzy, kde-format 1992 #| msgctxt "color" 1993 #| msgid "LightGreen" 1994 msgctxt "color" 1995 msgid "green2" 1996 msgstr "Ljochtgrien" 1997 1998 #, fuzzy, kde-format 1999 #| msgctxt "color" 2000 #| msgid "LightGreen" 2001 msgctxt "color" 2002 msgid "green3" 2003 msgstr "Ljochtgrien" 2004 2005 #, fuzzy, kde-format 2006 #| msgctxt "color" 2007 #| msgid "LightGreen" 2008 msgctxt "color" 2009 msgid "green4" 2010 msgstr "Ljochtgrien" 2011 2012 #, kde-format 2013 msgctxt "color" 2014 msgid "honeydew" 2015 msgstr "huningmeloen" 2016 2017 #, kde-format 2018 msgctxt "color" 2019 msgid "honeydew1" 2020 msgstr "huningmeloen1" 2021 2022 #, kde-format 2023 msgctxt "color" 2024 msgid "honeydew2" 2025 msgstr "huningmeloen2" 2026 2027 #, kde-format 2028 msgctxt "color" 2029 msgid "honeydew3" 2030 msgstr "huningmeloen3" 2031 2032 #, kde-format 2033 msgctxt "color" 2034 msgid "honeydew4" 2035 msgstr "huningmeloen4" 2036 2037 #, kde-format 2038 msgctxt "color" 2039 msgid "ivory" 2040 msgstr "ivoar" 2041 2042 #, kde-format 2043 msgctxt "color" 2044 msgid "ivory1" 2045 msgstr "ivoar1" 2046 2047 #, kde-format 2048 msgctxt "color" 2049 msgid "ivory2" 2050 msgstr "ivoar2" 2051 2052 #, kde-format 2053 msgctxt "color" 2054 msgid "ivory3" 2055 msgstr "ivoar3" 2056 2057 #, kde-format 2058 msgctxt "color" 2059 msgid "ivory4" 2060 msgstr "ivoar4" 2061 2062 #, kde-format 2063 msgctxt "color" 2064 msgid "khaki" 2065 msgstr "kaki" 2066 2067 #, kde-format 2068 msgctxt "color" 2069 msgid "khaki1" 2070 msgstr "kaki1" 2071 2072 #, kde-format 2073 msgctxt "color" 2074 msgid "khaki2" 2075 msgstr "kaki2" 2076 2077 #, kde-format 2078 msgctxt "color" 2079 msgid "khaki3" 2080 msgstr "kaki3" 2081 2082 #, fuzzy, kde-format 2083 #| msgctxt "color" 2084 #| msgid "khaki" 2085 msgctxt "color" 2086 msgid "khaki4" 2087 msgstr "kaki" 2088 2089 #, kde-format 2090 msgctxt "color" 2091 msgid "lavender" 2092 msgstr "lavindel" 2093 2094 #, kde-format 2095 msgctxt "color" 2096 msgid "linen" 2097 msgstr "linnenwyt" 2098 2099 #, kde-format 2100 msgctxt "color" 2101 msgid "magenta" 2102 msgstr "" 2103 2104 #, kde-format 2105 msgctxt "color" 2106 msgid "magenta1" 2107 msgstr "" 2108 2109 #, kde-format 2110 msgctxt "color" 2111 msgid "magenta2" 2112 msgstr "" 2113 2114 #, kde-format 2115 msgctxt "color" 2116 msgid "magenta3" 2117 msgstr "" 2118 2119 #, kde-format 2120 msgctxt "color" 2121 msgid "magenta4" 2122 msgstr "" 2123 2124 #, kde-format 2125 msgctxt "color" 2126 msgid "maroon" 2127 msgstr "" 2128 2129 #, kde-format 2130 msgctxt "color" 2131 msgid "maroon1" 2132 msgstr "" 2133 2134 #, kde-format 2135 msgctxt "color" 2136 msgid "maroon2" 2137 msgstr "" 2138 2139 #, kde-format 2140 msgctxt "color" 2141 msgid "maroon3" 2142 msgstr "" 2143 2144 #, kde-format 2145 msgctxt "color" 2146 msgid "maroon4" 2147 msgstr "" 2148 2149 #, kde-format 2150 msgctxt "color" 2151 msgid "moccasin" 2152 msgstr "mokassin" 2153 2154 #, kde-format 2155 msgctxt "color" 2156 msgid "navy" 2157 msgstr "" 2158 2159 #, kde-format 2160 msgctxt "color" 2161 msgid "orange" 2162 msgstr "" 2163 2164 #, kde-format 2165 msgctxt "color" 2166 msgid "orange1" 2167 msgstr "" 2168 2169 #, kde-format 2170 msgctxt "color" 2171 msgid "orange2" 2172 msgstr "" 2173 2174 #, kde-format 2175 msgctxt "color" 2176 msgid "orange3" 2177 msgstr "" 2178 2179 #, kde-format 2180 msgctxt "color" 2181 msgid "orange4" 2182 msgstr "" 2183 2184 #, kde-format 2185 msgctxt "color" 2186 msgid "orchid" 2187 msgstr "orchideepears" 2188 2189 #, kde-format 2190 msgctxt "color" 2191 msgid "orchid1" 2192 msgstr "orchideepears1" 2193 2194 #, kde-format 2195 msgctxt "color" 2196 msgid "orchid2" 2197 msgstr "orchideepears2" 2198 2199 #, kde-format 2200 msgctxt "color" 2201 msgid "orchid3" 2202 msgstr "orchideepears3" 2203 2204 #, fuzzy, kde-format 2205 #| msgctxt "color" 2206 #| msgid "orchid" 2207 msgctxt "color" 2208 msgid "orchid4" 2209 msgstr "orchideepears" 2210 2211 #, kde-format 2212 msgctxt "color" 2213 msgid "peru" 2214 msgstr "" 2215 2216 #, kde-format 2217 msgctxt "color" 2218 msgid "pink" 2219 msgstr "rôze" 2220 2221 #, kde-format 2222 msgctxt "color" 2223 msgid "pink1" 2224 msgstr "rôze1" 2225 2226 #, kde-format 2227 msgctxt "color" 2228 msgid "pink2" 2229 msgstr "rôze2" 2230 2231 #, kde-format 2232 msgctxt "color" 2233 msgid "pink3" 2234 msgstr "rôze3" 2235 2236 #, fuzzy, kde-format 2237 #| msgctxt "color" 2238 #| msgid "pink" 2239 msgctxt "color" 2240 msgid "pink4" 2241 msgstr "rôze" 2242 2243 #, kde-format 2244 msgctxt "color" 2245 msgid "plum" 2246 msgstr "lilapears" 2247 2248 #, kde-format 2249 msgctxt "color" 2250 msgid "plum1" 2251 msgstr "lilapears1" 2252 2253 #, kde-format 2254 msgctxt "color" 2255 msgid "plum2" 2256 msgstr "lilapears2" 2257 2258 #, kde-format 2259 msgctxt "color" 2260 msgid "plum3" 2261 msgstr "lilapears3" 2262 2263 #, kde-format 2264 msgctxt "color" 2265 msgid "plum4" 2266 msgstr "lilapears4" 2267 2268 #, kde-format 2269 msgctxt "color" 2270 msgid "purple" 2271 msgstr "" 2272 2273 #, fuzzy, kde-format 2274 #| msgctxt "color" 2275 #| msgid "azure1" 2276 msgctxt "color" 2277 msgid "purple1" 2278 msgstr "Azuerblau1" 2279 2280 #, fuzzy, kde-format 2281 #| msgctxt "color" 2282 #| msgid "azure2" 2283 msgctxt "color" 2284 msgid "purple2" 2285 msgstr "Azuerblau2" 2286 2287 #, fuzzy, kde-format 2288 #| msgctxt "color" 2289 #| msgid "azure3" 2290 msgctxt "color" 2291 msgid "purple3" 2292 msgstr "Azuerblau3" 2293 2294 #, fuzzy, kde-format 2295 #| msgctxt "color" 2296 #| msgid "azure4" 2297 msgctxt "color" 2298 msgid "purple4" 2299 msgstr "Azuerblau4" 2300 2301 #, fuzzy, kde-format 2302 msgctxt "color" 2303 msgid "red" 2304 msgstr "wo" 2305 2306 #, fuzzy, kde-format 2307 #| msgctxt "color" 2308 #| msgid "azure1" 2309 msgctxt "color" 2310 msgid "red1" 2311 msgstr "Azuerblau1" 2312 2313 #, fuzzy, kde-format 2314 #| msgctxt "color" 2315 #| msgid "azure2" 2316 msgctxt "color" 2317 msgid "red2" 2318 msgstr "Azuerblau2" 2319 2320 #, fuzzy, kde-format 2321 #| msgctxt "color" 2322 #| msgid "azure3" 2323 msgctxt "color" 2324 msgid "red3" 2325 msgstr "Azuerblau3" 2326 2327 #, fuzzy, kde-format 2328 #| msgctxt "color" 2329 #| msgid "azure4" 2330 msgctxt "color" 2331 msgid "red4" 2332 msgstr "Azuerblau4" 2333 2334 #, kde-format 2335 msgctxt "color" 2336 msgid "salmon" 2337 msgstr "salmrôze" 2338 2339 #, kde-format 2340 msgctxt "color" 2341 msgid "salmon1" 2342 msgstr "salmrôze1" 2343 2344 #, fuzzy, kde-format 2345 #| msgctxt "color" 2346 #| msgid "salmon" 2347 msgctxt "color" 2348 msgid "salmon2" 2349 msgstr "salmrôze" 2350 2351 #, fuzzy, kde-format 2352 #| msgctxt "color" 2353 #| msgid "salmon" 2354 msgctxt "color" 2355 msgid "salmon3" 2356 msgstr "salmrôze" 2357 2358 #, fuzzy, kde-format 2359 #| msgctxt "color" 2360 #| msgid "salmon" 2361 msgctxt "color" 2362 msgid "salmon4" 2363 msgstr "salmrôze" 2364 2365 #, kde-format 2366 msgctxt "color" 2367 msgid "seashell" 2368 msgstr "schelp" 2369 2370 #, kde-format 2371 msgctxt "color" 2372 msgid "seashell1" 2373 msgstr "schelp1" 2374 2375 #, kde-format 2376 msgctxt "color" 2377 msgid "seashell2" 2378 msgstr "schelp2" 2379 2380 #, kde-format 2381 msgctxt "color" 2382 msgid "seashell3" 2383 msgstr "schelp3" 2384 2385 #, kde-format 2386 msgctxt "color" 2387 msgid "seashell4" 2388 msgstr "schelp4" 2389 2390 #, kde-format 2391 msgctxt "color" 2392 msgid "sienna" 2393 msgstr "" 2394 2395 #, kde-format 2396 msgctxt "color" 2397 msgid "sienna1" 2398 msgstr "" 2399 2400 #, kde-format 2401 msgctxt "color" 2402 msgid "sienna2" 2403 msgstr "" 2404 2405 #, kde-format 2406 msgctxt "color" 2407 msgid "sienna3" 2408 msgstr "" 2409 2410 #, kde-format 2411 msgctxt "color" 2412 msgid "sienna4" 2413 msgstr "" 2414 2415 #, kde-format 2416 msgctxt "color" 2417 msgid "snow" 2418 msgstr "sniewyt" 2419 2420 #, kde-format 2421 msgctxt "color" 2422 msgid "snow1" 2423 msgstr "sniewyt1" 2424 2425 #, kde-format 2426 msgctxt "color" 2427 msgid "snow2" 2428 msgstr "sniewyt2" 2429 2430 #, kde-format 2431 msgctxt "color" 2432 msgid "snow3" 2433 msgstr "sniewyt3" 2434 2435 #, kde-format 2436 msgctxt "color" 2437 msgid "snow4" 2438 msgstr "sniewyt4" 2439 2440 #, fuzzy, kde-format 2441 msgctxt "color" 2442 msgid "tan" 2443 msgstr "jan" 2444 2445 #, fuzzy, kde-format 2446 #| msgctxt "color" 2447 #| msgid "tan" 2448 msgctxt "color" 2449 msgid "tan1" 2450 msgstr "taankleurig" 2451 2452 #, fuzzy, kde-format 2453 #| msgctxt "color" 2454 #| msgid "tan" 2455 msgctxt "color" 2456 msgid "tan2" 2457 msgstr "taankleurig" 2458 2459 #, fuzzy, kde-format 2460 #| msgctxt "color" 2461 #| msgid "tan" 2462 msgctxt "color" 2463 msgid "tan3" 2464 msgstr "taankleurig" 2465 2466 #, fuzzy, kde-format 2467 #| msgctxt "color" 2468 #| msgid "tan" 2469 msgctxt "color" 2470 msgid "tan4" 2471 msgstr "taankleurig" 2472 2473 #, kde-format 2474 msgctxt "color" 2475 msgid "thistle" 2476 msgstr "Doarnstikelblau" 2477 2478 #, kde-format 2479 msgctxt "color" 2480 msgid "thistle1" 2481 msgstr "Doarnstikelblau1" 2482 2483 #, kde-format 2484 msgctxt "color" 2485 msgid "thistle2" 2486 msgstr "Doarnstikelblau2" 2487 2488 #, kde-format 2489 msgctxt "color" 2490 msgid "thistle3" 2491 msgstr "Doarnstikelblau3" 2492 2493 #, kde-format 2494 msgctxt "color" 2495 msgid "thistle4" 2496 msgstr "Doarnstikelblau4" 2497 2498 #, kde-format 2499 msgctxt "color" 2500 msgid "tomato" 2501 msgstr "" 2502 2503 #, kde-format 2504 msgctxt "color" 2505 msgid "tomato1" 2506 msgstr "" 2507 2508 #, kde-format 2509 msgctxt "color" 2510 msgid "tomato2" 2511 msgstr "" 2512 2513 #, kde-format 2514 msgctxt "color" 2515 msgid "tomato3" 2516 msgstr "" 2517 2518 #, kde-format 2519 msgctxt "color" 2520 msgid "tomato4" 2521 msgstr "" 2522 2523 #, fuzzy, kde-format 2524 #| msgctxt "color" 2525 #| msgid "PaleTurquoise" 2526 msgctxt "color" 2527 msgid "turquoise" 2528 msgstr "Bleekturkoaize" 2529 2530 #, fuzzy, kde-format 2531 #| msgctxt "color" 2532 #| msgid "PaleTurquoise1" 2533 msgctxt "color" 2534 msgid "turquoise1" 2535 msgstr "Bleekturkoaize1" 2536 2537 #, fuzzy, kde-format 2538 #| msgctxt "color" 2539 #| msgid "PaleTurquoise2" 2540 msgctxt "color" 2541 msgid "turquoise2" 2542 msgstr "Bleekturkoaize2" 2543 2544 #, fuzzy, kde-format 2545 #| msgctxt "color" 2546 #| msgid "PaleTurquoise3" 2547 msgctxt "color" 2548 msgid "turquoise3" 2549 msgstr "Bleekturkoaize3" 2550 2551 #, fuzzy, kde-format 2552 #| msgctxt "color" 2553 #| msgid "PaleTurquoise4" 2554 msgctxt "color" 2555 msgid "turquoise4" 2556 msgstr "Bleekturkoaize4" 2557 2558 #, kde-format 2559 msgctxt "color" 2560 msgid "violet" 2561 msgstr "fiolet" 2562 2563 #, kde-format 2564 msgctxt "color" 2565 msgid "wheat" 2566 msgstr "weitgiel" 2567 2568 #, kde-format 2569 msgctxt "color" 2570 msgid "wheat1" 2571 msgstr "weitgiel1" 2572 2573 #, kde-format 2574 msgctxt "color" 2575 msgid "wheat2" 2576 msgstr "weitgiel2" 2577 2578 #, kde-format 2579 msgctxt "color" 2580 msgid "wheat3" 2581 msgstr "weitgiel3" 2582 2583 #, kde-format 2584 msgctxt "color" 2585 msgid "wheat4" 2586 msgstr "weitgiel4" 2587 2588 #, kde-format 2589 msgctxt "color" 2590 msgid "white" 2591 msgstr "wyt" 2592 2593 #, kde-format 2594 msgctxt "color" 2595 msgid "yellow" 2596 msgstr "" 2597 2598 #, fuzzy, kde-format 2599 #| msgctxt "color" 2600 #| msgid "LightYellow1" 2601 msgctxt "color" 2602 msgid "yellow1" 2603 msgstr "Ljochtgiel1" 2604 2605 #, fuzzy, kde-format 2606 #| msgctxt "color" 2607 #| msgid "LightYellow2" 2608 msgctxt "color" 2609 msgid "yellow2" 2610 msgstr "Ljochtgiel2" 2611 2612 #, fuzzy, kde-format 2613 #| msgctxt "color" 2614 #| msgid "LightYellow3" 2615 msgctxt "color" 2616 msgid "yellow3" 2617 msgstr "Ljochtgiel3" 2618 2619 #, fuzzy, kde-format 2620 #| msgctxt "color" 2621 #| msgid "LightYellow4" 2622 msgctxt "color" 2623 msgid "yellow4" 2624 msgstr "Ljochtgiel4" 2625 2626 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2627 #, kde-format 2628 msgid "Debug Settings" 2629 msgstr "Utbrek ynstellings" 2630 2631 #: kdebugdialog/kdebugdialog.cpp:59 2632 #, kde-format 2633 msgid "File" 2634 msgstr "Triem" 2635 2636 #: kdebugdialog/kdebugdialog.cpp:60 2637 #, kde-format 2638 msgid "Message Box" 2639 msgstr "Berjochtfak" 2640 2641 #: kdebugdialog/kdebugdialog.cpp:61 2642 #, kde-format 2643 msgid "Shell" 2644 msgstr "Shell" 2645 2646 #: kdebugdialog/kdebugdialog.cpp:62 2647 #, kde-format 2648 msgid "Syslog" 2649 msgstr "Syslog" 2650 2651 #: kdebugdialog/kdebugdialog.cpp:63 2652 #, kde-format 2653 msgid "None" 2654 msgstr "Neat" 2655 2656 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2657 #: kdebugdialog/kdebugdialog.ui:48 2658 #, kde-format 2659 msgid "Information" 2660 msgstr "Ynformaasje" 2661 2662 #. i18n: ectx: property (text), widget (QLabel, label_2) 2663 #. i18n: ectx: property (text), widget (QLabel, label_8) 2664 #. i18n: ectx: property (text), widget (QLabel, label_4) 2665 #. i18n: ectx: property (text), widget (QLabel, label_6) 2666 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2667 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2668 #, kde-format 2669 msgid "Output to:" 2670 msgstr "Utfier nei:" 2671 2672 #. i18n: ectx: property (text), widget (QLabel, label_3) 2673 #. i18n: ectx: property (text), widget (QLabel, label_9) 2674 #. i18n: ectx: property (text), widget (QLabel, label_5) 2675 #. i18n: ectx: property (text), widget (QLabel, label_7) 2676 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2677 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2678 #, kde-format 2679 msgid "Filename:" 2680 msgstr "Triemnamme:" 2681 2682 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2683 #: kdebugdialog/kdebugdialog.ui:83 2684 #, kde-format 2685 msgid "Error" 2686 msgstr "Flater" 2687 2688 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2689 #: kdebugdialog/kdebugdialog.ui:118 2690 #, kde-format 2691 msgid "Abort on fatal errors" 2692 msgstr "Ofbrekke by fatale flaters" 2693 2694 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2695 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2696 #, kde-format 2697 msgid "Disable all debug output" 2698 msgstr "Alle útbrek útfier útskeakelje" 2699 2700 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2701 #: kdebugdialog/kdebugdialog.ui:145 2702 #, kde-format 2703 msgid "Warning" 2704 msgstr "Warskôging" 2705 2706 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2707 #: kdebugdialog/kdebugdialog.ui:180 2708 #, kde-format 2709 msgid "Fatal Error" 2710 msgstr "Fatale flater" 2711 2712 #: kdebugdialog/klistdebugdialog.cpp:69 2713 #, kde-format 2714 msgid "&Select All" 2715 msgstr "Alle&s selektearje" 2716 2717 #: kdebugdialog/klistdebugdialog.cpp:70 2718 #, kde-format 2719 msgid "&Deselect All" 2720 msgstr "Alles &ûntselektearje" 2721 2722 #: kdebugdialog/main.cpp:100 2723 #, kde-format 2724 msgid "KDebugDialog" 2725 msgstr "KDebugDialog" 2726 2727 #: kdebugdialog/main.cpp:101 2728 #, kde-format 2729 msgid "A dialog box for setting preferences for debug output" 2730 msgstr "" 2731 "In dialoochfinster foar it ynstellen fan de foarkarren foar de debug-útfier." 2732 2733 #: kdebugdialog/main.cpp:102 2734 #, fuzzy, kde-format 2735 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2736 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2737 msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2738 2739 #: kdebugdialog/main.cpp:103 2740 #, kde-format 2741 msgid "David Faure" 2742 msgstr "David Faure" 2743 2744 #: kdebugdialog/main.cpp:103 2745 #, kde-format 2746 msgid "Maintainer" 2747 msgstr "Underhâlder" 2748 2749 #: kdebugdialog/main.cpp:108 2750 #, kde-format 2751 msgid "Show the fully-fledged dialog instead of the default list dialog" 2752 msgstr "" 2753 "It folsleine dialoochfinster sjen litte yn plak fan it standert list-" 2754 "dialoochfinster" 2755 2756 #: kdebugdialog/main.cpp:109 2757 #, kde-format 2758 msgid "Turn area on" 2759 msgstr "Gebiet ynskeakelje" 2760 2761 #: kdebugdialog/main.cpp:110 2762 #, kde-format 2763 msgid "Turn area off" 2764 msgstr "Gebiet útskeakelje" 2765 2766 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2767 #, kde-format 2768 msgid "no error" 2769 msgstr "gjin flater" 2770 2771 #: kdecore/k3resolver.cpp:534 2772 #, kde-format 2773 msgid "requested family not supported for this host name" 2774 msgstr "Fersochte family wurd net stipe foar dizze kompjûternamme" 2775 2776 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2777 #, kde-format 2778 msgid "temporary failure in name resolution" 2779 msgstr "tydlike flater yn nammeresolúsje" 2780 2781 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2782 #, kde-format 2783 msgid "non-recoverable failure in name resolution" 2784 msgstr "net te ferhelpen flater yn nammeresolúsje" 2785 2786 #: kdecore/k3resolver.cpp:537 2787 #, kde-format 2788 msgid "invalid flags" 2789 msgstr "ûnjildige wearde foar 'ai_flags'" 2790 2791 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2792 #, kde-format 2793 msgid "memory allocation failure" 2794 msgstr "ûnthâld-tawizings-flater" 2795 2796 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2797 #, kde-format 2798 msgid "name or service not known" 2799 msgstr "namme of tsjinst ûnbekend" 2800 2801 #: kdecore/k3resolver.cpp:540 2802 #, kde-format 2803 msgid "requested family not supported" 2804 msgstr "fersochte family wurdt net stipe" 2805 2806 #: kdecore/k3resolver.cpp:541 2807 #, kde-format 2808 msgid "requested service not supported for this socket type" 2809 msgstr "fersochte tsjinst wurdt net stipe foar dit sockettype" 2810 2811 #: kdecore/k3resolver.cpp:542 2812 #, kde-format 2813 msgid "requested socket type not supported" 2814 msgstr "fersochte sockettype wurdt net stipe" 2815 2816 #: kdecore/k3resolver.cpp:543 2817 #, kde-format 2818 msgid "unknown error" 2819 msgstr "ûnbekende flater" 2820 2821 #: kdecore/k3resolver.cpp:545 2822 #, kde-format 2823 msgctxt "1: the i18n'ed system error code, from errno" 2824 msgid "system error: %1" 2825 msgstr "systeem flater: %1" 2826 2827 #: kdecore/k3resolver.cpp:556 2828 #, kde-format 2829 msgid "request was canceled" 2830 msgstr "fersyk is ôfbrutsen" 2831 2832 #: kdecore/k3socketaddress.cpp:631 2833 #, kde-format 2834 msgctxt "1: the unknown socket address family number" 2835 msgid "Unknown family %1" 2836 msgstr "Onbekende familie %1" 2837 2838 #: kdecore/k3socketbase.cpp:215 2839 #, kde-format 2840 msgctxt "Socket error code NoError" 2841 msgid "no error" 2842 msgstr "gjin flater" 2843 2844 #: kdecore/k3socketbase.cpp:220 2845 #, kde-format 2846 msgctxt "Socket error code LookupFailure" 2847 msgid "name lookup has failed" 2848 msgstr "it opsykjen fan namme is net slagge" 2849 2850 #: kdecore/k3socketbase.cpp:225 2851 #, kde-format 2852 msgctxt "Socket error code AddressInUse" 2853 msgid "address already in use" 2854 msgstr "adres is al yn gebrûk" 2855 2856 #: kdecore/k3socketbase.cpp:230 2857 #, kde-format 2858 msgctxt "Socket error code AlreadyBound" 2859 msgid "socket is already bound" 2860 msgstr "socket is al bûn" 2861 2862 #: kdecore/k3socketbase.cpp:235 2863 #, kde-format 2864 msgctxt "Socket error code AlreadyCreated" 2865 msgid "socket is already created" 2866 msgstr "socket is al oanmakke" 2867 2868 #: kdecore/k3socketbase.cpp:240 2869 #, kde-format 2870 msgctxt "Socket error code NotBound" 2871 msgid "socket is not bound" 2872 msgstr "socket is net bûn" 2873 2874 #: kdecore/k3socketbase.cpp:245 2875 #, kde-format 2876 msgctxt "Socket error code NotCreated" 2877 msgid "socket has not been created" 2878 msgstr "socket is net oanmakke" 2879 2880 #: kdecore/k3socketbase.cpp:250 2881 #, kde-format 2882 msgctxt "Socket error code WouldBlock" 2883 msgid "operation would block" 2884 msgstr "hanneling soe blokkearre" 2885 2886 #: kdecore/k3socketbase.cpp:255 2887 #, kde-format 2888 msgctxt "Socket error code ConnectionRefused" 2889 msgid "connection actively refused" 2890 msgstr "ferbining is aktyf wegere" 2891 2892 #: kdecore/k3socketbase.cpp:260 2893 #, kde-format 2894 msgctxt "Socket error code ConnectionTimedOut" 2895 msgid "connection timed out" 2896 msgstr "ferbining is ferrûn" 2897 2898 #: kdecore/k3socketbase.cpp:265 2899 #, kde-format 2900 msgctxt "Socket error code InProgress" 2901 msgid "operation is already in progress" 2902 msgstr "hanneling is al geande" 2903 2904 #: kdecore/k3socketbase.cpp:270 2905 #, kde-format 2906 msgctxt "Socket error code NetFailure" 2907 msgid "network failure occurred" 2908 msgstr "der wy in netwurkflater" 2909 2910 #: kdecore/k3socketbase.cpp:275 2911 #, kde-format 2912 msgctxt "Socket error code NotSupported" 2913 msgid "operation is not supported" 2914 msgstr "hanneling wurdt net stype" 2915 2916 #: kdecore/k3socketbase.cpp:280 2917 #, kde-format 2918 msgctxt "Socket error code Timeout" 2919 msgid "timed operation timed out" 2920 msgstr "tiidlimit foar dizze aksje is ferrûn" 2921 2922 #: kdecore/k3socketbase.cpp:285 2923 #, kde-format 2924 msgctxt "Socket error code UnknownError" 2925 msgid "an unknown/unexpected error has happened" 2926 msgstr "in ûnbekende of ûnferwachte flater hat him foardien" 2927 2928 #: kdecore/k3socketbase.cpp:290 2929 #, kde-format 2930 msgctxt "Socket error code RemotelyDisconnected" 2931 msgid "remote host closed connection" 2932 msgstr "de eksterne kompjûter hat de ferbining ferbrutsen" 2933 2934 #: kdecore/k4aboutdata.cpp:267 2935 #, kde-format 2936 msgid "" 2937 "No licensing terms for this program have been specified.\n" 2938 "Please check the documentation or the source for any\n" 2939 "licensing terms.\n" 2940 msgstr "" 2941 2942 #: kdecore/k4aboutdata.cpp:273 2943 #, kde-format 2944 msgid "This program is distributed under the terms of the %1." 2945 msgstr "" 2946 2947 #: kdecore/k4aboutdata.cpp:297 2948 #, kde-format 2949 msgctxt "@item license (short name)" 2950 msgid "GPL v2" 2951 msgstr "GPL v2" 2952 2953 #: kdecore/k4aboutdata.cpp:298 2954 #, kde-format 2955 msgctxt "@item license" 2956 msgid "GNU General Public License Version 2" 2957 msgstr "GNU General Public License Version 2" 2958 2959 #: kdecore/k4aboutdata.cpp:301 2960 #, kde-format 2961 msgctxt "@item license (short name)" 2962 msgid "LGPL v2" 2963 msgstr "LGPL v2" 2964 2965 #: kdecore/k4aboutdata.cpp:302 2966 #, kde-format 2967 msgctxt "@item license" 2968 msgid "GNU Lesser General Public License Version 2" 2969 msgstr "GNU Lesser General Public License Version 2" 2970 2971 #: kdecore/k4aboutdata.cpp:305 2972 #, kde-format 2973 msgctxt "@item license (short name)" 2974 msgid "BSD License" 2975 msgstr "BSD Lisinsje" 2976 2977 #: kdecore/k4aboutdata.cpp:306 2978 #, kde-format 2979 msgctxt "@item license" 2980 msgid "BSD License" 2981 msgstr "BSD Lisinsje:" 2982 2983 #: kdecore/k4aboutdata.cpp:309 2984 #, kde-format 2985 msgctxt "@item license (short name)" 2986 msgid "Artistic License" 2987 msgstr "Artistic lisinsje" 2988 2989 #: kdecore/k4aboutdata.cpp:310 2990 #, kde-format 2991 msgctxt "@item license" 2992 msgid "Artistic License" 2993 msgstr "Artistic lisinsje" 2994 2995 #: kdecore/k4aboutdata.cpp:313 2996 #, kde-format 2997 msgctxt "@item license (short name)" 2998 msgid "QPL v1.0" 2999 msgstr "QPL v1.0" 3000 3001 #: kdecore/k4aboutdata.cpp:314 3002 #, kde-format 3003 msgctxt "@item license" 3004 msgid "Q Public License" 3005 msgstr "Q Public lisinsje" 3006 3007 #: kdecore/k4aboutdata.cpp:317 3008 #, kde-format 3009 msgctxt "@item license (short name)" 3010 msgid "GPL v3" 3011 msgstr "GPL v3" 3012 3013 #: kdecore/k4aboutdata.cpp:318 3014 #, kde-format 3015 msgctxt "@item license" 3016 msgid "GNU General Public License Version 3" 3017 msgstr "GNU General Public License Version 2" 3018 3019 #: kdecore/k4aboutdata.cpp:321 3020 #, kde-format 3021 msgctxt "@item license (short name)" 3022 msgid "LGPL v3" 3023 msgstr "LGPL v3" 3024 3025 #: kdecore/k4aboutdata.cpp:322 3026 #, kde-format 3027 msgctxt "@item license" 3028 msgid "GNU Lesser General Public License Version 3" 3029 msgstr "GNU Lesser General Public License Version 3" 3030 3031 #: kdecore/k4aboutdata.cpp:326 3032 #, kde-format 3033 msgctxt "@item license" 3034 msgid "Custom" 3035 msgstr "Oanpast" 3036 3037 #: kdecore/k4aboutdata.cpp:329 3038 #, kde-format 3039 msgctxt "@item license" 3040 msgid "Not specified" 3041 msgstr "Net oantsjutte" 3042 3043 #: kdecore/k4aboutdata.cpp:891 3044 #, kde-format 3045 msgctxt "replace this with information about your translation team" 3046 msgid "" 3047 "<p>KDE is translated into many languages thanks to the work of the " 3048 "translation teams all over the world.</p><p>For more information on KDE " 3049 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 3050 "org</a></p>" 3051 msgstr "" 3052 "<p>KDE is yn ferskate talen beskikber. Dat is te tankjen oan de ynset fan " 3053 "oersetteams dy' t rûnom op 'e wrâld aktyf binne.</p><p>Sjoch foar mear " 3054 "ynformaasje oer de Frysktalige KDE op http://www.kde.nl/frysk en foar " 3055 "algemiene ynformaasje oer de ynternasjonalisaasje fan KDE op http://l10n.kde." 3056 "org</p>" 3057 3058 #: kdecore/kcalendarsystem.cpp:108 3059 #, kde-format 3060 msgctxt "@item Calendar system" 3061 msgid "Gregorian" 3062 msgstr "Gregoriaansk" 3063 3064 #: kdecore/kcalendarsystem.cpp:110 3065 #, fuzzy, kde-format 3066 msgctxt "@item Calendar system" 3067 msgid "Coptic" 3068 msgstr "Koptysk" 3069 3070 #: kdecore/kcalendarsystem.cpp:112 3071 #, fuzzy, kde-format 3072 msgctxt "@item Calendar system" 3073 msgid "Ethiopian" 3074 msgstr "Ethiopysk" 3075 3076 #: kdecore/kcalendarsystem.cpp:114 3077 #, kde-format 3078 msgctxt "@item Calendar system" 3079 msgid "Hebrew" 3080 msgstr "Hebreeuwsk" 3081 3082 #: kdecore/kcalendarsystem.cpp:116 3083 #, kde-format 3084 msgctxt "@item Calendar system" 3085 msgid "Islamic / Hijri (Civil)" 3086 msgstr "" 3087 3088 #: kdecore/kcalendarsystem.cpp:118 3089 #, kde-format 3090 msgctxt "@item Calendar system" 3091 msgid "Indian National" 3092 msgstr "" 3093 3094 #: kdecore/kcalendarsystem.cpp:120 3095 #, kde-format 3096 msgctxt "@item Calendar system" 3097 msgid "Jalali" 3098 msgstr "Jalali" 3099 3100 #: kdecore/kcalendarsystem.cpp:122 3101 #, kde-format 3102 msgctxt "@item Calendar system" 3103 msgid "Japanese" 3104 msgstr "" 3105 3106 #: kdecore/kcalendarsystem.cpp:124 3107 #, fuzzy, kde-format 3108 msgctxt "@item Calendar system" 3109 msgid "Julian" 3110 msgstr "jan" 3111 3112 #: kdecore/kcalendarsystem.cpp:126 3113 #, kde-format 3114 msgctxt "@item Calendar system" 3115 msgid "Taiwanese" 3116 msgstr "" 3117 3118 #: kdecore/kcalendarsystem.cpp:128 3119 #, fuzzy, kde-format 3120 #| msgid "R. Thaani" 3121 msgctxt "@item Calendar system" 3122 msgid "Thai" 3123 msgstr "R. Thaani" 3124 3125 #: kdecore/kcalendarsystem.cpp:131 3126 #, kde-format 3127 msgctxt "@item Calendar system" 3128 msgid "Invalid Calendar Type" 3129 msgstr "Unjildich kalindertype" 3130 3131 #: kdecore/kcalendarsystem.cpp:1495 3132 #, kde-format 3133 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 3134 msgid "-" 3135 msgstr "" 3136 3137 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 3138 #: kio/kfilemetadataprovider.cpp:199 3139 #, kde-format 3140 msgid "Today" 3141 msgstr "Hjoed" 3142 3143 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 3144 #: kio/kfilemetadataprovider.cpp:202 3145 #, kde-format 3146 msgid "Yesterday" 3147 msgstr "Juster" 3148 3149 #: kdecore/kcalendarsystemcoptic.cpp:45 3150 #, kde-format 3151 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 3152 msgid "Anno Martyrum" 3153 msgstr "" 3154 3155 #: kdecore/kcalendarsystemcoptic.cpp:46 3156 #, kde-format 3157 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 3158 msgid "AM" 3159 msgstr "" 3160 3161 #: kdecore/kcalendarsystemcoptic.cpp:47 3162 #, kde-format 3163 msgctxt "" 3164 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 3165 msgid "%Ey %EC" 3166 msgstr "" 3167 3168 #: kdecore/kcalendarsystemcoptic.cpp:153 3169 #, kde-format 3170 msgctxt "Coptic month 1 - KLocale::NarrowName" 3171 msgid "T" 3172 msgstr "" 3173 3174 #: kdecore/kcalendarsystemcoptic.cpp:155 3175 #, kde-format 3176 msgctxt "Coptic month 2 - KLocale::NarrowName" 3177 msgid "P" 3178 msgstr "" 3179 3180 #: kdecore/kcalendarsystemcoptic.cpp:157 3181 #, kde-format 3182 msgctxt "Coptic month 3 - KLocale::NarrowName" 3183 msgid "H" 3184 msgstr "" 3185 3186 #: kdecore/kcalendarsystemcoptic.cpp:159 3187 #, kde-format 3188 msgctxt "Coptic month 4 - KLocale::NarrowName" 3189 msgid "K" 3190 msgstr "" 3191 3192 #: kdecore/kcalendarsystemcoptic.cpp:161 3193 #, kde-format 3194 msgctxt "Coptic month 5 - KLocale::NarrowName" 3195 msgid "T" 3196 msgstr "" 3197 3198 #: kdecore/kcalendarsystemcoptic.cpp:163 3199 #, kde-format 3200 msgctxt "Coptic month 6 - KLocale::NarrowName" 3201 msgid "M" 3202 msgstr "" 3203 3204 #: kdecore/kcalendarsystemcoptic.cpp:165 3205 #, kde-format 3206 msgctxt "Coptic month 7 - KLocale::NarrowName" 3207 msgid "P" 3208 msgstr "" 3209 3210 #: kdecore/kcalendarsystemcoptic.cpp:167 3211 #, kde-format 3212 msgctxt "Coptic month 8 - KLocale::NarrowName" 3213 msgid "P" 3214 msgstr "" 3215 3216 #: kdecore/kcalendarsystemcoptic.cpp:169 3217 #, kde-format 3218 msgctxt "Coptic month 9 - KLocale::NarrowName" 3219 msgid "P" 3220 msgstr "" 3221 3222 #: kdecore/kcalendarsystemcoptic.cpp:171 3223 #, kde-format 3224 msgctxt "Coptic month 10 - KLocale::NarrowName" 3225 msgid "P" 3226 msgstr "" 3227 3228 #: kdecore/kcalendarsystemcoptic.cpp:173 3229 #, kde-format 3230 msgctxt "Coptic month 11 - KLocale::NarrowName" 3231 msgid "E" 3232 msgstr "" 3233 3234 #: kdecore/kcalendarsystemcoptic.cpp:175 3235 #, kde-format 3236 msgctxt "Coptic month 12 - KLocale::NarrowName" 3237 msgid "M" 3238 msgstr "" 3239 3240 #: kdecore/kcalendarsystemcoptic.cpp:177 3241 #, kde-format 3242 msgctxt "Coptic month 13 - KLocale::NarrowName" 3243 msgid "K" 3244 msgstr "" 3245 3246 #: kdecore/kcalendarsystemcoptic.cpp:186 3247 #, fuzzy, kde-format 3248 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 3249 msgid "of Tho" 3250 msgstr "fan Kho" 3251 3252 #: kdecore/kcalendarsystemcoptic.cpp:188 3253 #, fuzzy, kde-format 3254 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 3255 msgid "of Pao" 3256 msgstr "fan Tamuz" 3257 3258 #: kdecore/kcalendarsystemcoptic.cpp:190 3259 #, fuzzy, kde-format 3260 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 3261 msgid "of Hat" 3262 msgstr "fan Shvat" 3263 3264 #: kdecore/kcalendarsystemcoptic.cpp:192 3265 #, fuzzy, kde-format 3266 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 3267 msgid "of Kia" 3268 msgstr "fan Nisan" 3269 3270 #: kdecore/kcalendarsystemcoptic.cpp:194 3271 #, fuzzy, kde-format 3272 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 3273 msgid "of Tob" 3274 msgstr "fan feb" 3275 3276 #: kdecore/kcalendarsystemcoptic.cpp:196 3277 #, fuzzy, kde-format 3278 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 3279 msgid "of Mes" 3280 msgstr "fan Meh" 3281 3282 #: kdecore/kcalendarsystemcoptic.cpp:198 3283 #, fuzzy, kde-format 3284 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 3285 msgid "of Par" 3286 msgstr "fan mrt" 3287 3288 #: kdecore/kcalendarsystemcoptic.cpp:200 3289 #, fuzzy, kde-format 3290 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 3291 msgid "of Pam" 3292 msgstr "fan Tamuz" 3293 3294 #: kdecore/kcalendarsystemcoptic.cpp:202 3295 #, fuzzy, kde-format 3296 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 3297 msgid "of Pas" 3298 msgstr "fan Bah" 3299 3300 #: kdecore/kcalendarsystemcoptic.cpp:204 3301 #, fuzzy, kde-format 3302 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 3303 msgid "of Pan" 3304 msgstr "fan jan" 3305 3306 #: kdecore/kcalendarsystemcoptic.cpp:206 3307 #, fuzzy, kde-format 3308 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 3309 msgid "of Epe" 3310 msgstr "fan feb" 3311 3312 #: kdecore/kcalendarsystemcoptic.cpp:208 3313 #, fuzzy, kde-format 3314 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 3315 msgid "of Meo" 3316 msgstr "fan Mor" 3317 3318 #: kdecore/kcalendarsystemcoptic.cpp:210 3319 #, fuzzy, kde-format 3320 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3321 msgid "of Kou" 3322 msgstr "fan Kho" 3323 3324 #: kdecore/kcalendarsystemcoptic.cpp:219 3325 #, fuzzy, kde-format 3326 msgctxt "Coptic month 1 - KLocale::ShortName" 3327 msgid "Tho" 3328 msgstr "Thl" 3329 3330 #: kdecore/kcalendarsystemcoptic.cpp:221 3331 #, fuzzy, kde-format 3332 msgctxt "Coptic month 2 - KLocale::ShortName" 3333 msgid "Pao" 3334 msgstr "Skoftsje" 3335 3336 #: kdecore/kcalendarsystemcoptic.cpp:223 3337 #, fuzzy, kde-format 3338 msgctxt "Coptic month 3 - KLocale::ShortName" 3339 msgid "Hat" 3340 msgstr "sno" 3341 3342 #: kdecore/kcalendarsystemcoptic.cpp:225 3343 #, fuzzy, kde-format 3344 msgctxt "Coptic month 4 - KLocale::ShortName" 3345 msgid "Kia" 3346 msgstr "Kha" 3347 3348 #: kdecore/kcalendarsystemcoptic.cpp:227 3349 #, fuzzy, kde-format 3350 msgctxt "Coptic month 5 - KLocale::ShortName" 3351 msgid "Tob" 3352 msgstr "Taak" 3353 3354 #: kdecore/kcalendarsystemcoptic.cpp:229 3355 #, fuzzy, kde-format 3356 msgctxt "Coptic month 6 - KLocale::ShortName" 3357 msgid "Mes" 3358 msgstr "Ja" 3359 3360 #: kdecore/kcalendarsystemcoptic.cpp:231 3361 #, fuzzy, kde-format 3362 msgctxt "Coptic month 7 - KLocale::ShortName" 3363 msgid "Par" 3364 msgstr "mrt" 3365 3366 #: kdecore/kcalendarsystemcoptic.cpp:233 3367 #, fuzzy, kde-format 3368 msgctxt "Coptic month 8 - KLocale::ShortName" 3369 msgid "Pam" 3370 msgstr "am" 3371 3372 #: kdecore/kcalendarsystemcoptic.cpp:235 3373 #, fuzzy, kde-format 3374 msgctxt "Coptic month 9 - KLocale::ShortName" 3375 msgid "Pas" 3376 msgstr "Siden" 3377 3378 #: kdecore/kcalendarsystemcoptic.cpp:237 3379 #, fuzzy, kde-format 3380 msgctxt "Coptic month 10 - KLocale::ShortName" 3381 msgid "Pan" 3382 msgstr "jan" 3383 3384 #: kdecore/kcalendarsystemcoptic.cpp:239 3385 #, fuzzy, kde-format 3386 msgctxt "Coptic month 11 - KLocale::ShortName" 3387 msgid "Epe" 3388 msgstr "Utbrekke" 3389 3390 #: kdecore/kcalendarsystemcoptic.cpp:241 3391 #, fuzzy, kde-format 3392 msgctxt "Coptic month 12 - KLocale::ShortName" 3393 msgid "Meo" 3394 msgstr "mo" 3395 3396 #: kdecore/kcalendarsystemcoptic.cpp:243 3397 #, fuzzy, kde-format 3398 msgctxt "Coptic month 12 - KLocale::ShortName" 3399 msgid "Kou" 3400 msgstr "Kho" 3401 3402 #: kdecore/kcalendarsystemcoptic.cpp:252 3403 #, fuzzy, kde-format 3404 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3405 msgid "of Thoout" 3406 msgstr "fan Kho" 3407 3408 #: kdecore/kcalendarsystemcoptic.cpp:254 3409 #, fuzzy, kde-format 3410 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3411 msgid "of Paope" 3412 msgstr "fan Tamuz" 3413 3414 #: kdecore/kcalendarsystemcoptic.cpp:256 3415 #, fuzzy, kde-format 3416 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3417 msgid "of Hathor" 3418 msgstr "of Hijjah" 3419 3420 #: kdecore/kcalendarsystemcoptic.cpp:258 3421 #, fuzzy, kde-format 3422 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3423 msgid "of Kiahk" 3424 msgstr "fan Kho" 3425 3426 #: kdecore/kcalendarsystemcoptic.cpp:260 3427 #, fuzzy, kde-format 3428 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3429 msgid "of Tobe" 3430 msgstr "fan oktober" 3431 3432 #: kdecore/kcalendarsystemcoptic.cpp:262 3433 #, fuzzy, kde-format 3434 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3435 msgid "of Meshir" 3436 msgstr "fan Mehr" 3437 3438 #: kdecore/kcalendarsystemcoptic.cpp:264 3439 #, fuzzy, kde-format 3440 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3441 msgid "of Paremhotep" 3442 msgstr "Parameter" 3443 3444 #: kdecore/kcalendarsystemcoptic.cpp:266 3445 #, fuzzy, kde-format 3446 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3447 msgid "of Parmoute" 3448 msgstr "fan Tamuz" 3449 3450 #: kdecore/kcalendarsystemcoptic.cpp:268 3451 #, fuzzy, kde-format 3452 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3453 msgid "of Pashons" 3454 msgstr "fan Bah" 3455 3456 #: kdecore/kcalendarsystemcoptic.cpp:270 3457 #, fuzzy, kde-format 3458 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3459 msgid "of Paone" 3460 msgstr "fan jan" 3461 3462 #: kdecore/kcalendarsystemcoptic.cpp:272 3463 #, fuzzy, kde-format 3464 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3465 msgid "of Epep" 3466 msgstr "fan sep" 3467 3468 #: kdecore/kcalendarsystemcoptic.cpp:274 3469 #, fuzzy, kde-format 3470 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3471 msgid "of Mesore" 3472 msgstr "fan Mor" 3473 3474 #: kdecore/kcalendarsystemcoptic.cpp:276 3475 #, fuzzy, kde-format 3476 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3477 msgid "of Kouji nabot" 3478 msgstr "fan feb" 3479 3480 #: kdecore/kcalendarsystemcoptic.cpp:285 3481 #, fuzzy, kde-format 3482 msgctxt "Coptic month 1 - KLocale::LongName" 3483 msgid "Thoout" 3484 msgstr "to" 3485 3486 #: kdecore/kcalendarsystemcoptic.cpp:287 3487 #, fuzzy, kde-format 3488 msgctxt "Coptic month 2 - KLocale::LongName" 3489 msgid "Paope" 3490 msgstr "Eigenskip" 3491 3492 #: kdecore/kcalendarsystemcoptic.cpp:289 3493 #, fuzzy, kde-format 3494 msgctxt "Coptic month 3 - KLocale::LongName" 3495 msgid "Hathor" 3496 msgstr "Skriuwer" 3497 3498 #: kdecore/kcalendarsystemcoptic.cpp:291 3499 #, fuzzy, kde-format 3500 msgctxt "Coptic month 4 - KLocale::LongName" 3501 msgid "Kiahk" 3502 msgstr "fan Kho" 3503 3504 #: kdecore/kcalendarsystemcoptic.cpp:293 3505 #, fuzzy, kde-format 3506 msgctxt "Coptic month 5 - KLocale::LongName" 3507 msgid "Tobe" 3508 msgstr "Taak" 3509 3510 #: kdecore/kcalendarsystemcoptic.cpp:295 3511 #, fuzzy, kde-format 3512 msgctxt "Coptic month 6 - KLocale::LongName" 3513 msgid "Meshir" 3514 msgstr "Mehr" 3515 3516 #: kdecore/kcalendarsystemcoptic.cpp:297 3517 #, fuzzy, kde-format 3518 msgctxt "Coptic month 7 - KLocale::LongName" 3519 msgid "Paremhotep" 3520 msgstr "Parameter" 3521 3522 #: kdecore/kcalendarsystemcoptic.cpp:299 3523 #, fuzzy, kde-format 3524 msgctxt "Coptic month 8 - KLocale::LongName" 3525 msgid "Parmoute" 3526 msgstr "Parameter" 3527 3528 #: kdecore/kcalendarsystemcoptic.cpp:301 3529 #, fuzzy, kde-format 3530 msgctxt "Coptic month 9 - KLocale::LongName" 3531 msgid "Pashons" 3532 msgstr "Skoftsje" 3533 3534 #: kdecore/kcalendarsystemcoptic.cpp:303 3535 #, fuzzy, kde-format 3536 msgctxt "Coptic month 10 - KLocale::LongName" 3537 msgid "Paone" 3538 msgstr "Gjint" 3539 3540 #: kdecore/kcalendarsystemcoptic.cpp:305 3541 #, fuzzy, kde-format 3542 msgctxt "Coptic month 11 - KLocale::LongName" 3543 msgid "Epep" 3544 msgstr "Utbrekke" 3545 3546 #: kdecore/kcalendarsystemcoptic.cpp:307 3547 #, fuzzy, kde-format 3548 msgctxt "Coptic month 12 - KLocale::LongName" 3549 msgid "Mesore" 3550 msgstr "He&rstelle" 3551 3552 #: kdecore/kcalendarsystemcoptic.cpp:309 3553 #, fuzzy, kde-format 3554 msgctxt "Coptic month 12 - KLocale::LongName" 3555 msgid "Kouji nabot" 3556 msgstr "fan feb" 3557 3558 #: kdecore/kcalendarsystemcoptic.cpp:324 3559 #, kde-format 3560 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3561 msgid "P" 3562 msgstr "" 3563 3564 #: kdecore/kcalendarsystemcoptic.cpp:326 3565 #, kde-format 3566 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3567 msgid "P" 3568 msgstr "" 3569 3570 #: kdecore/kcalendarsystemcoptic.cpp:328 3571 #, kde-format 3572 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3573 msgid "P" 3574 msgstr "" 3575 3576 #: kdecore/kcalendarsystemcoptic.cpp:330 3577 #, kde-format 3578 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3579 msgid "P" 3580 msgstr "" 3581 3582 #: kdecore/kcalendarsystemcoptic.cpp:332 3583 #, kde-format 3584 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3585 msgid "P" 3586 msgstr "" 3587 3588 #: kdecore/kcalendarsystemcoptic.cpp:334 3589 #, kde-format 3590 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3591 msgid "P" 3592 msgstr "" 3593 3594 #: kdecore/kcalendarsystemcoptic.cpp:336 3595 #, kde-format 3596 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3597 msgid "T" 3598 msgstr "" 3599 3600 #: kdecore/kcalendarsystemcoptic.cpp:345 3601 #, fuzzy, kde-format 3602 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3603 msgid "Pes" 3604 msgstr "Siden" 3605 3606 #: kdecore/kcalendarsystemcoptic.cpp:347 3607 #, fuzzy, kde-format 3608 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3609 msgid "Psh" 3610 msgstr "Skoftsje" 3611 3612 #: kdecore/kcalendarsystemcoptic.cpp:349 3613 #, fuzzy, kde-format 3614 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3615 msgid "Pef" 3616 msgstr "Siden" 3617 3618 #: kdecore/kcalendarsystemcoptic.cpp:351 3619 #, kde-format 3620 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3621 msgid "Pti" 3622 msgstr "" 3623 3624 #: kdecore/kcalendarsystemcoptic.cpp:353 3625 #, fuzzy, kde-format 3626 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3627 msgid "Pso" 3628 msgstr "Skoftsje" 3629 3630 #: kdecore/kcalendarsystemcoptic.cpp:355 3631 #, fuzzy, kde-format 3632 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3633 msgid "Psa" 3634 msgstr "Skoftsje" 3635 3636 #: kdecore/kcalendarsystemcoptic.cpp:357 3637 #, kde-format 3638 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3639 msgid "Tky" 3640 msgstr "" 3641 3642 #: kdecore/kcalendarsystemcoptic.cpp:365 3643 #, fuzzy, kde-format 3644 msgctxt "Coptic weekday 1 - KLocale::LongName" 3645 msgid "Pesnau" 3646 msgstr "Skoftsje" 3647 3648 #: kdecore/kcalendarsystemcoptic.cpp:367 3649 #, fuzzy, kde-format 3650 msgctxt "Coptic weekday 2 - KLocale::LongName" 3651 msgid "Pshoment" 3652 msgstr "Taljochting" 3653 3654 #: kdecore/kcalendarsystemcoptic.cpp:369 3655 #, kde-format 3656 msgctxt "Coptic weekday 3 - KLocale::LongName" 3657 msgid "Peftoou" 3658 msgstr "" 3659 3660 #: kdecore/kcalendarsystemcoptic.cpp:371 3661 #, kde-format 3662 msgctxt "Coptic weekday 4 - KLocale::LongName" 3663 msgid "Ptiou" 3664 msgstr "" 3665 3666 #: kdecore/kcalendarsystemcoptic.cpp:373 3667 #, fuzzy, kde-format 3668 msgctxt "Coptic weekday 5 - KLocale::LongName" 3669 msgid "Psoou" 3670 msgstr "Skoftsje" 3671 3672 #: kdecore/kcalendarsystemcoptic.cpp:375 3673 #, kde-format 3674 msgctxt "Coptic weekday 6 - KLocale::LongName" 3675 msgid "Psabbaton" 3676 msgstr "" 3677 3678 #: kdecore/kcalendarsystemcoptic.cpp:377 3679 #, kde-format 3680 msgctxt "Coptic weekday 7 - KLocale::LongName" 3681 msgid "Tkyriakē" 3682 msgstr "" 3683 3684 #: kdecore/kcalendarsystemethiopian.cpp:50 3685 #, kde-format 3686 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3687 msgid "Amata Mehrat" 3688 msgstr "" 3689 3690 #: kdecore/kcalendarsystemethiopian.cpp:51 3691 #, kde-format 3692 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3693 msgid "AM" 3694 msgstr "" 3695 3696 #: kdecore/kcalendarsystemethiopian.cpp:52 3697 #, kde-format 3698 msgctxt "" 3699 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3700 msgid "%Ey %EC" 3701 msgstr "" 3702 3703 #: kdecore/kcalendarsystemethiopian.cpp:66 3704 #, kde-format 3705 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3706 msgid "M" 3707 msgstr "" 3708 3709 #: kdecore/kcalendarsystemethiopian.cpp:68 3710 #, kde-format 3711 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3712 msgid "T" 3713 msgstr "" 3714 3715 #: kdecore/kcalendarsystemethiopian.cpp:70 3716 #, kde-format 3717 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3718 msgid "H" 3719 msgstr "" 3720 3721 #: kdecore/kcalendarsystemethiopian.cpp:72 3722 #, kde-format 3723 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3724 msgid "T" 3725 msgstr "" 3726 3727 #: kdecore/kcalendarsystemethiopian.cpp:74 3728 #, kde-format 3729 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3730 msgid "T" 3731 msgstr "" 3732 3733 #: kdecore/kcalendarsystemethiopian.cpp:76 3734 #, kde-format 3735 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3736 msgid "Y" 3737 msgstr "" 3738 3739 #: kdecore/kcalendarsystemethiopian.cpp:78 3740 #, kde-format 3741 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3742 msgid "M" 3743 msgstr "" 3744 3745 #: kdecore/kcalendarsystemethiopian.cpp:80 3746 #, kde-format 3747 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3748 msgid "M" 3749 msgstr "" 3750 3751 #: kdecore/kcalendarsystemethiopian.cpp:82 3752 #, kde-format 3753 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3754 msgid "G" 3755 msgstr "" 3756 3757 #: kdecore/kcalendarsystemethiopian.cpp:84 3758 #, kde-format 3759 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3760 msgid "S" 3761 msgstr "" 3762 3763 #: kdecore/kcalendarsystemethiopian.cpp:86 3764 #, kde-format 3765 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3766 msgid "H" 3767 msgstr "" 3768 3769 #: kdecore/kcalendarsystemethiopian.cpp:88 3770 #, kde-format 3771 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3772 msgid "N" 3773 msgstr "" 3774 3775 #: kdecore/kcalendarsystemethiopian.cpp:90 3776 #, kde-format 3777 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3778 msgid "P" 3779 msgstr "" 3780 3781 #: kdecore/kcalendarsystemethiopian.cpp:99 3782 #, fuzzy, kde-format 3783 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3784 msgid "of Mes" 3785 msgstr "fan Meh" 3786 3787 #: kdecore/kcalendarsystemethiopian.cpp:101 3788 #, fuzzy, kde-format 3789 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3790 msgid "of Teq" 3791 msgstr "fan Tevet" 3792 3793 #: kdecore/kcalendarsystemethiopian.cpp:103 3794 #, fuzzy, kde-format 3795 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3796 msgid "of Hed" 3797 msgstr "fan feb" 3798 3799 #: kdecore/kcalendarsystemethiopian.cpp:105 3800 #, fuzzy, kde-format 3801 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3802 msgid "of Tah" 3803 msgstr "fan Bah" 3804 3805 #: kdecore/kcalendarsystemethiopian.cpp:107 3806 #, fuzzy, kde-format 3807 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3808 msgid "of Ter" 3809 msgstr "fan Tir" 3810 3811 #: kdecore/kcalendarsystemethiopian.cpp:109 3812 #, fuzzy, kde-format 3813 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3814 msgid "of Yak" 3815 msgstr "fan jan" 3816 3817 #: kdecore/kcalendarsystemethiopian.cpp:111 3818 #, fuzzy, kde-format 3819 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3820 msgid "of Mag" 3821 msgstr "fan mrt" 3822 3823 #: kdecore/kcalendarsystemethiopian.cpp:113 3824 #, fuzzy, kde-format 3825 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3826 msgid "of Miy" 3827 msgstr "fan mai" 3828 3829 #: kdecore/kcalendarsystemethiopian.cpp:115 3830 #, fuzzy, kde-format 3831 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3832 msgid "of Gen" 3833 msgstr "fan jan" 3834 3835 #: kdecore/kcalendarsystemethiopian.cpp:117 3836 #, fuzzy, kde-format 3837 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3838 msgid "of Sen" 3839 msgstr "fan sep" 3840 3841 #: kdecore/kcalendarsystemethiopian.cpp:119 3842 #, fuzzy, kde-format 3843 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3844 msgid "of Ham" 3845 msgstr "fan Tamuz" 3846 3847 #: kdecore/kcalendarsystemethiopian.cpp:121 3848 #, fuzzy, kde-format 3849 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3850 msgid "of Neh" 3851 msgstr "fan Meh" 3852 3853 #: kdecore/kcalendarsystemethiopian.cpp:123 3854 #, fuzzy, kde-format 3855 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3856 msgid "of Pag" 3857 msgstr "fan Tamuz" 3858 3859 #: kdecore/kcalendarsystemethiopian.cpp:132 3860 #, fuzzy, kde-format 3861 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3862 msgid "Mes" 3863 msgstr "Ja" 3864 3865 #: kdecore/kcalendarsystemethiopian.cpp:134 3866 #, fuzzy, kde-format 3867 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3868 msgid "Teq" 3869 msgstr "ti" 3870 3871 #: kdecore/kcalendarsystemethiopian.cpp:136 3872 #, fuzzy, kde-format 3873 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3874 msgid "Hed" 3875 msgstr "wo" 3876 3877 #: kdecore/kcalendarsystemethiopian.cpp:138 3878 #, fuzzy, kde-format 3879 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3880 msgid "Tah" 3881 msgstr "Thl" 3882 3883 #: kdecore/kcalendarsystemethiopian.cpp:140 3884 #, fuzzy, kde-format 3885 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3886 msgid "Ter" 3887 msgstr "ti" 3888 3889 #: kdecore/kcalendarsystemethiopian.cpp:142 3890 #, fuzzy, kde-format 3891 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3892 msgid "Yak" 3893 msgstr "fan jan" 3894 3895 #: kdecore/kcalendarsystemethiopian.cpp:144 3896 #, fuzzy, kde-format 3897 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3898 msgid "Mag" 3899 msgstr "mrt" 3900 3901 #: kdecore/kcalendarsystemethiopian.cpp:146 3902 #, fuzzy, kde-format 3903 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3904 msgid "Miy" 3905 msgstr "mai" 3906 3907 #: kdecore/kcalendarsystemethiopian.cpp:148 3908 #, fuzzy, kde-format 3909 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3910 msgid "Gen" 3911 msgstr "Grien:" 3912 3913 #: kdecore/kcalendarsystemethiopian.cpp:150 3914 #, fuzzy, kde-format 3915 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3916 msgid "Sen" 3917 msgstr "Fer&stjoere" 3918 3919 #: kdecore/kcalendarsystemethiopian.cpp:152 3920 #, fuzzy, kde-format 3921 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3922 msgid "Ham" 3923 msgstr "am" 3924 3925 #: kdecore/kcalendarsystemethiopian.cpp:154 3926 #, fuzzy, kde-format 3927 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3928 msgid "Neh" 3929 msgstr "Meh" 3930 3931 #: kdecore/kcalendarsystemethiopian.cpp:156 3932 #, fuzzy, kde-format 3933 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3934 msgid "Pag" 3935 msgstr "Siden" 3936 3937 #: kdecore/kcalendarsystemethiopian.cpp:165 3938 #, fuzzy, kde-format 3939 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3940 msgid "of Meskerem" 3941 msgstr "fan Mehr" 3942 3943 #: kdecore/kcalendarsystemethiopian.cpp:167 3944 #, fuzzy, kde-format 3945 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3946 msgid "of Tequemt" 3947 msgstr "fan Tevet" 3948 3949 #: kdecore/kcalendarsystemethiopian.cpp:169 3950 #, fuzzy, kde-format 3951 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3952 msgid "of Hedar" 3953 msgstr "fan Adar" 3954 3955 #: kdecore/kcalendarsystemethiopian.cpp:171 3956 #, fuzzy, kde-format 3957 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3958 msgid "of Tahsas" 3959 msgstr "fan Bahman" 3960 3961 #: kdecore/kcalendarsystemethiopian.cpp:173 3962 #, fuzzy, kde-format 3963 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3964 msgid "of Ter" 3965 msgstr "fan Tir" 3966 3967 #: kdecore/kcalendarsystemethiopian.cpp:175 3968 #, fuzzy, kde-format 3969 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3970 msgid "of Yakatit" 3971 msgstr "fan Far" 3972 3973 #: kdecore/kcalendarsystemethiopian.cpp:177 3974 #, fuzzy, kde-format 3975 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3976 msgid "of Magabit" 3977 msgstr "of Rajab" 3978 3979 #: kdecore/kcalendarsystemethiopian.cpp:179 3980 #, fuzzy, kde-format 3981 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3982 msgid "of Miyazya" 3983 msgstr "fan mai" 3984 3985 #: kdecore/kcalendarsystemethiopian.cpp:181 3986 #, fuzzy, kde-format 3987 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3988 msgid "of Genbot" 3989 msgstr "fan feb" 3990 3991 #: kdecore/kcalendarsystemethiopian.cpp:183 3992 #, fuzzy, kde-format 3993 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3994 msgid "of Sene" 3995 msgstr "fan sep" 3996 3997 #: kdecore/kcalendarsystemethiopian.cpp:185 3998 #, fuzzy, kde-format 3999 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 4000 msgid "of Hamle" 4001 msgstr "fan Tamuz" 4002 4003 #: kdecore/kcalendarsystemethiopian.cpp:187 4004 #, fuzzy, kde-format 4005 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 4006 msgid "of Nehase" 4007 msgstr "fan Sha" 4008 4009 #: kdecore/kcalendarsystemethiopian.cpp:189 4010 #, fuzzy, kde-format 4011 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 4012 msgid "of Pagumen" 4013 msgstr "fan Tamuz" 4014 4015 #: kdecore/kcalendarsystemethiopian.cpp:198 4016 #, fuzzy, kde-format 4017 msgctxt "Ethiopian month 1 - KLocale::LongName" 4018 msgid "Meskerem" 4019 msgstr "fan Mehr" 4020 4021 #: kdecore/kcalendarsystemethiopian.cpp:200 4022 #, fuzzy, kde-format 4023 msgctxt "Ethiopian month 2 - KLocale::LongName" 4024 msgid "Tequemt" 4025 msgstr "Tevet" 4026 4027 #: kdecore/kcalendarsystemethiopian.cpp:202 4028 #, fuzzy, kde-format 4029 msgctxt "Ethiopian month 3 - KLocale::LongName" 4030 msgid "Hedar" 4031 msgstr "Adar" 4032 4033 #: kdecore/kcalendarsystemethiopian.cpp:204 4034 #, fuzzy, kde-format 4035 msgctxt "Ethiopian month 4 - KLocale::LongName" 4036 msgid "Tahsas" 4037 msgstr "Taak" 4038 4039 #: kdecore/kcalendarsystemethiopian.cpp:206 4040 #, fuzzy, kde-format 4041 msgctxt "Ethiopian month 5 - KLocale::LongName" 4042 msgid "Ter" 4043 msgstr "ti" 4044 4045 #: kdecore/kcalendarsystemethiopian.cpp:208 4046 #, fuzzy, kde-format 4047 msgctxt "Ethiopian month 6 - KLocale::LongName" 4048 msgid "Yakatit" 4049 msgstr "fan Far" 4050 4051 #: kdecore/kcalendarsystemethiopian.cpp:210 4052 #, fuzzy, kde-format 4053 msgctxt "Ethiopian month 7 - KLocale::LongName" 4054 msgid "Magabit" 4055 msgstr "of Rajab" 4056 4057 #: kdecore/kcalendarsystemethiopian.cpp:212 4058 #, fuzzy, kde-format 4059 msgctxt "Ethiopian month 8 - KLocale::LongName" 4060 msgid "Miyazya" 4061 msgstr "fan mai" 4062 4063 #: kdecore/kcalendarsystemethiopian.cpp:214 4064 #, fuzzy, kde-format 4065 msgctxt "Ethiopian month 9 - KLocale::LongName" 4066 msgid "Genbot" 4067 msgstr "fan feb" 4068 4069 #: kdecore/kcalendarsystemethiopian.cpp:216 4070 #, fuzzy, kde-format 4071 msgctxt "Ethiopian month 10 - KLocale::LongName" 4072 msgid "Sene" 4073 msgstr "Fer&stjoere" 4074 4075 #: kdecore/kcalendarsystemethiopian.cpp:218 4076 #, fuzzy, kde-format 4077 msgctxt "Ethiopian month 11 - KLocale::LongName" 4078 msgid "Hamle" 4079 msgstr "Namme" 4080 4081 #: kdecore/kcalendarsystemethiopian.cpp:220 4082 #, fuzzy, kde-format 4083 msgctxt "Ethiopian month 12 - KLocale::LongName" 4084 msgid "Nehase" 4085 msgstr "Namme" 4086 4087 #: kdecore/kcalendarsystemethiopian.cpp:222 4088 #, fuzzy, kde-format 4089 msgctxt "Ethiopian month 13 - KLocale::LongName" 4090 msgid "Pagumen" 4091 msgstr "Siden" 4092 4093 #: kdecore/kcalendarsystemethiopian.cpp:236 4094 #, kde-format 4095 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 4096 msgid "S" 4097 msgstr "" 4098 4099 #: kdecore/kcalendarsystemethiopian.cpp:238 4100 #, kde-format 4101 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 4102 msgid "M" 4103 msgstr "" 4104 4105 #: kdecore/kcalendarsystemethiopian.cpp:240 4106 #, kde-format 4107 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 4108 msgid "R" 4109 msgstr "" 4110 4111 #: kdecore/kcalendarsystemethiopian.cpp:242 4112 #, kde-format 4113 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 4114 msgid "H" 4115 msgstr "" 4116 4117 #: kdecore/kcalendarsystemethiopian.cpp:244 4118 #, fuzzy, kde-format 4119 #| msgid "Av" 4120 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 4121 msgid "A" 4122 msgstr "Av" 4123 4124 #: kdecore/kcalendarsystemethiopian.cpp:246 4125 #, kde-format 4126 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 4127 msgid "Q" 4128 msgstr "" 4129 4130 #: kdecore/kcalendarsystemethiopian.cpp:248 4131 #, kde-format 4132 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 4133 msgid "E" 4134 msgstr "" 4135 4136 #: kdecore/kcalendarsystemethiopian.cpp:257 4137 #, fuzzy, kde-format 4138 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 4139 msgid "Seg" 4140 msgstr "sep" 4141 4142 #: kdecore/kcalendarsystemethiopian.cpp:259 4143 #, fuzzy, kde-format 4144 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 4145 msgid "Mak" 4146 msgstr "mrt" 4147 4148 #: kdecore/kcalendarsystemethiopian.cpp:261 4149 #, fuzzy, kde-format 4150 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 4151 msgid "Rob" 4152 msgstr "Taak" 4153 4154 #: kdecore/kcalendarsystemethiopian.cpp:263 4155 #, fuzzy, kde-format 4156 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 4157 msgid "Ham" 4158 msgstr "am" 4159 4160 #: kdecore/kcalendarsystemethiopian.cpp:265 4161 #, fuzzy, kde-format 4162 #| msgid "Arb" 4163 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 4164 msgid "Arb" 4165 msgstr "Arb" 4166 4167 #: kdecore/kcalendarsystemethiopian.cpp:267 4168 #, fuzzy, kde-format 4169 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 4170 msgid "Qed" 4171 msgstr "wo" 4172 4173 #: kdecore/kcalendarsystemethiopian.cpp:269 4174 #, fuzzy, kde-format 4175 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 4176 msgid "Ehu" 4177 msgstr "to" 4178 4179 #: kdecore/kcalendarsystemethiopian.cpp:276 4180 #, fuzzy, kde-format 4181 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 4182 msgid "Segno" 4183 msgstr "Fer&stjoere" 4184 4185 #: kdecore/kcalendarsystemethiopian.cpp:278 4186 #, fuzzy, kde-format 4187 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 4188 msgid "Maksegno" 4189 msgstr "Fer&stjoere" 4190 4191 #: kdecore/kcalendarsystemethiopian.cpp:280 4192 #, fuzzy, kde-format 4193 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 4194 msgid "Rob" 4195 msgstr "Taak" 4196 4197 #: kdecore/kcalendarsystemethiopian.cpp:282 4198 #, fuzzy, kde-format 4199 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 4200 msgid "Hamus" 4201 msgstr "Skoftsje" 4202 4203 #: kdecore/kcalendarsystemethiopian.cpp:284 4204 #, fuzzy, kde-format 4205 #| msgid "Arb" 4206 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 4207 msgid "Arb" 4208 msgstr "Arb" 4209 4210 #: kdecore/kcalendarsystemethiopian.cpp:286 4211 #, fuzzy, kde-format 4212 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 4213 msgid "Qedame" 4214 msgstr "Namme" 4215 4216 #: kdecore/kcalendarsystemethiopian.cpp:288 4217 #, fuzzy, kde-format 4218 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 4219 msgid "Ehud" 4220 msgstr "to" 4221 4222 #: kdecore/kcalendarsystemgregorian.cpp:53 4223 #, kde-format 4224 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 4225 msgid "Before Common Era" 4226 msgstr "" 4227 4228 #: kdecore/kcalendarsystemgregorian.cpp:54 4229 #, kde-format 4230 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 4231 msgid "BCE" 4232 msgstr "" 4233 4234 #: kdecore/kcalendarsystemgregorian.cpp:56 4235 #, kde-format 4236 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 4237 msgid "Before Christ" 4238 msgstr "" 4239 4240 #: kdecore/kcalendarsystemgregorian.cpp:57 4241 #, kde-format 4242 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 4243 msgid "BC" 4244 msgstr "" 4245 4246 #: kdecore/kcalendarsystemgregorian.cpp:59 4247 #, kde-format 4248 msgctxt "" 4249 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 4250 msgid "%Ey %EC" 4251 msgstr "" 4252 4253 #: kdecore/kcalendarsystemgregorian.cpp:63 4254 #, kde-format 4255 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 4256 msgid "Common Era" 4257 msgstr "" 4258 4259 #: kdecore/kcalendarsystemgregorian.cpp:64 4260 #, kde-format 4261 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 4262 msgid "CE" 4263 msgstr "" 4264 4265 #: kdecore/kcalendarsystemgregorian.cpp:66 4266 #: kdecore/kcalendarsystemjapanese.cpp:57 4267 #, kde-format 4268 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 4269 msgid "Anno Domini" 4270 msgstr "" 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:67 4273 #: kdecore/kcalendarsystemjapanese.cpp:58 4274 #, kde-format 4275 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 4276 msgid "AD" 4277 msgstr "" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:69 4280 #: kdecore/kcalendarsystemjapanese.cpp:59 4281 #, kde-format 4282 msgctxt "" 4283 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 4284 msgid "%Ey %EC" 4285 msgstr "" 4286 4287 #: kdecore/kcalendarsystemgregorian.cpp:138 4288 #, kde-format 4289 msgctxt "Gregorian month 1 - KLocale::NarrowName" 4290 msgid "J" 4291 msgstr "" 4292 4293 #: kdecore/kcalendarsystemgregorian.cpp:140 4294 #, kde-format 4295 msgctxt "Gregorian month 2 - KLocale::NarrowName" 4296 msgid "F" 4297 msgstr "" 4298 4299 #: kdecore/kcalendarsystemgregorian.cpp:142 4300 #, kde-format 4301 msgctxt "Gregorian month 3 - KLocale::NarrowName" 4302 msgid "M" 4303 msgstr "" 4304 4305 #: kdecore/kcalendarsystemgregorian.cpp:144 4306 #, fuzzy, kde-format 4307 #| msgid "Av" 4308 msgctxt "Gregorian month 4 - KLocale::NarrowName" 4309 msgid "A" 4310 msgstr "Av" 4311 4312 #: kdecore/kcalendarsystemgregorian.cpp:146 4313 #, kde-format 4314 msgctxt "Gregorian month 5 - KLocale::NarrowName" 4315 msgid "M" 4316 msgstr "" 4317 4318 #: kdecore/kcalendarsystemgregorian.cpp:148 4319 #, kde-format 4320 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4321 msgid "J" 4322 msgstr "" 4323 4324 #: kdecore/kcalendarsystemgregorian.cpp:150 4325 #, kde-format 4326 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4327 msgid "J" 4328 msgstr "" 4329 4330 #: kdecore/kcalendarsystemgregorian.cpp:152 4331 #, fuzzy, kde-format 4332 #| msgid "Av" 4333 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4334 msgid "A" 4335 msgstr "Av" 4336 4337 #: kdecore/kcalendarsystemgregorian.cpp:154 4338 #, kde-format 4339 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4340 msgid "S" 4341 msgstr "" 4342 4343 #: kdecore/kcalendarsystemgregorian.cpp:156 4344 #, kde-format 4345 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4346 msgid "O" 4347 msgstr "" 4348 4349 #: kdecore/kcalendarsystemgregorian.cpp:158 4350 #, kde-format 4351 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4352 msgid "N" 4353 msgstr "" 4354 4355 #: kdecore/kcalendarsystemgregorian.cpp:160 4356 #, kde-format 4357 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4358 msgid "D" 4359 msgstr "" 4360 4361 #: kdecore/kcalendarsystemgregorian.cpp:169 4362 #, fuzzy, kde-format 4363 #| msgctxt "of January" 4364 #| msgid "of Jan" 4365 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4366 msgid "of Jan" 4367 msgstr "fan jan" 4368 4369 #: kdecore/kcalendarsystemgregorian.cpp:171 4370 #, fuzzy, kde-format 4371 #| msgctxt "of February" 4372 #| msgid "of Feb" 4373 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4374 msgid "of Feb" 4375 msgstr "fan feb" 4376 4377 #: kdecore/kcalendarsystemgregorian.cpp:173 4378 #, fuzzy, kde-format 4379 #| msgctxt "of March" 4380 #| msgid "of Mar" 4381 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4382 msgid "of Mar" 4383 msgstr "fan mrt" 4384 4385 #: kdecore/kcalendarsystemgregorian.cpp:175 4386 #, fuzzy, kde-format 4387 #| msgctxt "of April" 4388 #| msgid "of Apr" 4389 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4390 msgid "of Apr" 4391 msgstr "fan apr" 4392 4393 #: kdecore/kcalendarsystemgregorian.cpp:177 4394 #, fuzzy, kde-format 4395 #| msgctxt "of May short" 4396 #| msgid "of May" 4397 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4398 msgid "of May" 4399 msgstr "fan mai" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:179 4402 #, fuzzy, kde-format 4403 #| msgctxt "of June" 4404 #| msgid "of Jun" 4405 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4406 msgid "of Jun" 4407 msgstr "fan jun" 4408 4409 #: kdecore/kcalendarsystemgregorian.cpp:181 4410 #, fuzzy, kde-format 4411 #| msgctxt "of July" 4412 #| msgid "of Jul" 4413 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4414 msgid "of Jul" 4415 msgstr "fan jul" 4416 4417 #: kdecore/kcalendarsystemgregorian.cpp:183 4418 #, fuzzy, kde-format 4419 #| msgctxt "of August" 4420 #| msgid "of Aug" 4421 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4422 msgid "of Aug" 4423 msgstr "fan aug" 4424 4425 #: kdecore/kcalendarsystemgregorian.cpp:185 4426 #, fuzzy, kde-format 4427 #| msgctxt "of September" 4428 #| msgid "of Sep" 4429 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4430 msgid "of Sep" 4431 msgstr "fan sep" 4432 4433 #: kdecore/kcalendarsystemgregorian.cpp:187 4434 #, fuzzy, kde-format 4435 #| msgctxt "of October" 4436 #| msgid "of Oct" 4437 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4438 msgid "of Oct" 4439 msgstr "fan okt" 4440 4441 #: kdecore/kcalendarsystemgregorian.cpp:189 4442 #, fuzzy, kde-format 4443 #| msgctxt "of November" 4444 #| msgid "of Nov" 4445 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4446 msgid "of Nov" 4447 msgstr "fan nov" 4448 4449 #: kdecore/kcalendarsystemgregorian.cpp:191 4450 #, fuzzy, kde-format 4451 #| msgctxt "of December" 4452 #| msgid "of Dec" 4453 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4454 msgid "of Dec" 4455 msgstr "fan des" 4456 4457 #: kdecore/kcalendarsystemgregorian.cpp:200 4458 #, fuzzy, kde-format 4459 #| msgctxt "January" 4460 #| msgid "Jan" 4461 msgctxt "Gregorian month 1 - KLocale::ShortName" 4462 msgid "Jan" 4463 msgstr "jan" 4464 4465 #: kdecore/kcalendarsystemgregorian.cpp:202 4466 #, fuzzy, kde-format 4467 #| msgctxt "February" 4468 #| msgid "Feb" 4469 msgctxt "Gregorian month 2 - KLocale::ShortName" 4470 msgid "Feb" 4471 msgstr "feb" 4472 4473 #: kdecore/kcalendarsystemgregorian.cpp:204 4474 #, fuzzy, kde-format 4475 #| msgctxt "March" 4476 #| msgid "Mar" 4477 msgctxt "Gregorian month 3 - KLocale::ShortName" 4478 msgid "Mar" 4479 msgstr "mrt" 4480 4481 #: kdecore/kcalendarsystemgregorian.cpp:206 4482 #, fuzzy, kde-format 4483 #| msgctxt "April" 4484 #| msgid "Apr" 4485 msgctxt "Gregorian month 4 - KLocale::ShortName" 4486 msgid "Apr" 4487 msgstr "apr" 4488 4489 #: kdecore/kcalendarsystemgregorian.cpp:208 4490 #, fuzzy, kde-format 4491 #| msgctxt "May short" 4492 #| msgid "May" 4493 msgctxt "Gregorian month 5 - KLocale::ShortName" 4494 msgid "May" 4495 msgstr "mai" 4496 4497 #: kdecore/kcalendarsystemgregorian.cpp:210 4498 #, fuzzy, kde-format 4499 #| msgctxt "June" 4500 #| msgid "Jun" 4501 msgctxt "Gregorian month 6 - KLocale::ShortName" 4502 msgid "Jun" 4503 msgstr "jun" 4504 4505 #: kdecore/kcalendarsystemgregorian.cpp:212 4506 #, fuzzy, kde-format 4507 #| msgctxt "July" 4508 #| msgid "Jul" 4509 msgctxt "Gregorian month 7 - KLocale::ShortName" 4510 msgid "Jul" 4511 msgstr "jul" 4512 4513 #: kdecore/kcalendarsystemgregorian.cpp:214 4514 #, fuzzy, kde-format 4515 #| msgctxt "August" 4516 #| msgid "Aug" 4517 msgctxt "Gregorian month 8 - KLocale::ShortName" 4518 msgid "Aug" 4519 msgstr "aug" 4520 4521 #: kdecore/kcalendarsystemgregorian.cpp:216 4522 #, fuzzy, kde-format 4523 #| msgctxt "September" 4524 #| msgid "Sep" 4525 msgctxt "Gregorian month 9 - KLocale::ShortName" 4526 msgid "Sep" 4527 msgstr "sep" 4528 4529 #: kdecore/kcalendarsystemgregorian.cpp:218 4530 #, fuzzy, kde-format 4531 #| msgctxt "October" 4532 #| msgid "Oct" 4533 msgctxt "Gregorian month 10 - KLocale::ShortName" 4534 msgid "Oct" 4535 msgstr "okt" 4536 4537 #: kdecore/kcalendarsystemgregorian.cpp:220 4538 #, fuzzy, kde-format 4539 #| msgctxt "November" 4540 #| msgid "Nov" 4541 msgctxt "Gregorian month 11 - KLocale::ShortName" 4542 msgid "Nov" 4543 msgstr "nov" 4544 4545 #: kdecore/kcalendarsystemgregorian.cpp:222 4546 #, fuzzy, kde-format 4547 #| msgctxt "December" 4548 #| msgid "Dec" 4549 msgctxt "Gregorian month 12 - KLocale::ShortName" 4550 msgid "Dec" 4551 msgstr "des" 4552 4553 #: kdecore/kcalendarsystemgregorian.cpp:231 4554 #, fuzzy, kde-format 4555 #| msgid "of January" 4556 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4557 msgid "of January" 4558 msgstr "fan jannewaris" 4559 4560 #: kdecore/kcalendarsystemgregorian.cpp:233 4561 #, fuzzy, kde-format 4562 #| msgid "of February" 4563 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4564 msgid "of February" 4565 msgstr "fan febrewaris" 4566 4567 #: kdecore/kcalendarsystemgregorian.cpp:235 4568 #, fuzzy, kde-format 4569 #| msgid "of March" 4570 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4571 msgid "of March" 4572 msgstr "fan maart" 4573 4574 #: kdecore/kcalendarsystemgregorian.cpp:237 4575 #, fuzzy, kde-format 4576 #| msgid "of April" 4577 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4578 msgid "of April" 4579 msgstr "fan april" 4580 4581 #: kdecore/kcalendarsystemgregorian.cpp:239 4582 #, fuzzy, kde-format 4583 #| msgctxt "of May short" 4584 #| msgid "of May" 4585 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4586 msgid "of May" 4587 msgstr "fan mai" 4588 4589 #: kdecore/kcalendarsystemgregorian.cpp:241 4590 #, fuzzy, kde-format 4591 #| msgid "of June" 4592 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4593 msgid "of June" 4594 msgstr "fan juny" 4595 4596 #: kdecore/kcalendarsystemgregorian.cpp:243 4597 #, fuzzy, kde-format 4598 #| msgid "of July" 4599 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4600 msgid "of July" 4601 msgstr "fan july" 4602 4603 #: kdecore/kcalendarsystemgregorian.cpp:245 4604 #, fuzzy, kde-format 4605 #| msgid "of August" 4606 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4607 msgid "of August" 4608 msgstr "fan augustus" 4609 4610 #: kdecore/kcalendarsystemgregorian.cpp:247 4611 #, fuzzy, kde-format 4612 #| msgid "of September" 4613 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4614 msgid "of September" 4615 msgstr "fan septimber" 4616 4617 #: kdecore/kcalendarsystemgregorian.cpp:249 4618 #, fuzzy, kde-format 4619 #| msgid "of October" 4620 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4621 msgid "of October" 4622 msgstr "fan oktober" 4623 4624 #: kdecore/kcalendarsystemgregorian.cpp:251 4625 #, fuzzy, kde-format 4626 #| msgid "of November" 4627 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4628 msgid "of November" 4629 msgstr "fan novimber" 4630 4631 #: kdecore/kcalendarsystemgregorian.cpp:253 4632 #, fuzzy, kde-format 4633 #| msgid "of December" 4634 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4635 msgid "of December" 4636 msgstr "fan desimber" 4637 4638 #: kdecore/kcalendarsystemgregorian.cpp:262 4639 #, fuzzy, kde-format 4640 #| msgid "January" 4641 msgctxt "Gregorian month 1 - KLocale::LongName" 4642 msgid "January" 4643 msgstr "Jannewaris" 4644 4645 #: kdecore/kcalendarsystemgregorian.cpp:264 4646 #, fuzzy, kde-format 4647 #| msgid "February" 4648 msgctxt "Gregorian month 2 - KLocale::LongName" 4649 msgid "February" 4650 msgstr "Febrewaris" 4651 4652 #: kdecore/kcalendarsystemgregorian.cpp:266 4653 #, fuzzy, kde-format 4654 #| msgctxt "March long" 4655 #| msgid "March" 4656 msgctxt "Gregorian month 3 - KLocale::LongName" 4657 msgid "March" 4658 msgstr "Maart" 4659 4660 #: kdecore/kcalendarsystemgregorian.cpp:268 4661 #, fuzzy, kde-format 4662 #| msgid "April" 4663 msgctxt "Gregorian month 4 - KLocale::LongName" 4664 msgid "April" 4665 msgstr "April" 4666 4667 #: kdecore/kcalendarsystemgregorian.cpp:270 4668 #, fuzzy, kde-format 4669 #| msgctxt "May short" 4670 #| msgid "May" 4671 msgctxt "Gregorian month 5 - KLocale::LongName" 4672 msgid "May" 4673 msgstr "mai" 4674 4675 #: kdecore/kcalendarsystemgregorian.cpp:272 4676 #, fuzzy, kde-format 4677 #| msgid "June" 4678 msgctxt "Gregorian month 6 - KLocale::LongName" 4679 msgid "June" 4680 msgstr "Juny" 4681 4682 #: kdecore/kcalendarsystemgregorian.cpp:274 4683 #, fuzzy, kde-format 4684 #| msgid "July" 4685 msgctxt "Gregorian month 7 - KLocale::LongName" 4686 msgid "July" 4687 msgstr "July" 4688 4689 #: kdecore/kcalendarsystemgregorian.cpp:276 4690 #, fuzzy, kde-format 4691 #| msgctxt "August long" 4692 #| msgid "August" 4693 msgctxt "Gregorian month 8 - KLocale::LongName" 4694 msgid "August" 4695 msgstr "Augustus" 4696 4697 #: kdecore/kcalendarsystemgregorian.cpp:278 4698 #, fuzzy, kde-format 4699 #| msgid "September" 4700 msgctxt "Gregorian month 9 - KLocale::LongName" 4701 msgid "September" 4702 msgstr "Septimber" 4703 4704 #: kdecore/kcalendarsystemgregorian.cpp:280 4705 #, fuzzy, kde-format 4706 #| msgid "October" 4707 msgctxt "Gregorian month 10 - KLocale::LongName" 4708 msgid "October" 4709 msgstr "Oktober" 4710 4711 #: kdecore/kcalendarsystemgregorian.cpp:282 4712 #, fuzzy, kde-format 4713 #| msgid "November" 4714 msgctxt "Gregorian month 11 - KLocale::LongName" 4715 msgid "November" 4716 msgstr "Novimber" 4717 4718 #: kdecore/kcalendarsystemgregorian.cpp:284 4719 #, fuzzy, kde-format 4720 #| msgid "December" 4721 msgctxt "Gregorian month 12 - KLocale::LongName" 4722 msgid "December" 4723 msgstr "Desimber" 4724 4725 #: kdecore/kcalendarsystemgregorian.cpp:297 4726 #: kdecore/kcalendarsystemhebrew.cpp:807 4727 #, kde-format 4728 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4729 msgid "M" 4730 msgstr "" 4731 4732 #: kdecore/kcalendarsystemgregorian.cpp:299 4733 #: kdecore/kcalendarsystemhebrew.cpp:809 4734 #, kde-format 4735 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4736 msgid "T" 4737 msgstr "" 4738 4739 #: kdecore/kcalendarsystemgregorian.cpp:301 4740 #: kdecore/kcalendarsystemhebrew.cpp:811 4741 #, kde-format 4742 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4743 msgid "W" 4744 msgstr "" 4745 4746 #: kdecore/kcalendarsystemgregorian.cpp:303 4747 #: kdecore/kcalendarsystemhebrew.cpp:813 4748 #, kde-format 4749 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4750 msgid "T" 4751 msgstr "" 4752 4753 #: kdecore/kcalendarsystemgregorian.cpp:305 4754 #: kdecore/kcalendarsystemhebrew.cpp:815 4755 #, kde-format 4756 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4757 msgid "F" 4758 msgstr "" 4759 4760 #: kdecore/kcalendarsystemgregorian.cpp:307 4761 #: kdecore/kcalendarsystemhebrew.cpp:817 4762 #, kde-format 4763 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4764 msgid "S" 4765 msgstr "" 4766 4767 #: kdecore/kcalendarsystemgregorian.cpp:309 4768 #: kdecore/kcalendarsystemhebrew.cpp:819 4769 #, kde-format 4770 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4771 msgid "S" 4772 msgstr "" 4773 4774 #: kdecore/kcalendarsystemgregorian.cpp:318 4775 #: kdecore/kcalendarsystemhebrew.cpp:828 4776 #, fuzzy, kde-format 4777 #| msgctxt "Monday" 4778 #| msgid "Mon" 4779 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4780 msgid "Mon" 4781 msgstr "mo" 4782 4783 #: kdecore/kcalendarsystemgregorian.cpp:320 4784 #: kdecore/kcalendarsystemhebrew.cpp:830 4785 #, fuzzy, kde-format 4786 #| msgctxt "Tuesday" 4787 #| msgid "Tue" 4788 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4789 msgid "Tue" 4790 msgstr "ti" 4791 4792 #: kdecore/kcalendarsystemgregorian.cpp:322 4793 #: kdecore/kcalendarsystemhebrew.cpp:832 4794 #, fuzzy, kde-format 4795 #| msgctxt "Wednesday" 4796 #| msgid "Wed" 4797 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4798 msgid "Wed" 4799 msgstr "wo" 4800 4801 #: kdecore/kcalendarsystemgregorian.cpp:324 4802 #: kdecore/kcalendarsystemhebrew.cpp:834 4803 #, fuzzy, kde-format 4804 #| msgctxt "Thursday" 4805 #| msgid "Thu" 4806 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4807 msgid "Thu" 4808 msgstr "to" 4809 4810 #: kdecore/kcalendarsystemgregorian.cpp:326 4811 #: kdecore/kcalendarsystemhebrew.cpp:836 4812 #, fuzzy, kde-format 4813 #| msgctxt "Friday" 4814 #| msgid "Fri" 4815 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4816 msgid "Fri" 4817 msgstr "fr" 4818 4819 #: kdecore/kcalendarsystemgregorian.cpp:328 4820 #: kdecore/kcalendarsystemhebrew.cpp:838 4821 #, fuzzy, kde-format 4822 #| msgctxt "Saturday" 4823 #| msgid "Sat" 4824 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4825 msgid "Sat" 4826 msgstr "sno" 4827 4828 #: kdecore/kcalendarsystemgregorian.cpp:330 4829 #: kdecore/kcalendarsystemhebrew.cpp:840 4830 #, fuzzy, kde-format 4831 #| msgctxt "Sunday" 4832 #| msgid "Sun" 4833 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4834 msgid "Sun" 4835 msgstr "sne" 4836 4837 #: kdecore/kcalendarsystemgregorian.cpp:337 4838 #: kdecore/kcalendarsystemhebrew.cpp:847 4839 #, fuzzy, kde-format 4840 #| msgid "Monday" 4841 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4842 msgid "Monday" 4843 msgstr "moandei" 4844 4845 #: kdecore/kcalendarsystemgregorian.cpp:339 4846 #: kdecore/kcalendarsystemhebrew.cpp:849 4847 #, fuzzy, kde-format 4848 #| msgid "Tuesday" 4849 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4850 msgid "Tuesday" 4851 msgstr "tiisdei" 4852 4853 #: kdecore/kcalendarsystemgregorian.cpp:341 4854 #: kdecore/kcalendarsystemhebrew.cpp:851 4855 #, fuzzy, kde-format 4856 #| msgid "Wednesday" 4857 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4858 msgid "Wednesday" 4859 msgstr "woansdei" 4860 4861 #: kdecore/kcalendarsystemgregorian.cpp:343 4862 #: kdecore/kcalendarsystemhebrew.cpp:853 4863 #, fuzzy, kde-format 4864 #| msgid "Thursday" 4865 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4866 msgid "Thursday" 4867 msgstr "tongersdei" 4868 4869 #: kdecore/kcalendarsystemgregorian.cpp:345 4870 #: kdecore/kcalendarsystemhebrew.cpp:855 4871 #, fuzzy, kde-format 4872 #| msgid "Friday" 4873 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4874 msgid "Friday" 4875 msgstr "freed" 4876 4877 #: kdecore/kcalendarsystemgregorian.cpp:347 4878 #: kdecore/kcalendarsystemhebrew.cpp:857 4879 #, fuzzy, kde-format 4880 #| msgid "Saturday" 4881 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4882 msgid "Saturday" 4883 msgstr "sneon" 4884 4885 #: kdecore/kcalendarsystemgregorian.cpp:349 4886 #: kdecore/kcalendarsystemhebrew.cpp:859 4887 #, fuzzy, kde-format 4888 #| msgid "Sunday" 4889 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4890 msgid "Sunday" 4891 msgstr "snein" 4892 4893 #: kdecore/kcalendarsystemhebrew.cpp:281 4894 #, kde-format 4895 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4896 msgid "Anno Mundi" 4897 msgstr "" 4898 4899 #: kdecore/kcalendarsystemhebrew.cpp:282 4900 #, kde-format 4901 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4902 msgid "AM" 4903 msgstr "" 4904 4905 #: kdecore/kcalendarsystemhebrew.cpp:283 4906 #, kde-format 4907 msgctxt "" 4908 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4909 msgid "%Ey %EC" 4910 msgstr "" 4911 4912 #: kdecore/kcalendarsystemhebrew.cpp:625 4913 #, kde-format 4914 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4915 msgid "T" 4916 msgstr "" 4917 4918 #: kdecore/kcalendarsystemhebrew.cpp:627 4919 #, kde-format 4920 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4921 msgid "H" 4922 msgstr "" 4923 4924 #: kdecore/kcalendarsystemhebrew.cpp:629 4925 #, kde-format 4926 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4927 msgid "K" 4928 msgstr "" 4929 4930 #: kdecore/kcalendarsystemhebrew.cpp:631 4931 #, kde-format 4932 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4933 msgid "T" 4934 msgstr "" 4935 4936 #: kdecore/kcalendarsystemhebrew.cpp:633 4937 #, kde-format 4938 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4939 msgid "S" 4940 msgstr "" 4941 4942 #: kdecore/kcalendarsystemhebrew.cpp:635 4943 #, fuzzy, kde-format 4944 #| msgid "Av" 4945 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4946 msgid "A" 4947 msgstr "Av" 4948 4949 #: kdecore/kcalendarsystemhebrew.cpp:637 4950 #, kde-format 4951 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4952 msgid "N" 4953 msgstr "" 4954 4955 #: kdecore/kcalendarsystemhebrew.cpp:639 4956 #, kde-format 4957 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4958 msgid "I" 4959 msgstr "" 4960 4961 #: kdecore/kcalendarsystemhebrew.cpp:641 4962 #, kde-format 4963 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4964 msgid "S" 4965 msgstr "" 4966 4967 #: kdecore/kcalendarsystemhebrew.cpp:643 4968 #, kde-format 4969 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4970 msgid "T" 4971 msgstr "" 4972 4973 #: kdecore/kcalendarsystemhebrew.cpp:645 4974 #, fuzzy, kde-format 4975 #| msgid "Av" 4976 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4977 msgid "A" 4978 msgstr "Av" 4979 4980 #: kdecore/kcalendarsystemhebrew.cpp:647 4981 #, kde-format 4982 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4983 msgid "E" 4984 msgstr "" 4985 4986 #: kdecore/kcalendarsystemhebrew.cpp:649 4987 #, fuzzy, kde-format 4988 #| msgid "Av" 4989 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4990 msgid "A" 4991 msgstr "Av" 4992 4993 #: kdecore/kcalendarsystemhebrew.cpp:651 4994 #, fuzzy, kde-format 4995 #| msgid "Av" 4996 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4997 msgid "A" 4998 msgstr "Av" 4999 5000 #: kdecore/kcalendarsystemhebrew.cpp:660 5001 #, fuzzy, kde-format 5002 #| msgctxt "of Tir short" 5003 #| msgid "of Tir" 5004 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 5005 msgid "of Tis" 5006 msgstr "fan Tir" 5007 5008 #: kdecore/kcalendarsystemhebrew.cpp:662 5009 #, fuzzy, kde-format 5010 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 5011 msgid "of Hes" 5012 msgstr "fan Meh" 5013 5014 #: kdecore/kcalendarsystemhebrew.cpp:664 5015 #, fuzzy, kde-format 5016 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 5017 msgid "of Kis" 5018 msgstr "fan Nisan" 5019 5020 #: kdecore/kcalendarsystemhebrew.cpp:666 5021 #, fuzzy, kde-format 5022 #| msgid "of Tevet" 5023 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 5024 msgid "of Tev" 5025 msgstr "fan Tevet" 5026 5027 #: kdecore/kcalendarsystemhebrew.cpp:668 5028 #, fuzzy, kde-format 5029 #| msgid "of Shvat" 5030 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 5031 msgid "of Shv" 5032 msgstr "fan Shvat" 5033 5034 #: kdecore/kcalendarsystemhebrew.cpp:670 5035 #, fuzzy, kde-format 5036 #| msgid "of Adar" 5037 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 5038 msgid "of Ada" 5039 msgstr "fan Adar" 5040 5041 #: kdecore/kcalendarsystemhebrew.cpp:672 5042 #, fuzzy, kde-format 5043 #| msgid "of Nisan" 5044 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 5045 msgid "of Nis" 5046 msgstr "fan Nisan" 5047 5048 #: kdecore/kcalendarsystemhebrew.cpp:674 5049 #, fuzzy, kde-format 5050 #| msgid "of Iyar" 5051 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 5052 msgid "of Iya" 5053 msgstr "fan Iyar" 5054 5055 #: kdecore/kcalendarsystemhebrew.cpp:676 5056 #, fuzzy, kde-format 5057 #| msgid "of Sivan" 5058 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 5059 msgid "of Siv" 5060 msgstr "fan Sivan" 5061 5062 #: kdecore/kcalendarsystemhebrew.cpp:678 5063 #, fuzzy, kde-format 5064 #| msgid "of Tamuz" 5065 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 5066 msgid "of Tam" 5067 msgstr "fan Tamuz" 5068 5069 #: kdecore/kcalendarsystemhebrew.cpp:680 5070 #, fuzzy, kde-format 5071 #| msgid "of Av" 5072 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 5073 msgid "of Av" 5074 msgstr "fan Av" 5075 5076 #: kdecore/kcalendarsystemhebrew.cpp:682 5077 #, fuzzy, kde-format 5078 #| msgid "of Elul" 5079 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 5080 msgid "of Elu" 5081 msgstr "fan Elul" 5082 5083 #: kdecore/kcalendarsystemhebrew.cpp:684 5084 #, fuzzy, kde-format 5085 #| msgid "of Adar" 5086 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 5087 msgid "of Ad1" 5088 msgstr "fan Adar" 5089 5090 #: kdecore/kcalendarsystemhebrew.cpp:686 5091 #, fuzzy, kde-format 5092 #| msgid "of Adar" 5093 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 5094 msgid "of Ad2" 5095 msgstr "fan Adar" 5096 5097 #: kdecore/kcalendarsystemhebrew.cpp:695 5098 #, fuzzy, kde-format 5099 #| msgctxt "Tir short" 5100 #| msgid "Tir" 5101 msgctxt "Hebrew month 1 - KLocale::ShortName" 5102 msgid "Tis" 5103 msgstr "Tir" 5104 5105 #: kdecore/kcalendarsystemhebrew.cpp:697 5106 #, fuzzy, kde-format 5107 msgctxt "Hebrew month 2 - KLocale::ShortName" 5108 msgid "Hes" 5109 msgstr "Ja" 5110 5111 #: kdecore/kcalendarsystemhebrew.cpp:699 5112 #, fuzzy, kde-format 5113 #| msgid "Kislev" 5114 msgctxt "Hebrew month 3 - KLocale::ShortName" 5115 msgid "Kis" 5116 msgstr "Kislev" 5117 5118 #: kdecore/kcalendarsystemhebrew.cpp:701 5119 #, fuzzy, kde-format 5120 #| msgid "Tevet" 5121 msgctxt "Hebrew month 4 - KLocale::ShortName" 5122 msgid "Tev" 5123 msgstr "Tevet" 5124 5125 #: kdecore/kcalendarsystemhebrew.cpp:703 5126 #, fuzzy, kde-format 5127 #| msgid "Shvat" 5128 msgctxt "Hebrew month 5 - KLocale::ShortName" 5129 msgid "Shv" 5130 msgstr "Shvat" 5131 5132 #: kdecore/kcalendarsystemhebrew.cpp:705 5133 #, fuzzy, kde-format 5134 #| msgid "Adar" 5135 msgctxt "Hebrew month 6 - KLocale::ShortName" 5136 msgid "Ada" 5137 msgstr "Adar" 5138 5139 #: kdecore/kcalendarsystemhebrew.cpp:707 5140 #, fuzzy, kde-format 5141 #| msgid "Nisan" 5142 msgctxt "Hebrew month 7 - KLocale::ShortName" 5143 msgid "Nis" 5144 msgstr "Nisan" 5145 5146 #: kdecore/kcalendarsystemhebrew.cpp:709 5147 #, fuzzy, kde-format 5148 #| msgid "Iyar" 5149 msgctxt "Hebrew month 8 - KLocale::ShortName" 5150 msgid "Iya" 5151 msgstr "Iyar" 5152 5153 #: kdecore/kcalendarsystemhebrew.cpp:711 5154 #, fuzzy, kde-format 5155 #| msgid "Sivan" 5156 msgctxt "Hebrew month 9 - KLocale::ShortName" 5157 msgid "Siv" 5158 msgstr "Sivan" 5159 5160 #: kdecore/kcalendarsystemhebrew.cpp:713 5161 #, fuzzy, kde-format 5162 #| msgid "Tamuz" 5163 msgctxt "Hebrew month 10 - KLocale::ShortName" 5164 msgid "Tam" 5165 msgstr "Tamuz" 5166 5167 #: kdecore/kcalendarsystemhebrew.cpp:715 5168 #, fuzzy, kde-format 5169 #| msgid "Av" 5170 msgctxt "Hebrew month 11 - KLocale::ShortName" 5171 msgid "Av" 5172 msgstr "Av" 5173 5174 #: kdecore/kcalendarsystemhebrew.cpp:717 5175 #, fuzzy, kde-format 5176 #| msgid "Elul" 5177 msgctxt "Hebrew month 12 - KLocale::ShortName" 5178 msgid "Elu" 5179 msgstr "Elul" 5180 5181 #: kdecore/kcalendarsystemhebrew.cpp:719 5182 #, fuzzy, kde-format 5183 #| msgid "Ahd" 5184 msgctxt "Hebrew month 13 - KLocale::ShortName" 5185 msgid "Ad1" 5186 msgstr "Ahd" 5187 5188 #: kdecore/kcalendarsystemhebrew.cpp:721 5189 #, fuzzy, kde-format 5190 #| msgid "Ahd" 5191 msgctxt "Hebrew month 14 - KLocale::ShortName" 5192 msgid "Ad2" 5193 msgstr "Ahd" 5194 5195 #: kdecore/kcalendarsystemhebrew.cpp:730 5196 #, fuzzy, kde-format 5197 #| msgid "of Tishrey" 5198 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 5199 msgid "of Tishrey" 5200 msgstr "fan Tishrey" 5201 5202 #: kdecore/kcalendarsystemhebrew.cpp:732 5203 #, fuzzy, kde-format 5204 #| msgid "of Heshvan" 5205 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 5206 msgid "of Heshvan" 5207 msgstr "fan Heshvan" 5208 5209 #: kdecore/kcalendarsystemhebrew.cpp:734 5210 #, fuzzy, kde-format 5211 #| msgid "of Kislev" 5212 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 5213 msgid "of Kislev" 5214 msgstr "fan Kislev" 5215 5216 #: kdecore/kcalendarsystemhebrew.cpp:736 5217 #, fuzzy, kde-format 5218 #| msgid "of Tevet" 5219 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 5220 msgid "of Tevet" 5221 msgstr "fan Tevet" 5222 5223 #: kdecore/kcalendarsystemhebrew.cpp:738 5224 #, fuzzy, kde-format 5225 #| msgid "of Shvat" 5226 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 5227 msgid "of Shvat" 5228 msgstr "fan Shvat" 5229 5230 #: kdecore/kcalendarsystemhebrew.cpp:740 5231 #, fuzzy, kde-format 5232 #| msgid "of Adar" 5233 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 5234 msgid "of Adar" 5235 msgstr "fan Adar" 5236 5237 #: kdecore/kcalendarsystemhebrew.cpp:742 5238 #, fuzzy, kde-format 5239 #| msgid "of Nisan" 5240 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 5241 msgid "of Nisan" 5242 msgstr "fan Nisan" 5243 5244 #: kdecore/kcalendarsystemhebrew.cpp:744 5245 #, fuzzy, kde-format 5246 #| msgid "of Iyar" 5247 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 5248 msgid "of Iyar" 5249 msgstr "fan Iyar" 5250 5251 #: kdecore/kcalendarsystemhebrew.cpp:746 5252 #, fuzzy, kde-format 5253 #| msgid "of Sivan" 5254 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 5255 msgid "of Sivan" 5256 msgstr "fan Sivan" 5257 5258 #: kdecore/kcalendarsystemhebrew.cpp:748 5259 #, fuzzy, kde-format 5260 #| msgid "of Tamuz" 5261 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 5262 msgid "of Tamuz" 5263 msgstr "fan Tamuz" 5264 5265 #: kdecore/kcalendarsystemhebrew.cpp:750 5266 #, fuzzy, kde-format 5267 #| msgid "of Av" 5268 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 5269 msgid "of Av" 5270 msgstr "fan Av" 5271 5272 #: kdecore/kcalendarsystemhebrew.cpp:752 5273 #, fuzzy, kde-format 5274 #| msgid "of Elul" 5275 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 5276 msgid "of Elul" 5277 msgstr "fan Elul" 5278 5279 #: kdecore/kcalendarsystemhebrew.cpp:754 5280 #, fuzzy, kde-format 5281 #| msgid "of Adar I" 5282 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 5283 msgid "of Adar I" 5284 msgstr "fan Adar I" 5285 5286 #: kdecore/kcalendarsystemhebrew.cpp:756 5287 #, fuzzy, kde-format 5288 #| msgid "of Adar II" 5289 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 5290 msgid "of Adar II" 5291 msgstr "fan Adar II" 5292 5293 #: kdecore/kcalendarsystemhebrew.cpp:765 5294 #, fuzzy, kde-format 5295 #| msgid "Tishrey" 5296 msgctxt "Hebrew month 1 - KLocale::LongName" 5297 msgid "Tishrey" 5298 msgstr "Tishrey" 5299 5300 #: kdecore/kcalendarsystemhebrew.cpp:767 5301 #, fuzzy, kde-format 5302 #| msgid "Heshvan" 5303 msgctxt "Hebrew month 2 - KLocale::LongName" 5304 msgid "Heshvan" 5305 msgstr "Heshvan" 5306 5307 #: kdecore/kcalendarsystemhebrew.cpp:769 5308 #, fuzzy, kde-format 5309 #| msgid "Kislev" 5310 msgctxt "Hebrew month 3 - KLocale::LongName" 5311 msgid "Kislev" 5312 msgstr "Kislev" 5313 5314 #: kdecore/kcalendarsystemhebrew.cpp:771 5315 #, fuzzy, kde-format 5316 #| msgid "Tevet" 5317 msgctxt "Hebrew month 4 - KLocale::LongName" 5318 msgid "Tevet" 5319 msgstr "Tevet" 5320 5321 #: kdecore/kcalendarsystemhebrew.cpp:773 5322 #, fuzzy, kde-format 5323 #| msgid "Shvat" 5324 msgctxt "Hebrew month 5 - KLocale::LongName" 5325 msgid "Shvat" 5326 msgstr "Shvat" 5327 5328 #: kdecore/kcalendarsystemhebrew.cpp:775 5329 #, fuzzy, kde-format 5330 #| msgid "Adar" 5331 msgctxt "Hebrew month 6 - KLocale::LongName" 5332 msgid "Adar" 5333 msgstr "Adar" 5334 5335 #: kdecore/kcalendarsystemhebrew.cpp:777 5336 #, fuzzy, kde-format 5337 #| msgid "Nisan" 5338 msgctxt "Hebrew month 7 - KLocale::LongName" 5339 msgid "Nisan" 5340 msgstr "Nisan" 5341 5342 #: kdecore/kcalendarsystemhebrew.cpp:779 5343 #, fuzzy, kde-format 5344 #| msgid "Iyar" 5345 msgctxt "Hebrew month 8 - KLocale::LongName" 5346 msgid "Iyar" 5347 msgstr "Iyar" 5348 5349 #: kdecore/kcalendarsystemhebrew.cpp:781 5350 #, fuzzy, kde-format 5351 #| msgid "Sivan" 5352 msgctxt "Hebrew month 9 - KLocale::LongName" 5353 msgid "Sivan" 5354 msgstr "Sivan" 5355 5356 #: kdecore/kcalendarsystemhebrew.cpp:783 5357 #, fuzzy, kde-format 5358 #| msgid "Tamuz" 5359 msgctxt "Hebrew month 10 - KLocale::LongName" 5360 msgid "Tamuz" 5361 msgstr "Tamuz" 5362 5363 #: kdecore/kcalendarsystemhebrew.cpp:785 5364 #, fuzzy, kde-format 5365 #| msgid "Av" 5366 msgctxt "Hebrew month 11 - KLocale::LongName" 5367 msgid "Av" 5368 msgstr "Av" 5369 5370 #: kdecore/kcalendarsystemhebrew.cpp:787 5371 #, fuzzy, kde-format 5372 #| msgid "Elul" 5373 msgctxt "Hebrew month 12 - KLocale::LongName" 5374 msgid "Elul" 5375 msgstr "Elul" 5376 5377 #: kdecore/kcalendarsystemhebrew.cpp:789 5378 #, fuzzy, kde-format 5379 #| msgid "Adar I" 5380 msgctxt "Hebrew month 13 - KLocale::LongName" 5381 msgid "Adar I" 5382 msgstr "Adar I" 5383 5384 #: kdecore/kcalendarsystemhebrew.cpp:791 5385 #, fuzzy, kde-format 5386 #| msgid "Adar II" 5387 msgctxt "Hebrew month 14 - KLocale::LongName" 5388 msgid "Adar II" 5389 msgstr "Adar II" 5390 5391 #: kdecore/kcalendarsystemindiannational.cpp:66 5392 #, fuzzy, kde-format 5393 #| msgid "Safar" 5394 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5395 msgid "Saka Era" 5396 msgstr "Safar" 5397 5398 #: kdecore/kcalendarsystemindiannational.cpp:67 5399 #, kde-format 5400 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5401 msgid "SE" 5402 msgstr "" 5403 5404 #: kdecore/kcalendarsystemindiannational.cpp:68 5405 #, kde-format 5406 msgctxt "" 5407 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5408 "2000 SE" 5409 msgid "%Ey %EC" 5410 msgstr "" 5411 5412 #: kdecore/kcalendarsystemindiannational.cpp:158 5413 #, kde-format 5414 msgctxt "Indian National month 1 - KLocale::NarrowName" 5415 msgid "C" 5416 msgstr "" 5417 5418 #: kdecore/kcalendarsystemindiannational.cpp:160 5419 #, kde-format 5420 msgctxt "Indian National month 2 - KLocale::NarrowName" 5421 msgid "V" 5422 msgstr "" 5423 5424 #: kdecore/kcalendarsystemindiannational.cpp:162 5425 #, kde-format 5426 msgctxt "Indian National month 3 - KLocale::NarrowName" 5427 msgid "J" 5428 msgstr "" 5429 5430 #: kdecore/kcalendarsystemindiannational.cpp:164 5431 #, fuzzy, kde-format 5432 msgctxt "Indian National month 4 - KLocale::NarrowName" 5433 msgid "Ā" 5434 msgstr "fan Kho" 5435 5436 #: kdecore/kcalendarsystemindiannational.cpp:166 5437 #, kde-format 5438 msgctxt "Indian National month 5 - KLocale::NarrowName" 5439 msgid "S" 5440 msgstr "" 5441 5442 #: kdecore/kcalendarsystemindiannational.cpp:168 5443 #, kde-format 5444 msgctxt "Indian National month 6 - KLocale::NarrowName" 5445 msgid "B" 5446 msgstr "" 5447 5448 #: kdecore/kcalendarsystemindiannational.cpp:170 5449 #, fuzzy, kde-format 5450 msgctxt "Indian National month 7 - KLocale::NarrowName" 5451 msgid "Ā" 5452 msgstr "fan Kho" 5453 5454 #: kdecore/kcalendarsystemindiannational.cpp:172 5455 #, kde-format 5456 msgctxt "Indian National month 8 - KLocale::NarrowName" 5457 msgid "K" 5458 msgstr "" 5459 5460 #: kdecore/kcalendarsystemindiannational.cpp:174 5461 #, fuzzy, kde-format 5462 #| msgid "Av" 5463 msgctxt "Indian National month 9 - KLocale::NarrowName" 5464 msgid "A" 5465 msgstr "Av" 5466 5467 #: kdecore/kcalendarsystemindiannational.cpp:176 5468 #, kde-format 5469 msgctxt "Indian National month 10 - KLocale::NarrowName" 5470 msgid "P" 5471 msgstr "" 5472 5473 #: kdecore/kcalendarsystemindiannational.cpp:178 5474 #, kde-format 5475 msgctxt "Indian National month 11 - KLocale::NarrowName" 5476 msgid "M" 5477 msgstr "" 5478 5479 #: kdecore/kcalendarsystemindiannational.cpp:180 5480 #, kde-format 5481 msgctxt "Indian National month 12 - KLocale::NarrowName" 5482 msgid "P" 5483 msgstr "" 5484 5485 #: kdecore/kcalendarsystemindiannational.cpp:189 5486 #, fuzzy, kde-format 5487 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5488 msgid "of Cha" 5489 msgstr "fan Sha" 5490 5491 #: kdecore/kcalendarsystemindiannational.cpp:191 5492 #, fuzzy, kde-format 5493 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5494 msgid "of Vai" 5495 msgstr "fan Far" 5496 5497 #: kdecore/kcalendarsystemindiannational.cpp:193 5498 #, fuzzy, kde-format 5499 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5500 msgid "of Jya" 5501 msgstr "fan jan" 5502 5503 #: kdecore/kcalendarsystemindiannational.cpp:195 5504 #, fuzzy, kde-format 5505 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5506 msgid "of Āsh" 5507 msgstr "fan Kho" 5508 5509 #: kdecore/kcalendarsystemindiannational.cpp:197 5510 #, fuzzy, kde-format 5511 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5512 msgid "of Shr" 5513 msgstr "fan Sha" 5514 5515 #: kdecore/kcalendarsystemindiannational.cpp:199 5516 #, fuzzy, kde-format 5517 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5518 msgid "of Bhā" 5519 msgstr "fan Bah" 5520 5521 #: kdecore/kcalendarsystemindiannational.cpp:201 5522 #, fuzzy, kde-format 5523 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5524 msgid "of Āsw" 5525 msgstr "fan Esf" 5526 5527 #: kdecore/kcalendarsystemindiannational.cpp:203 5528 #, fuzzy, kde-format 5529 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5530 msgid "of Kār" 5531 msgstr "fan Far" 5532 5533 #: kdecore/kcalendarsystemindiannational.cpp:205 5534 #, fuzzy, kde-format 5535 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5536 msgid "of Agr" 5537 msgstr "fan apr" 5538 5539 #: kdecore/kcalendarsystemindiannational.cpp:207 5540 #, fuzzy, kde-format 5541 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5542 msgid "of Pau" 5543 msgstr "fan Tamuz" 5544 5545 #: kdecore/kcalendarsystemindiannational.cpp:209 5546 #, fuzzy, kde-format 5547 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5548 msgid "of Māg" 5549 msgstr "fan Mor" 5550 5551 #: kdecore/kcalendarsystemindiannational.cpp:211 5552 #, fuzzy, kde-format 5553 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5554 msgid "of Phā" 5555 msgstr "fan Kho" 5556 5557 #: kdecore/kcalendarsystemindiannational.cpp:220 5558 #, fuzzy, kde-format 5559 msgctxt "Indian National month 1 - KLocale::ShortName" 5560 msgid "Cha" 5561 msgstr "Kha" 5562 5563 #: kdecore/kcalendarsystemindiannational.cpp:222 5564 #, fuzzy, kde-format 5565 msgctxt "Indian National month 2 - KLocale::ShortName" 5566 msgid "Vai" 5567 msgstr "fan Far" 5568 5569 #: kdecore/kcalendarsystemindiannational.cpp:224 5570 #, fuzzy, kde-format 5571 msgctxt "Indian National month 3 - KLocale::ShortName" 5572 msgid "Jya" 5573 msgstr "jan" 5574 5575 #: kdecore/kcalendarsystemindiannational.cpp:226 5576 #, fuzzy, kde-format 5577 msgctxt "Indian National month 4 - KLocale::ShortName" 5578 msgid "Āsh" 5579 msgstr "fan Kho" 5580 5581 #: kdecore/kcalendarsystemindiannational.cpp:228 5582 #, fuzzy, kde-format 5583 msgctxt "Indian National month 5 - KLocale::ShortName" 5584 msgid "Shr" 5585 msgstr "Sha" 5586 5587 #: kdecore/kcalendarsystemindiannational.cpp:230 5588 #, fuzzy, kde-format 5589 msgctxt "Indian National month 6 - KLocale::ShortName" 5590 msgid "Bhā" 5591 msgstr "fan Bah" 5592 5593 #: kdecore/kcalendarsystemindiannational.cpp:232 5594 #, fuzzy, kde-format 5595 msgctxt "Indian National month 7 - KLocale::ShortName" 5596 msgid "Āsw" 5597 msgstr "fan Esf" 5598 5599 #: kdecore/kcalendarsystemindiannational.cpp:234 5600 #, fuzzy, kde-format 5601 msgctxt "Indian National month 8 - KLocale::ShortName" 5602 msgid "Kār" 5603 msgstr "fan Far" 5604 5605 #: kdecore/kcalendarsystemindiannational.cpp:236 5606 #, fuzzy, kde-format 5607 msgctxt "Indian National month 9 - KLocale::ShortName" 5608 msgid "Agr" 5609 msgstr "Arb" 5610 5611 #: kdecore/kcalendarsystemindiannational.cpp:238 5612 #, fuzzy, kde-format 5613 msgctxt "Indian National month 10 - KLocale::ShortName" 5614 msgid "Pau" 5615 msgstr "Skoftsje" 5616 5617 #: kdecore/kcalendarsystemindiannational.cpp:240 5618 #, fuzzy, kde-format 5619 msgctxt "Indian National month 11 - KLocale::ShortName" 5620 msgid "Māg" 5621 msgstr "fan Mor" 5622 5623 #: kdecore/kcalendarsystemindiannational.cpp:242 5624 #, fuzzy, kde-format 5625 msgctxt "Indian National month 12 - KLocale::ShortName" 5626 msgid "Phā" 5627 msgstr "fan Kho" 5628 5629 #: kdecore/kcalendarsystemindiannational.cpp:251 5630 #, fuzzy, kde-format 5631 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5632 msgid "of Chaitra" 5633 msgstr "of Muharram" 5634 5635 #: kdecore/kcalendarsystemindiannational.cpp:253 5636 #, fuzzy, kde-format 5637 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5638 msgid "of Vaishākh" 5639 msgstr "fan Far" 5640 5641 #: kdecore/kcalendarsystemindiannational.cpp:255 5642 #, fuzzy, kde-format 5643 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5644 msgid "of Jyaishtha" 5645 msgstr "fan Nisan" 5646 5647 #: kdecore/kcalendarsystemindiannational.cpp:257 5648 #, fuzzy, kde-format 5649 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5650 msgid "of Āshādha" 5651 msgstr "fan Kho" 5652 5653 #: kdecore/kcalendarsystemindiannational.cpp:259 5654 #, fuzzy, kde-format 5655 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5656 msgid "of Shrāvana" 5657 msgstr "fan Shvat" 5658 5659 #: kdecore/kcalendarsystemindiannational.cpp:261 5660 #, fuzzy, kde-format 5661 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5662 msgid "of Bhādrapad" 5663 msgstr "fan Khordad" 5664 5665 #: kdecore/kcalendarsystemindiannational.cpp:263 5666 #, fuzzy, kde-format 5667 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5668 msgid "of Āshwin" 5669 msgstr "fan Heshvan" 5670 5671 #: kdecore/kcalendarsystemindiannational.cpp:265 5672 #, fuzzy, kde-format 5673 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5674 msgid "of Kārtik" 5675 msgstr "fan Far" 5676 5677 #: kdecore/kcalendarsystemindiannational.cpp:267 5678 #, fuzzy, kde-format 5679 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5680 msgid "of Agrahayana" 5681 msgstr "fan Bahman" 5682 5683 #: kdecore/kcalendarsystemindiannational.cpp:269 5684 #, fuzzy, kde-format 5685 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5686 msgid "of Paush" 5687 msgstr "fan Bah" 5688 5689 #: kdecore/kcalendarsystemindiannational.cpp:271 5690 #, fuzzy, kde-format 5691 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5692 msgid "of Māgh" 5693 msgstr "fan Meh" 5694 5695 #: kdecore/kcalendarsystemindiannational.cpp:273 5696 #, fuzzy, kde-format 5697 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5698 msgid "of Phālgun" 5699 msgstr "fan Kho" 5700 5701 #: kdecore/kcalendarsystemindiannational.cpp:282 5702 #, fuzzy, kde-format 5703 msgctxt "Indian National month 1 - KLocale::LongName" 5704 msgid "Chaitra" 5705 msgstr "of Muharram" 5706 5707 #: kdecore/kcalendarsystemindiannational.cpp:284 5708 #, fuzzy, kde-format 5709 msgctxt "Indian National month 2 - KLocale::LongName" 5710 msgid "Vaishākh" 5711 msgstr "fan Far" 5712 5713 #: kdecore/kcalendarsystemindiannational.cpp:286 5714 #, fuzzy, kde-format 5715 msgctxt "Indian National month 3 - KLocale::LongName" 5716 msgid "Jyaishtha" 5717 msgstr "fan Nisan" 5718 5719 #: kdecore/kcalendarsystemindiannational.cpp:288 5720 #, fuzzy, kde-format 5721 msgctxt "Indian National month 4 - KLocale::LongName" 5722 msgid "Āshādha" 5723 msgstr "fan Kho" 5724 5725 #: kdecore/kcalendarsystemindiannational.cpp:290 5726 #, fuzzy, kde-format 5727 msgctxt "Indian National month 5 - KLocale::LongName" 5728 msgid "Shrāvana" 5729 msgstr "fan Shvat" 5730 5731 #: kdecore/kcalendarsystemindiannational.cpp:292 5732 #, fuzzy, kde-format 5733 msgctxt "Indian National month 6 - KLocale::LongName" 5734 msgid "Bhādrapad" 5735 msgstr "fan Khordad" 5736 5737 #: kdecore/kcalendarsystemindiannational.cpp:294 5738 #, fuzzy, kde-format 5739 msgctxt "Indian National month 7 - KLocale::LongName" 5740 msgid "Āshwin" 5741 msgstr "fan Heshvan" 5742 5743 #: kdecore/kcalendarsystemindiannational.cpp:296 5744 #, fuzzy, kde-format 5745 msgctxt "Indian National month 8 - KLocale::LongName" 5746 msgid "Kārtik" 5747 msgstr "fan Far" 5748 5749 #: kdecore/kcalendarsystemindiannational.cpp:298 5750 #, fuzzy, kde-format 5751 msgctxt "Indian National month 9 - KLocale::LongName" 5752 msgid "Agrahayana" 5753 msgstr "Thaanaask" 5754 5755 #: kdecore/kcalendarsystemindiannational.cpp:300 5756 #, fuzzy, kde-format 5757 msgctxt "Indian National month 10 - KLocale::LongName" 5758 msgid "Paush" 5759 msgstr "Skoftsje" 5760 5761 #: kdecore/kcalendarsystemindiannational.cpp:302 5762 #, fuzzy, kde-format 5763 msgctxt "Indian National month 11 - KLocale::LongName" 5764 msgid "Māgh" 5765 msgstr "fan Meh" 5766 5767 #: kdecore/kcalendarsystemindiannational.cpp:304 5768 #, fuzzy, kde-format 5769 msgctxt "Indian National month 12 - KLocale::LongName" 5770 msgid "Phālgun" 5771 msgstr "fan Kho" 5772 5773 #: kdecore/kcalendarsystemindiannational.cpp:317 5774 #, kde-format 5775 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5776 msgid "S" 5777 msgstr "" 5778 5779 #: kdecore/kcalendarsystemindiannational.cpp:319 5780 #, kde-format 5781 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5782 msgid "M" 5783 msgstr "" 5784 5785 #: kdecore/kcalendarsystemindiannational.cpp:321 5786 #, kde-format 5787 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5788 msgid "B" 5789 msgstr "" 5790 5791 #: kdecore/kcalendarsystemindiannational.cpp:323 5792 #, kde-format 5793 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5794 msgid "G" 5795 msgstr "" 5796 5797 #: kdecore/kcalendarsystemindiannational.cpp:325 5798 #, kde-format 5799 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5800 msgid "S" 5801 msgstr "" 5802 5803 #: kdecore/kcalendarsystemindiannational.cpp:327 5804 #, kde-format 5805 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5806 msgid "S" 5807 msgstr "" 5808 5809 #: kdecore/kcalendarsystemindiannational.cpp:329 5810 #, kde-format 5811 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5812 msgid "R" 5813 msgstr "" 5814 5815 #: kdecore/kcalendarsystemindiannational.cpp:338 5816 #, fuzzy, kde-format 5817 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5818 msgid "Som" 5819 msgstr "Jom" 5820 5821 #: kdecore/kcalendarsystemindiannational.cpp:340 5822 #, kde-format 5823 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5824 msgid "Mañ" 5825 msgstr "" 5826 5827 #: kdecore/kcalendarsystemindiannational.cpp:342 5828 #, fuzzy, kde-format 5829 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5830 msgid "Bud" 5831 msgstr "Buhid" 5832 5833 #: kdecore/kcalendarsystemindiannational.cpp:344 5834 #, kde-format 5835 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5836 msgid "Gur" 5837 msgstr "" 5838 5839 #: kdecore/kcalendarsystemindiannational.cpp:346 5840 #, fuzzy, kde-format 5841 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5842 msgid "Suk" 5843 msgstr "sne" 5844 5845 #: kdecore/kcalendarsystemindiannational.cpp:348 5846 #, fuzzy, kde-format 5847 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5848 msgid "San" 5849 msgstr "Sivan" 5850 5851 #: kdecore/kcalendarsystemindiannational.cpp:350 5852 #, kde-format 5853 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5854 msgid "Rav" 5855 msgstr "" 5856 5857 #: kdecore/kcalendarsystemindiannational.cpp:357 5858 #, kde-format 5859 msgctxt "Indian National weekday 1 - KLocale::LongName" 5860 msgid "Somavãra" 5861 msgstr "" 5862 5863 #: kdecore/kcalendarsystemindiannational.cpp:359 5864 #, kde-format 5865 msgctxt "Indian National weekday 2 - KLocale::LongName" 5866 msgid "Mañgalvã" 5867 msgstr "" 5868 5869 #: kdecore/kcalendarsystemindiannational.cpp:361 5870 #, kde-format 5871 msgctxt "Indian National weekday 3 - KLocale::LongName" 5872 msgid "Budhavãra" 5873 msgstr "" 5874 5875 #: kdecore/kcalendarsystemindiannational.cpp:363 5876 #, kde-format 5877 msgctxt "Indian National weekday 4 - KLocale::LongName" 5878 msgid "Guruvãra" 5879 msgstr "" 5880 5881 #: kdecore/kcalendarsystemindiannational.cpp:365 5882 #, kde-format 5883 msgctxt "Indian National weekday 5 - KLocale::LongName" 5884 msgid "Sukravãra" 5885 msgstr "" 5886 5887 #: kdecore/kcalendarsystemindiannational.cpp:367 5888 #, kde-format 5889 msgctxt "Indian National weekday 6 - KLocale::LongName" 5890 msgid "Sanivãra" 5891 msgstr "" 5892 5893 #: kdecore/kcalendarsystemindiannational.cpp:369 5894 #, kde-format 5895 msgctxt "Indian National weekday 7 - KLocale::LongName" 5896 msgid "Raviãra" 5897 msgstr "" 5898 5899 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5900 #, kde-format 5901 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5902 msgid "Anno Hegirae" 5903 msgstr "" 5904 5905 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5906 #, kde-format 5907 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5908 msgid "AH" 5909 msgstr "" 5910 5911 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5912 #, kde-format 5913 msgctxt "" 5914 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5915 msgid "%Ey %EC" 5916 msgstr "" 5917 5918 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5919 #, kde-format 5920 msgctxt "Hijri month 1 - KLocale::NarrowName" 5921 msgid "M" 5922 msgstr "" 5923 5924 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5925 #, kde-format 5926 msgctxt "Hijri month 2 - KLocale::NarrowName" 5927 msgid "S" 5928 msgstr "" 5929 5930 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5931 #, fuzzy, kde-format 5932 #| msgid "Av" 5933 msgctxt "Hijri month 3 - KLocale::NarrowName" 5934 msgid "A" 5935 msgstr "Av" 5936 5937 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5938 #, kde-format 5939 msgctxt "Hijri month 4 - KLocale::NarrowName" 5940 msgid "T" 5941 msgstr "" 5942 5943 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5944 #, fuzzy, kde-format 5945 #| msgid "Av" 5946 msgctxt "Hijri month 5 - KLocale::NarrowName" 5947 msgid "A" 5948 msgstr "Av" 5949 5950 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5951 #, kde-format 5952 msgctxt "Hijri month 6 - KLocale::NarrowName" 5953 msgid "T" 5954 msgstr "" 5955 5956 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5957 #, kde-format 5958 msgctxt "Hijri month 7 - KLocale::NarrowName" 5959 msgid "R" 5960 msgstr "" 5961 5962 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5963 #, kde-format 5964 msgctxt "Hijri month 8 - KLocale::NarrowName" 5965 msgid "S" 5966 msgstr "" 5967 5968 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5969 #, kde-format 5970 msgctxt "Hijri month 9 - KLocale::NarrowName" 5971 msgid "R" 5972 msgstr "" 5973 5974 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5975 #, kde-format 5976 msgctxt "Hijri month 10 - KLocale::NarrowName" 5977 msgid "S" 5978 msgstr "" 5979 5980 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5981 #, kde-format 5982 msgctxt "Hijri month 11 - KLocale::NarrowName" 5983 msgid "Q" 5984 msgstr "" 5985 5986 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5987 #, kde-format 5988 msgctxt "Hijri month 12 - KLocale::NarrowName" 5989 msgid "H" 5990 msgstr "" 5991 5992 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5993 #, fuzzy, kde-format 5994 #| msgctxt "of Mehr short" 5995 #| msgid "of Meh" 5996 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5997 msgid "of Muh" 5998 msgstr "fan Meh" 5999 6000 #: kdecore/kcalendarsystemislamiccivil.cpp:199 6001 #, fuzzy, kde-format 6002 #| msgid "of Safar" 6003 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 6004 msgid "of Saf" 6005 msgstr "of Safar" 6006 6007 #: kdecore/kcalendarsystemislamiccivil.cpp:201 6008 #, fuzzy, kde-format 6009 #| msgid "of R. Awal" 6010 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 6011 msgid "of R.A" 6012 msgstr "of R. Awal" 6013 6014 #: kdecore/kcalendarsystemislamiccivil.cpp:203 6015 #, fuzzy, kde-format 6016 #| msgid "of R. Thaani" 6017 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 6018 msgid "of R.T" 6019 msgstr "of R. Thaani" 6020 6021 #: kdecore/kcalendarsystemislamiccivil.cpp:205 6022 #, fuzzy, kde-format 6023 #| msgid "of J. Awal" 6024 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 6025 msgid "of J.A" 6026 msgstr "of J. Awal" 6027 6028 #: kdecore/kcalendarsystemislamiccivil.cpp:207 6029 #, fuzzy, kde-format 6030 #| msgid "of J. Thaani" 6031 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 6032 msgid "of J.T" 6033 msgstr "of J. Thaani" 6034 6035 #: kdecore/kcalendarsystemislamiccivil.cpp:209 6036 #, fuzzy, kde-format 6037 #| msgid "of Rajab" 6038 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 6039 msgid "of Raj" 6040 msgstr "of Rajab" 6041 6042 #: kdecore/kcalendarsystemislamiccivil.cpp:211 6043 #, fuzzy, kde-format 6044 #| msgctxt "of Shahrivar short" 6045 #| msgid "of Sha" 6046 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 6047 msgid "of Sha" 6048 msgstr "fan Sha" 6049 6050 #: kdecore/kcalendarsystemislamiccivil.cpp:213 6051 #, fuzzy, kde-format 6052 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 6053 msgid "of Ram" 6054 msgstr "fan Tamuz" 6055 6056 #: kdecore/kcalendarsystemislamiccivil.cpp:215 6057 #, fuzzy, kde-format 6058 #| msgctxt "of Shahrivar short" 6059 #| msgid "of Sha" 6060 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 6061 msgid "of Shw" 6062 msgstr "fan Sha" 6063 6064 #: kdecore/kcalendarsystemislamiccivil.cpp:217 6065 #, fuzzy, kde-format 6066 #| msgid "of Qi`dah" 6067 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 6068 msgid "of Qid" 6069 msgstr "of Qi`dah" 6070 6071 #: kdecore/kcalendarsystemislamiccivil.cpp:219 6072 #, fuzzy, kde-format 6073 #| msgid "of Hijjah" 6074 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 6075 msgid "of Hij" 6076 msgstr "of Hijjah" 6077 6078 #: kdecore/kcalendarsystemislamiccivil.cpp:228 6079 #, fuzzy, kde-format 6080 #| msgctxt "Mehr short" 6081 #| msgid "Meh" 6082 msgctxt "Hijri month 1 - KLocale::ShortName" 6083 msgid "Muh" 6084 msgstr "Meh" 6085 6086 #: kdecore/kcalendarsystemislamiccivil.cpp:230 6087 #, fuzzy, kde-format 6088 #| msgid "Safar" 6089 msgctxt "Hijri month 2 - KLocale::ShortName" 6090 msgid "Saf" 6091 msgstr "Safar" 6092 6093 #: kdecore/kcalendarsystemislamiccivil.cpp:232 6094 #, fuzzy, kde-format 6095 #| msgid "R. Awal" 6096 msgctxt "Hijri month 3 - KLocale::ShortName" 6097 msgid "R.A" 6098 msgstr "R. Awal" 6099 6100 #: kdecore/kcalendarsystemislamiccivil.cpp:234 6101 #, kde-format 6102 msgctxt "Hijri month 4 - KLocale::ShortName" 6103 msgid "R.T" 6104 msgstr "" 6105 6106 #: kdecore/kcalendarsystemislamiccivil.cpp:236 6107 #, fuzzy, kde-format 6108 #| msgid "J. Awal" 6109 msgctxt "Hijri month 5 - KLocale::ShortName" 6110 msgid "J.A" 6111 msgstr "J. Awal" 6112 6113 #: kdecore/kcalendarsystemislamiccivil.cpp:238 6114 #, kde-format 6115 msgctxt "Hijri month 6 - KLocale::ShortName" 6116 msgid "J.T" 6117 msgstr "" 6118 6119 #: kdecore/kcalendarsystemislamiccivil.cpp:240 6120 #, fuzzy, kde-format 6121 #| msgid "Rajab" 6122 msgctxt "Hijri month 7 - KLocale::ShortName" 6123 msgid "Raj" 6124 msgstr "Rajab" 6125 6126 #: kdecore/kcalendarsystemislamiccivil.cpp:242 6127 #, fuzzy, kde-format 6128 #| msgctxt "Shahrivar short" 6129 #| msgid "Sha" 6130 msgctxt "Hijri month 8 - KLocale::ShortName" 6131 msgid "Sha" 6132 msgstr "Sha" 6133 6134 #: kdecore/kcalendarsystemislamiccivil.cpp:244 6135 #, fuzzy, kde-format 6136 msgctxt "Hijri month 9 - KLocale::ShortName" 6137 msgid "Ram" 6138 msgstr "am" 6139 6140 #: kdecore/kcalendarsystemislamiccivil.cpp:246 6141 #, fuzzy, kde-format 6142 #| msgctxt "Shahrivar short" 6143 #| msgid "Sha" 6144 msgctxt "Hijri month 10 - KLocale::ShortName" 6145 msgid "Shw" 6146 msgstr "Sha" 6147 6148 #: kdecore/kcalendarsystemislamiccivil.cpp:248 6149 #, fuzzy, kde-format 6150 #| msgid "Qi`dah" 6151 msgctxt "Hijri month 11 - KLocale::ShortName" 6152 msgid "Qid" 6153 msgstr "Qi`dah" 6154 6155 #: kdecore/kcalendarsystemislamiccivil.cpp:250 6156 #, fuzzy, kde-format 6157 #| msgctxt "@item Calendar system" 6158 #| msgid "Hijri" 6159 msgctxt "Hijri month 12 - KLocale::ShortName" 6160 msgid "Hij" 6161 msgstr "Hijri" 6162 6163 #: kdecore/kcalendarsystemislamiccivil.cpp:259 6164 #, fuzzy, kde-format 6165 #| msgid "of Muharram" 6166 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 6167 msgid "of Muharram" 6168 msgstr "of Muharram" 6169 6170 #: kdecore/kcalendarsystemislamiccivil.cpp:261 6171 #, fuzzy, kde-format 6172 #| msgid "of Safar" 6173 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 6174 msgid "of Safar" 6175 msgstr "of Safar" 6176 6177 #: kdecore/kcalendarsystemislamiccivil.cpp:263 6178 #, fuzzy, kde-format 6179 #| msgid "of Rabi` al-Awal" 6180 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 6181 msgid "of Rabi` al-Awal" 6182 msgstr "of Rabi` al-Awal" 6183 6184 #: kdecore/kcalendarsystemislamiccivil.cpp:265 6185 #, fuzzy, kde-format 6186 #| msgid "of Rabi` al-Thaani" 6187 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 6188 msgid "of Rabi` al-Thaani" 6189 msgstr "of Rabi` al-Thaani" 6190 6191 #: kdecore/kcalendarsystemislamiccivil.cpp:267 6192 #, fuzzy, kde-format 6193 #| msgid "of Jumaada al-Awal" 6194 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 6195 msgid "of Jumaada al-Awal" 6196 msgstr "of Jumaada al-Awal" 6197 6198 #: kdecore/kcalendarsystemislamiccivil.cpp:269 6199 #, fuzzy, kde-format 6200 #| msgid "of Jumaada al-Thaani" 6201 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 6202 msgid "of Jumaada al-Thaani" 6203 msgstr "of Jumaada al-Thaani" 6204 6205 #: kdecore/kcalendarsystemislamiccivil.cpp:271 6206 #, fuzzy, kde-format 6207 #| msgid "of Rajab" 6208 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 6209 msgid "of Rajab" 6210 msgstr "of Rajab" 6211 6212 #: kdecore/kcalendarsystemislamiccivil.cpp:273 6213 #, fuzzy, kde-format 6214 #| msgid "of Sha`ban" 6215 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 6216 msgid "of Sha`ban" 6217 msgstr "of Sha`ban" 6218 6219 #: kdecore/kcalendarsystemislamiccivil.cpp:275 6220 #, fuzzy, kde-format 6221 #| msgid "of Ramadan" 6222 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 6223 msgid "of Ramadan" 6224 msgstr "of Ramadan" 6225 6226 #: kdecore/kcalendarsystemislamiccivil.cpp:277 6227 #, fuzzy, kde-format 6228 #| msgid "of Shawwal" 6229 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 6230 msgid "of Shawwal" 6231 msgstr "of Shawwal" 6232 6233 #: kdecore/kcalendarsystemislamiccivil.cpp:279 6234 #, fuzzy, kde-format 6235 #| msgid "of Thu al-Qi`dah" 6236 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 6237 msgid "of Thu al-Qi`dah" 6238 msgstr "of Thu al-Qi`dah" 6239 6240 #: kdecore/kcalendarsystemislamiccivil.cpp:281 6241 #, fuzzy, kde-format 6242 #| msgid "of Thu al-Hijjah" 6243 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 6244 msgid "of Thu al-Hijjah" 6245 msgstr "of Thu al-Hijjah" 6246 6247 #: kdecore/kcalendarsystemislamiccivil.cpp:290 6248 #, fuzzy, kde-format 6249 #| msgid "Muharram" 6250 msgctxt "Hijri month 1 - KLocale::LongName" 6251 msgid "Muharram" 6252 msgstr "Muharram" 6253 6254 #: kdecore/kcalendarsystemislamiccivil.cpp:292 6255 #, fuzzy, kde-format 6256 #| msgid "Safar" 6257 msgctxt "Hijri month 2 - KLocale::LongName" 6258 msgid "Safar" 6259 msgstr "Safar" 6260 6261 #: kdecore/kcalendarsystemislamiccivil.cpp:294 6262 #, fuzzy, kde-format 6263 #| msgid "Rabi` al-Awal" 6264 msgctxt "Hijri month 3 - KLocale::LongName" 6265 msgid "Rabi` al-Awal" 6266 msgstr "Rabi` al-Awal" 6267 6268 #: kdecore/kcalendarsystemislamiccivil.cpp:296 6269 #, fuzzy, kde-format 6270 #| msgid "Rabi` al-Thaani" 6271 msgctxt "Hijri month 4 - KLocale::LongName" 6272 msgid "Rabi` al-Thaani" 6273 msgstr "Rabi` al-Thaani" 6274 6275 #: kdecore/kcalendarsystemislamiccivil.cpp:298 6276 #, fuzzy, kde-format 6277 #| msgid "Jumaada al-Awal" 6278 msgctxt "Hijri month 5 - KLocale::LongName" 6279 msgid "Jumaada al-Awal" 6280 msgstr "Jumaada al-Awal" 6281 6282 #: kdecore/kcalendarsystemislamiccivil.cpp:300 6283 #, fuzzy, kde-format 6284 #| msgid "Jumaada al-Thaani" 6285 msgctxt "Hijri month 6 - KLocale::LongName" 6286 msgid "Jumaada al-Thaani" 6287 msgstr "Jumaada al-Thaani" 6288 6289 #: kdecore/kcalendarsystemislamiccivil.cpp:302 6290 #, fuzzy, kde-format 6291 #| msgid "Rajab" 6292 msgctxt "Hijri month 7 - KLocale::LongName" 6293 msgid "Rajab" 6294 msgstr "Rajab" 6295 6296 #: kdecore/kcalendarsystemislamiccivil.cpp:304 6297 #, fuzzy, kde-format 6298 #| msgid "Sha`ban" 6299 msgctxt "Hijri month 8 - KLocale::LongName" 6300 msgid "Sha`ban" 6301 msgstr "Sha`ban" 6302 6303 #: kdecore/kcalendarsystemislamiccivil.cpp:306 6304 #, fuzzy, kde-format 6305 #| msgid "Ramadan" 6306 msgctxt "Hijri month 9 - KLocale::LongName" 6307 msgid "Ramadan" 6308 msgstr "Ramadan" 6309 6310 #: kdecore/kcalendarsystemislamiccivil.cpp:308 6311 #, fuzzy, kde-format 6312 #| msgid "Shawwal" 6313 msgctxt "Hijri month 10 - KLocale::LongName" 6314 msgid "Shawwal" 6315 msgstr "Shawwal" 6316 6317 #: kdecore/kcalendarsystemislamiccivil.cpp:310 6318 #, fuzzy, kde-format 6319 #| msgid "Thu al-Qi`dah" 6320 msgctxt "Hijri month 11 - KLocale::LongName" 6321 msgid "Thu al-Qi`dah" 6322 msgstr "Thu al-Qi`dah" 6323 6324 #: kdecore/kcalendarsystemislamiccivil.cpp:312 6325 #, fuzzy, kde-format 6326 #| msgid "Thu al-Hijjah" 6327 msgctxt "Hijri month 12 - KLocale::LongName" 6328 msgid "Thu al-Hijjah" 6329 msgstr "Thu al-Hijjah" 6330 6331 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6332 #, kde-format 6333 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6334 msgid "I" 6335 msgstr "" 6336 6337 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6338 #, kde-format 6339 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6340 msgid "T" 6341 msgstr "" 6342 6343 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6344 #, fuzzy, kde-format 6345 #| msgid "Av" 6346 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6347 msgid "A" 6348 msgstr "Av" 6349 6350 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6351 #, kde-format 6352 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6353 msgid "K" 6354 msgstr "" 6355 6356 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6357 #, kde-format 6358 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6359 msgid "J" 6360 msgstr "" 6361 6362 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6363 #, kde-format 6364 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6365 msgid "S" 6366 msgstr "" 6367 6368 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6369 #, fuzzy, kde-format 6370 #| msgid "Av" 6371 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6372 msgid "A" 6373 msgstr "Av" 6374 6375 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6376 #, fuzzy, kde-format 6377 #| msgid "Ith" 6378 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6379 msgid "Ith" 6380 msgstr "Ith" 6381 6382 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6383 #, fuzzy, kde-format 6384 #| msgid "Thl" 6385 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6386 msgid "Thl" 6387 msgstr "Thl" 6388 6389 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6390 #, fuzzy, kde-format 6391 #| msgid "Arb" 6392 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6393 msgid "Arb" 6394 msgstr "Arb" 6395 6396 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6397 #, fuzzy, kde-format 6398 #| msgid "Kha" 6399 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6400 msgid "Kha" 6401 msgstr "Kha" 6402 6403 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6404 #, fuzzy, kde-format 6405 #| msgid "Jum" 6406 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6407 msgid "Jum" 6408 msgstr "Jum" 6409 6410 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6411 #, fuzzy, kde-format 6412 #| msgid "Sab" 6413 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6414 msgid "Sab" 6415 msgstr "Sab" 6416 6417 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6418 #, fuzzy, kde-format 6419 #| msgid "Ahd" 6420 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6421 msgid "Ahd" 6422 msgstr "Ahd" 6423 6424 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6425 #, fuzzy, kde-format 6426 #| msgid "Yaum al-Ithnain" 6427 msgctxt "Hijri weekday 1 - KLocale::LongName" 6428 msgid "Yaum al-Ithnain" 6429 msgstr "Yaum al-Ithnain" 6430 6431 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6432 #, fuzzy, kde-format 6433 #| msgid "Yau al-Thulatha" 6434 msgctxt "Hijri weekday 2 - KLocale::LongName" 6435 msgid "Yau al-Thulatha" 6436 msgstr "Yau al-Thulatha" 6437 6438 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6439 #, fuzzy, kde-format 6440 #| msgid "Yaum al-Arbi'a" 6441 msgctxt "Hijri weekday 3 - KLocale::LongName" 6442 msgid "Yaum al-Arbi'a" 6443 msgstr "Yaum al-Arbi'a" 6444 6445 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6446 #, fuzzy, kde-format 6447 #| msgid "Yaum al-Khamees" 6448 msgctxt "Hijri weekday 4 - KLocale::LongName" 6449 msgid "Yaum al-Khamees" 6450 msgstr "Yaum al-Khamees" 6451 6452 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6453 #, fuzzy, kde-format 6454 #| msgid "Yaum al-Jumma" 6455 msgctxt "Hijri weekday 5 - KLocale::LongName" 6456 msgid "Yaum al-Jumma" 6457 msgstr "Yaum al-Jumma" 6458 6459 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6460 #, fuzzy, kde-format 6461 #| msgid "Yaum al-Sabt" 6462 msgctxt "Hijri weekday 6 - KLocale::LongName" 6463 msgid "Yaum al-Sabt" 6464 msgstr "Yaum al-Sabt" 6465 6466 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6467 #, fuzzy, kde-format 6468 #| msgid "Yaum al-Ahad" 6469 msgctxt "Hijri weekday 7 - KLocale::LongName" 6470 msgid "Yaum al-Ahad" 6471 msgstr "Yaum al-Ahad" 6472 6473 #: kdecore/kcalendarsystemjalali.cpp:74 6474 #, kde-format 6475 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6476 msgid "Anno Persico" 6477 msgstr "" 6478 6479 #: kdecore/kcalendarsystemjalali.cpp:75 6480 #, kde-format 6481 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6482 msgid "AP" 6483 msgstr "" 6484 6485 #: kdecore/kcalendarsystemjalali.cpp:76 6486 #, kde-format 6487 msgctxt "" 6488 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6489 msgid "%Ey %EC" 6490 msgstr "" 6491 6492 #: kdecore/kcalendarsystemjalali.cpp:172 6493 #, kde-format 6494 msgctxt "Jalali month 1 - KLocale::NarrowName" 6495 msgid "F" 6496 msgstr "" 6497 6498 #: kdecore/kcalendarsystemjalali.cpp:174 6499 #, kde-format 6500 msgctxt "Jalali month 2 - KLocale::NarrowName" 6501 msgid "O" 6502 msgstr "" 6503 6504 #: kdecore/kcalendarsystemjalali.cpp:176 6505 #, kde-format 6506 msgctxt "Jalali month 3 - KLocale::NarrowName" 6507 msgid "K" 6508 msgstr "" 6509 6510 #: kdecore/kcalendarsystemjalali.cpp:178 6511 #, kde-format 6512 msgctxt "Jalali month 4 - KLocale::NarrowName" 6513 msgid "T" 6514 msgstr "" 6515 6516 #: kdecore/kcalendarsystemjalali.cpp:180 6517 #, kde-format 6518 msgctxt "Jalali month 5 - KLocale::NarrowName" 6519 msgid "M" 6520 msgstr "" 6521 6522 #: kdecore/kcalendarsystemjalali.cpp:182 6523 #, kde-format 6524 msgctxt "Jalali month 6 - KLocale::NarrowName" 6525 msgid "S" 6526 msgstr "" 6527 6528 #: kdecore/kcalendarsystemjalali.cpp:184 6529 #, kde-format 6530 msgctxt "Jalali month 7 - KLocale::NarrowName" 6531 msgid "M" 6532 msgstr "" 6533 6534 #: kdecore/kcalendarsystemjalali.cpp:186 6535 #, fuzzy, kde-format 6536 #| msgid "Av" 6537 msgctxt "Jalali month 8 - KLocale::NarrowName" 6538 msgid "A" 6539 msgstr "Av" 6540 6541 #: kdecore/kcalendarsystemjalali.cpp:188 6542 #, fuzzy, kde-format 6543 #| msgid "Av" 6544 msgctxt "Jalali month 9 - KLocale::NarrowName" 6545 msgid "A" 6546 msgstr "Av" 6547 6548 #: kdecore/kcalendarsystemjalali.cpp:190 6549 #, kde-format 6550 msgctxt "Jalali month 10 - KLocale::NarrowName" 6551 msgid "D" 6552 msgstr "" 6553 6554 #: kdecore/kcalendarsystemjalali.cpp:192 6555 #, kde-format 6556 msgctxt "Jalali month 11 - KLocale::NarrowName" 6557 msgid "B" 6558 msgstr "" 6559 6560 #: kdecore/kcalendarsystemjalali.cpp:194 6561 #, kde-format 6562 msgctxt "Jalali month 12 - KLocale::NarrowName" 6563 msgid "E" 6564 msgstr "" 6565 6566 #: kdecore/kcalendarsystemjalali.cpp:203 6567 #, fuzzy, kde-format 6568 #| msgctxt "of Farvardin short" 6569 #| msgid "of Far" 6570 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6571 msgid "of Far" 6572 msgstr "fan Far" 6573 6574 #: kdecore/kcalendarsystemjalali.cpp:205 6575 #, fuzzy, kde-format 6576 #| msgctxt "of Ordibehesht short" 6577 #| msgid "of Ord" 6578 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6579 msgid "of Ord" 6580 msgstr "fan Ord" 6581 6582 #: kdecore/kcalendarsystemjalali.cpp:207 6583 #, fuzzy, kde-format 6584 #| msgctxt "of Khordad short" 6585 #| msgid "of Kho" 6586 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6587 msgid "of Kho" 6588 msgstr "fan Kho" 6589 6590 #: kdecore/kcalendarsystemjalali.cpp:209 6591 #, fuzzy, kde-format 6592 #| msgctxt "of Tir short" 6593 #| msgid "of Tir" 6594 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6595 msgid "of Tir" 6596 msgstr "fan Tir" 6597 6598 #: kdecore/kcalendarsystemjalali.cpp:211 6599 #, fuzzy, kde-format 6600 #| msgctxt "of Mordad short" 6601 #| msgid "of Mor" 6602 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6603 msgid "of Mor" 6604 msgstr "fan Mor" 6605 6606 #: kdecore/kcalendarsystemjalali.cpp:213 6607 #, fuzzy, kde-format 6608 #| msgctxt "of Shahrivar short" 6609 #| msgid "of Sha" 6610 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6611 msgid "of Sha" 6612 msgstr "fan Sha" 6613 6614 #: kdecore/kcalendarsystemjalali.cpp:215 6615 #, fuzzy, kde-format 6616 #| msgctxt "of Mehr short" 6617 #| msgid "of Meh" 6618 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6619 msgid "of Meh" 6620 msgstr "fan Meh" 6621 6622 #: kdecore/kcalendarsystemjalali.cpp:217 6623 #, fuzzy, kde-format 6624 #| msgctxt "of Aban short" 6625 #| msgid "of Aba" 6626 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6627 msgid "of Aba" 6628 msgstr "fan Aba" 6629 6630 #: kdecore/kcalendarsystemjalali.cpp:219 6631 #, fuzzy, kde-format 6632 #| msgctxt "of Azar short" 6633 #| msgid "of Aza" 6634 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6635 msgid "of Aza" 6636 msgstr "fan Aza" 6637 6638 #: kdecore/kcalendarsystemjalali.cpp:221 6639 #, fuzzy, kde-format 6640 #| msgctxt "of Dei short" 6641 #| msgid "of Dei" 6642 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6643 msgid "of Dei" 6644 msgstr "fan Dei" 6645 6646 #: kdecore/kcalendarsystemjalali.cpp:223 6647 #, fuzzy, kde-format 6648 #| msgctxt "of Bahman short" 6649 #| msgid "of Bah" 6650 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6651 msgid "of Bah" 6652 msgstr "fan Bah" 6653 6654 #: kdecore/kcalendarsystemjalali.cpp:225 6655 #, fuzzy, kde-format 6656 #| msgctxt "of Esfand short" 6657 #| msgid "of Esf" 6658 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6659 msgid "of Esf" 6660 msgstr "fan Esf" 6661 6662 #: kdecore/kcalendarsystemjalali.cpp:234 6663 #, fuzzy, kde-format 6664 #| msgctxt "Farvardin short" 6665 #| msgid "Far" 6666 msgctxt "Jalali month 1 - KLocale::ShortName" 6667 msgid "Far" 6668 msgstr "Far" 6669 6670 #: kdecore/kcalendarsystemjalali.cpp:236 6671 #, fuzzy, kde-format 6672 #| msgctxt "Ordibehesht short" 6673 #| msgid "Ord" 6674 msgctxt "Jalali month 2 - KLocale::ShortName" 6675 msgid "Ord" 6676 msgstr "Ord" 6677 6678 #: kdecore/kcalendarsystemjalali.cpp:238 6679 #, fuzzy, kde-format 6680 #| msgctxt "Khordad short" 6681 #| msgid "Kho" 6682 msgctxt "Jalali month 3 - KLocale::ShortName" 6683 msgid "Kho" 6684 msgstr "Kho" 6685 6686 #: kdecore/kcalendarsystemjalali.cpp:240 6687 #, fuzzy, kde-format 6688 #| msgctxt "Tir short" 6689 #| msgid "Tir" 6690 msgctxt "Jalali month 4 - KLocale::ShortName" 6691 msgid "Tir" 6692 msgstr "Tir" 6693 6694 #: kdecore/kcalendarsystemjalali.cpp:242 6695 #, fuzzy, kde-format 6696 #| msgctxt "Mordad short" 6697 #| msgid "Mor" 6698 msgctxt "Jalali month 5 - KLocale::ShortName" 6699 msgid "Mor" 6700 msgstr "Mor" 6701 6702 #: kdecore/kcalendarsystemjalali.cpp:244 6703 #, fuzzy, kde-format 6704 #| msgctxt "Shahrivar short" 6705 #| msgid "Sha" 6706 msgctxt "Jalali month 6 - KLocale::ShortName" 6707 msgid "Sha" 6708 msgstr "Sha" 6709 6710 #: kdecore/kcalendarsystemjalali.cpp:246 6711 #, fuzzy, kde-format 6712 #| msgctxt "Mehr short" 6713 #| msgid "Meh" 6714 msgctxt "Jalali month 7 - KLocale::ShortName" 6715 msgid "Meh" 6716 msgstr "Meh" 6717 6718 #: kdecore/kcalendarsystemjalali.cpp:248 6719 #, fuzzy, kde-format 6720 #| msgctxt "Aban short" 6721 #| msgid "Aba" 6722 msgctxt "Jalali month 8 - KLocale::ShortName" 6723 msgid "Aba" 6724 msgstr "Aba" 6725 6726 #: kdecore/kcalendarsystemjalali.cpp:250 6727 #, fuzzy, kde-format 6728 #| msgctxt "Azar short" 6729 #| msgid "Aza" 6730 msgctxt "Jalali month 9 - KLocale::ShortName" 6731 msgid "Aza" 6732 msgstr "Aza" 6733 6734 #: kdecore/kcalendarsystemjalali.cpp:252 6735 #, fuzzy, kde-format 6736 #| msgctxt "Dei short" 6737 #| msgid "Dei" 6738 msgctxt "Jalali month 10 - KLocale::ShortName" 6739 msgid "Dei" 6740 msgstr "Dei" 6741 6742 #: kdecore/kcalendarsystemjalali.cpp:254 6743 #, fuzzy, kde-format 6744 #| msgctxt "Bahman short" 6745 #| msgid "Bah" 6746 msgctxt "Jalali month 11 - KLocale::ShortName" 6747 msgid "Bah" 6748 msgstr "Bah" 6749 6750 #: kdecore/kcalendarsystemjalali.cpp:256 6751 #, fuzzy, kde-format 6752 #| msgctxt "Esfand" 6753 #| msgid "Esf" 6754 msgctxt "Jalali month 12 - KLocale::ShortName" 6755 msgid "Esf" 6756 msgstr "Esf" 6757 6758 #: kdecore/kcalendarsystemjalali.cpp:265 6759 #, fuzzy, kde-format 6760 #| msgid "of Farvardin" 6761 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6762 msgid "of Farvardin" 6763 msgstr "fan Farvardin" 6764 6765 #: kdecore/kcalendarsystemjalali.cpp:267 6766 #, fuzzy, kde-format 6767 #| msgid "of Ordibehesht" 6768 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6769 msgid "of Ordibehesht" 6770 msgstr "fan Ordibehesht" 6771 6772 #: kdecore/kcalendarsystemjalali.cpp:269 6773 #, fuzzy, kde-format 6774 #| msgid "of Khordad" 6775 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6776 msgid "of Khordad" 6777 msgstr "fan Khordad" 6778 6779 #: kdecore/kcalendarsystemjalali.cpp:271 6780 #, fuzzy, kde-format 6781 #| msgctxt "of Tir short" 6782 #| msgid "of Tir" 6783 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6784 msgid "of Tir" 6785 msgstr "fan Tir" 6786 6787 #: kdecore/kcalendarsystemjalali.cpp:273 6788 #, fuzzy, kde-format 6789 #| msgid "of Mordad" 6790 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6791 msgid "of Mordad" 6792 msgstr "fan Mordad" 6793 6794 #: kdecore/kcalendarsystemjalali.cpp:275 6795 #, fuzzy, kde-format 6796 #| msgid "of Shahrivar" 6797 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6798 msgid "of Shahrivar" 6799 msgstr "fan Shahrivar" 6800 6801 #: kdecore/kcalendarsystemjalali.cpp:277 6802 #, fuzzy, kde-format 6803 #| msgid "of Mehr" 6804 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6805 msgid "of Mehr" 6806 msgstr "fan Mehr" 6807 6808 #: kdecore/kcalendarsystemjalali.cpp:279 6809 #, fuzzy, kde-format 6810 #| msgid "of Aban" 6811 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6812 msgid "of Aban" 6813 msgstr "fan Aban" 6814 6815 #: kdecore/kcalendarsystemjalali.cpp:281 6816 #, fuzzy, kde-format 6817 #| msgid "of Azar" 6818 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6819 msgid "of Azar" 6820 msgstr "fan Azar" 6821 6822 #: kdecore/kcalendarsystemjalali.cpp:283 6823 #, fuzzy, kde-format 6824 #| msgctxt "of Dei short" 6825 #| msgid "of Dei" 6826 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6827 msgid "of Dei" 6828 msgstr "fan Dei" 6829 6830 #: kdecore/kcalendarsystemjalali.cpp:285 6831 #, fuzzy, kde-format 6832 #| msgid "of Bahman" 6833 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6834 msgid "of Bahman" 6835 msgstr "fan Bahman" 6836 6837 #: kdecore/kcalendarsystemjalali.cpp:287 6838 #, fuzzy, kde-format 6839 #| msgid "of Esfand" 6840 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6841 msgid "of Esfand" 6842 msgstr "fan Esfand" 6843 6844 #: kdecore/kcalendarsystemjalali.cpp:296 6845 #, fuzzy, kde-format 6846 #| msgid "Farvardin" 6847 msgctxt "Jalali month 1 - KLocale::LongName" 6848 msgid "Farvardin" 6849 msgstr "Farvardin" 6850 6851 #: kdecore/kcalendarsystemjalali.cpp:298 6852 #, fuzzy, kde-format 6853 #| msgid "Ordibehesht" 6854 msgctxt "Jalali month 2 - KLocale::LongName" 6855 msgid "Ordibehesht" 6856 msgstr "Ordibehesht" 6857 6858 #: kdecore/kcalendarsystemjalali.cpp:300 6859 #, fuzzy, kde-format 6860 #| msgid "Khordad" 6861 msgctxt "Jalali month 3 - KLocale::LongName" 6862 msgid "Khordad" 6863 msgstr "Khordad" 6864 6865 #: kdecore/kcalendarsystemjalali.cpp:302 6866 #, fuzzy, kde-format 6867 #| msgctxt "Tir short" 6868 #| msgid "Tir" 6869 msgctxt "Jalali month 4 - KLocale::LongName" 6870 msgid "Tir" 6871 msgstr "Tir" 6872 6873 #: kdecore/kcalendarsystemjalali.cpp:304 6874 #, fuzzy, kde-format 6875 #| msgid "Mordad" 6876 msgctxt "Jalali month 5 - KLocale::LongName" 6877 msgid "Mordad" 6878 msgstr "Mordad" 6879 6880 #: kdecore/kcalendarsystemjalali.cpp:306 6881 #, fuzzy, kde-format 6882 #| msgid "Shahrivar" 6883 msgctxt "Jalali month 6 - KLocale::LongName" 6884 msgid "Shahrivar" 6885 msgstr "Shahrivar" 6886 6887 #: kdecore/kcalendarsystemjalali.cpp:308 6888 #, fuzzy, kde-format 6889 #| msgid "Mehr" 6890 msgctxt "Jalali month 7 - KLocale::LongName" 6891 msgid "Mehr" 6892 msgstr "Mehr" 6893 6894 #: kdecore/kcalendarsystemjalali.cpp:310 6895 #, fuzzy, kde-format 6896 #| msgid "Aban" 6897 msgctxt "Jalali month 8 - KLocale::LongName" 6898 msgid "Aban" 6899 msgstr "Aban" 6900 6901 #: kdecore/kcalendarsystemjalali.cpp:312 6902 #, fuzzy, kde-format 6903 #| msgid "Azar" 6904 msgctxt "Jalali month 9 - KLocale::LongName" 6905 msgid "Azar" 6906 msgstr "Azar" 6907 6908 #: kdecore/kcalendarsystemjalali.cpp:314 6909 #, fuzzy, kde-format 6910 #| msgctxt "Dei short" 6911 #| msgid "Dei" 6912 msgctxt "Jalali month 10 - KLocale::LongName" 6913 msgid "Dei" 6914 msgstr "Dei" 6915 6916 #: kdecore/kcalendarsystemjalali.cpp:316 6917 #, fuzzy, kde-format 6918 #| msgid "Bahman" 6919 msgctxt "Jalali month 11 - KLocale::LongName" 6920 msgid "Bahman" 6921 msgstr "Bahman" 6922 6923 #: kdecore/kcalendarsystemjalali.cpp:318 6924 #, fuzzy, kde-format 6925 #| msgid "Esfand" 6926 msgctxt "Jalali month 12 - KLocale::LongName" 6927 msgid "Esfand" 6928 msgstr "Esfand" 6929 6930 #: kdecore/kcalendarsystemjalali.cpp:331 6931 #, kde-format 6932 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6933 msgid "2" 6934 msgstr "" 6935 6936 #: kdecore/kcalendarsystemjalali.cpp:333 6937 #, kde-format 6938 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6939 msgid "3" 6940 msgstr "" 6941 6942 #: kdecore/kcalendarsystemjalali.cpp:335 6943 #, kde-format 6944 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6945 msgid "4" 6946 msgstr "" 6947 6948 #: kdecore/kcalendarsystemjalali.cpp:337 6949 #, kde-format 6950 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6951 msgid "5" 6952 msgstr "" 6953 6954 #: kdecore/kcalendarsystemjalali.cpp:339 6955 #, kde-format 6956 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6957 msgid "J" 6958 msgstr "" 6959 6960 #: kdecore/kcalendarsystemjalali.cpp:341 6961 #, kde-format 6962 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6963 msgid "S" 6964 msgstr "" 6965 6966 #: kdecore/kcalendarsystemjalali.cpp:343 6967 #, kde-format 6968 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6969 msgid "1" 6970 msgstr "" 6971 6972 #: kdecore/kcalendarsystemjalali.cpp:352 6973 #, fuzzy, kde-format 6974 #| msgctxt "Do shanbe short" 6975 #| msgid "2sh" 6976 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6977 msgid "2sh" 6978 msgstr "2sh" 6979 6980 #: kdecore/kcalendarsystemjalali.cpp:354 6981 #, fuzzy, kde-format 6982 #| msgctxt "Se shanbe short" 6983 #| msgid "3sh" 6984 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6985 msgid "3sh" 6986 msgstr "3sh" 6987 6988 #: kdecore/kcalendarsystemjalali.cpp:356 6989 #, fuzzy, kde-format 6990 #| msgctxt "Chahar shanbe short" 6991 #| msgid "4sh" 6992 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6993 msgid "4sh" 6994 msgstr "4sh" 6995 6996 #: kdecore/kcalendarsystemjalali.cpp:358 6997 #, fuzzy, kde-format 6998 #| msgctxt "Panj shanbe short" 6999 #| msgid "5sh" 7000 msgctxt "Jalali weekday 4 - KLocale::ShortName" 7001 msgid "5sh" 7002 msgstr "5sh" 7003 7004 #: kdecore/kcalendarsystemjalali.cpp:360 7005 #, fuzzy, kde-format 7006 #| msgctxt "Jumee short" 7007 #| msgid "Jom" 7008 msgctxt "Jalali weekday 5 - KLocale::ShortName" 7009 msgid "Jom" 7010 msgstr "Jom" 7011 7012 #: kdecore/kcalendarsystemjalali.cpp:362 7013 #, fuzzy, kde-format 7014 #| msgid "Shanbe" 7015 msgctxt "Jalali weekday 6 - KLocale::ShortName" 7016 msgid "Shn" 7017 msgstr "Shanbe" 7018 7019 #: kdecore/kcalendarsystemjalali.cpp:364 7020 #, fuzzy, kde-format 7021 #| msgctxt "Yek-shanbe short" 7022 #| msgid "1sh" 7023 msgctxt "Jalali weekday 7 - KLocale::ShortName" 7024 msgid "1sh" 7025 msgstr "1sh" 7026 7027 #: kdecore/kcalendarsystemjalali.cpp:371 7028 #, fuzzy, kde-format 7029 #| msgid "Do shanbe" 7030 msgctxt "Jalali weekday 1 - KLocale::LongName" 7031 msgid "Do shanbe" 7032 msgstr "Do shanbe" 7033 7034 #: kdecore/kcalendarsystemjalali.cpp:373 7035 #, fuzzy, kde-format 7036 #| msgid "Se shanbe" 7037 msgctxt "Jalali weekday 2 - KLocale::LongName" 7038 msgid "Se shanbe" 7039 msgstr "Se shanbe" 7040 7041 #: kdecore/kcalendarsystemjalali.cpp:375 7042 #, fuzzy, kde-format 7043 #| msgid "Chahar shanbe" 7044 msgctxt "Jalali weekday 3 - KLocale::LongName" 7045 msgid "Chahar shanbe" 7046 msgstr "Chahar shanbe" 7047 7048 #: kdecore/kcalendarsystemjalali.cpp:377 7049 #, fuzzy, kde-format 7050 #| msgid "Panj shanbe" 7051 msgctxt "Jalali weekday 4 - KLocale::LongName" 7052 msgid "Panj shanbe" 7053 msgstr "Panj shanbe" 7054 7055 #: kdecore/kcalendarsystemjalali.cpp:379 7056 #, fuzzy, kde-format 7057 #| msgid "Jumee" 7058 msgctxt "Jalali weekday 5 - KLocale::LongName" 7059 msgid "Jumee" 7060 msgstr "Jumee" 7061 7062 #: kdecore/kcalendarsystemjalali.cpp:381 7063 #, fuzzy, kde-format 7064 #| msgid "Shanbe" 7065 msgctxt "Jalali weekday 6 - KLocale::LongName" 7066 msgid "Shanbe" 7067 msgstr "Shanbe" 7068 7069 #: kdecore/kcalendarsystemjalali.cpp:383 7070 #, fuzzy, kde-format 7071 #| msgid "Yek-shanbe" 7072 msgctxt "Jalali weekday 7 - KLocale::LongName" 7073 msgid "Yek-shanbe" 7074 msgstr "Yek-shanbe" 7075 7076 #: kdecore/kcalendarsystemjapanese.cpp:62 7077 #, kde-format 7078 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 7079 msgid "Meiji" 7080 msgstr "" 7081 7082 #: kdecore/kcalendarsystemjapanese.cpp:64 7083 #, kde-format 7084 msgctxt "" 7085 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 7086 "e.g. Meiji 1" 7087 msgid "%EC Gannen" 7088 msgstr "" 7089 7090 #: kdecore/kcalendarsystemjapanese.cpp:66 7091 #, kde-format 7092 msgctxt "" 7093 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 7094 "e.g. Meiji 22" 7095 msgid "%EC %Ey" 7096 msgstr "" 7097 7098 #: kdecore/kcalendarsystemjapanese.cpp:69 7099 #, kde-format 7100 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 7101 msgid "Taishō" 7102 msgstr "" 7103 7104 #: kdecore/kcalendarsystemjapanese.cpp:71 7105 #, kde-format 7106 msgctxt "" 7107 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 7108 "1, e.g. Taishō 1" 7109 msgid "%EC Gannen" 7110 msgstr "" 7111 7112 #: kdecore/kcalendarsystemjapanese.cpp:73 7113 #, kde-format 7114 msgctxt "" 7115 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 7116 "1, e.g. Taishō 22" 7117 msgid "%EC %Ey" 7118 msgstr "" 7119 7120 #: kdecore/kcalendarsystemjapanese.cpp:76 7121 #, fuzzy, kde-format 7122 #| msgctxt "Shahrivar short" 7123 #| msgid "Sha" 7124 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 7125 msgid "Shōwa" 7126 msgstr "Sha" 7127 7128 #: kdecore/kcalendarsystemjapanese.cpp:78 7129 #, kde-format 7130 msgctxt "" 7131 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 7132 "e.g. Shōwa 1" 7133 msgid "%EC Gannen" 7134 msgstr "" 7135 7136 #: kdecore/kcalendarsystemjapanese.cpp:80 7137 #, kde-format 7138 msgctxt "" 7139 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 7140 "e.g. Shōwa 22" 7141 msgid "%EC %Ey" 7142 msgstr "" 7143 7144 #: kdecore/kcalendarsystemjapanese.cpp:83 7145 #, kde-format 7146 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 7147 msgid "Heisei" 7148 msgstr "" 7149 7150 #: kdecore/kcalendarsystemjapanese.cpp:85 7151 #, kde-format 7152 msgctxt "" 7153 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 7154 "1, e.g. Heisei 1" 7155 msgid "%EC Gannen" 7156 msgstr "" 7157 7158 #: kdecore/kcalendarsystemjapanese.cpp:87 7159 #, kde-format 7160 msgctxt "" 7161 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 7162 "1, e.g. Heisei 22" 7163 msgid "%EC %Ey" 7164 msgstr "" 7165 7166 #: kdecore/kcalendarsystemjapanese.cpp:164 7167 #, fuzzy, kde-format 7168 msgctxt "Japanese year 1 of era" 7169 msgid "Gannen" 7170 msgstr "Grien:" 7171 7172 #: kdecore/kcalendarsystemjulian.cpp:73 7173 #, kde-format 7174 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 7175 msgid "Before Common Era" 7176 msgstr "" 7177 7178 #: kdecore/kcalendarsystemjulian.cpp:74 7179 #, kde-format 7180 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 7181 msgid "BCE" 7182 msgstr "" 7183 7184 #: kdecore/kcalendarsystemjulian.cpp:76 7185 #, kde-format 7186 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 7187 msgid "Before Christ" 7188 msgstr "" 7189 7190 #: kdecore/kcalendarsystemjulian.cpp:77 7191 #, kde-format 7192 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 7193 msgid "BC" 7194 msgstr "" 7195 7196 #: kdecore/kcalendarsystemjulian.cpp:79 7197 #, kde-format 7198 msgctxt "" 7199 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 7200 msgid "%Ey %EC" 7201 msgstr "" 7202 7203 #: kdecore/kcalendarsystemjulian.cpp:83 7204 #, kde-format 7205 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 7206 msgid "Common Era" 7207 msgstr "" 7208 7209 #: kdecore/kcalendarsystemjulian.cpp:84 7210 #, kde-format 7211 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 7212 msgid "CE" 7213 msgstr "" 7214 7215 #: kdecore/kcalendarsystemjulian.cpp:86 7216 #, kde-format 7217 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 7218 msgid "Anno Domini" 7219 msgstr "" 7220 7221 #: kdecore/kcalendarsystemjulian.cpp:87 7222 #, kde-format 7223 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 7224 msgid "AD" 7225 msgstr "" 7226 7227 #: kdecore/kcalendarsystemjulian.cpp:89 7228 #, kde-format 7229 msgctxt "" 7230 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 7231 msgid "%Ey %EC" 7232 msgstr "" 7233 7234 #: kdecore/kcalendarsystemjulian.cpp:172 7235 #, kde-format 7236 msgctxt "Julian month 1 - KLocale::NarrowName" 7237 msgid "J" 7238 msgstr "" 7239 7240 #: kdecore/kcalendarsystemjulian.cpp:174 7241 #, kde-format 7242 msgctxt "Julian month 2 - KLocale::NarrowName" 7243 msgid "F" 7244 msgstr "" 7245 7246 #: kdecore/kcalendarsystemjulian.cpp:176 7247 #, kde-format 7248 msgctxt "Julian month 3 - KLocale::NarrowName" 7249 msgid "M" 7250 msgstr "" 7251 7252 #: kdecore/kcalendarsystemjulian.cpp:178 7253 #, fuzzy, kde-format 7254 #| msgid "Av" 7255 msgctxt "Julian month 4 - KLocale::NarrowName" 7256 msgid "A" 7257 msgstr "Av" 7258 7259 #: kdecore/kcalendarsystemjulian.cpp:180 7260 #, kde-format 7261 msgctxt "Julian month 5 - KLocale::NarrowName" 7262 msgid "M" 7263 msgstr "" 7264 7265 #: kdecore/kcalendarsystemjulian.cpp:182 7266 #, kde-format 7267 msgctxt "Julian month 6 - KLocale::NarrowName" 7268 msgid "J" 7269 msgstr "" 7270 7271 #: kdecore/kcalendarsystemjulian.cpp:184 7272 #, kde-format 7273 msgctxt "Julian month 7 - KLocale::NarrowName" 7274 msgid "J" 7275 msgstr "" 7276 7277 #: kdecore/kcalendarsystemjulian.cpp:186 7278 #, fuzzy, kde-format 7279 #| msgid "Av" 7280 msgctxt "Julian month 8 - KLocale::NarrowName" 7281 msgid "A" 7282 msgstr "Av" 7283 7284 #: kdecore/kcalendarsystemjulian.cpp:188 7285 #, kde-format 7286 msgctxt "Julian month 9 - KLocale::NarrowName" 7287 msgid "S" 7288 msgstr "" 7289 7290 #: kdecore/kcalendarsystemjulian.cpp:190 7291 #, kde-format 7292 msgctxt "Julian month 10 - KLocale::NarrowName" 7293 msgid "O" 7294 msgstr "" 7295 7296 #: kdecore/kcalendarsystemjulian.cpp:192 7297 #, kde-format 7298 msgctxt "Julian month 11 - KLocale::NarrowName" 7299 msgid "N" 7300 msgstr "" 7301 7302 #: kdecore/kcalendarsystemjulian.cpp:194 7303 #, kde-format 7304 msgctxt "Julian month 12 - KLocale::NarrowName" 7305 msgid "D" 7306 msgstr "" 7307 7308 #: kdecore/kcalendarsystemjulian.cpp:203 7309 #, fuzzy, kde-format 7310 #| msgctxt "of January" 7311 #| msgid "of Jan" 7312 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 7313 msgid "of Jan" 7314 msgstr "fan jan" 7315 7316 #: kdecore/kcalendarsystemjulian.cpp:205 7317 #, fuzzy, kde-format 7318 #| msgctxt "of February" 7319 #| msgid "of Feb" 7320 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 7321 msgid "of Feb" 7322 msgstr "fan feb" 7323 7324 #: kdecore/kcalendarsystemjulian.cpp:207 7325 #, fuzzy, kde-format 7326 #| msgctxt "of March" 7327 #| msgid "of Mar" 7328 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 7329 msgid "of Mar" 7330 msgstr "fan mrt" 7331 7332 #: kdecore/kcalendarsystemjulian.cpp:209 7333 #, fuzzy, kde-format 7334 #| msgctxt "of April" 7335 #| msgid "of Apr" 7336 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7337 msgid "of Apr" 7338 msgstr "fan apr" 7339 7340 #: kdecore/kcalendarsystemjulian.cpp:211 7341 #, fuzzy, kde-format 7342 #| msgctxt "of May short" 7343 #| msgid "of May" 7344 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7345 msgid "of May" 7346 msgstr "fan mai" 7347 7348 #: kdecore/kcalendarsystemjulian.cpp:213 7349 #, fuzzy, kde-format 7350 #| msgctxt "of June" 7351 #| msgid "of Jun" 7352 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7353 msgid "of Jun" 7354 msgstr "fan jun" 7355 7356 #: kdecore/kcalendarsystemjulian.cpp:215 7357 #, fuzzy, kde-format 7358 #| msgctxt "of July" 7359 #| msgid "of Jul" 7360 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7361 msgid "of Jul" 7362 msgstr "fan jul" 7363 7364 #: kdecore/kcalendarsystemjulian.cpp:217 7365 #, fuzzy, kde-format 7366 #| msgctxt "of August" 7367 #| msgid "of Aug" 7368 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7369 msgid "of Aug" 7370 msgstr "fan aug" 7371 7372 #: kdecore/kcalendarsystemjulian.cpp:219 7373 #, fuzzy, kde-format 7374 #| msgctxt "of September" 7375 #| msgid "of Sep" 7376 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7377 msgid "of Sep" 7378 msgstr "fan sep" 7379 7380 #: kdecore/kcalendarsystemjulian.cpp:221 7381 #, fuzzy, kde-format 7382 #| msgctxt "of October" 7383 #| msgid "of Oct" 7384 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7385 msgid "of Oct" 7386 msgstr "fan okt" 7387 7388 #: kdecore/kcalendarsystemjulian.cpp:223 7389 #, fuzzy, kde-format 7390 #| msgctxt "of November" 7391 #| msgid "of Nov" 7392 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7393 msgid "of Nov" 7394 msgstr "fan nov" 7395 7396 #: kdecore/kcalendarsystemjulian.cpp:225 7397 #, fuzzy, kde-format 7398 #| msgctxt "of December" 7399 #| msgid "of Dec" 7400 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7401 msgid "of Dec" 7402 msgstr "fan des" 7403 7404 #: kdecore/kcalendarsystemjulian.cpp:234 7405 #, fuzzy, kde-format 7406 #| msgctxt "January" 7407 #| msgid "Jan" 7408 msgctxt "Julian month 1 - KLocale::ShortName" 7409 msgid "Jan" 7410 msgstr "jan" 7411 7412 #: kdecore/kcalendarsystemjulian.cpp:236 7413 #, fuzzy, kde-format 7414 #| msgctxt "February" 7415 #| msgid "Feb" 7416 msgctxt "Julian month 2 - KLocale::ShortName" 7417 msgid "Feb" 7418 msgstr "feb" 7419 7420 #: kdecore/kcalendarsystemjulian.cpp:238 7421 #, fuzzy, kde-format 7422 #| msgctxt "March" 7423 #| msgid "Mar" 7424 msgctxt "Julian month 3 - KLocale::ShortName" 7425 msgid "Mar" 7426 msgstr "mrt" 7427 7428 #: kdecore/kcalendarsystemjulian.cpp:240 7429 #, fuzzy, kde-format 7430 #| msgctxt "April" 7431 #| msgid "Apr" 7432 msgctxt "Julian month 4 - KLocale::ShortName" 7433 msgid "Apr" 7434 msgstr "apr" 7435 7436 #: kdecore/kcalendarsystemjulian.cpp:242 7437 #, fuzzy, kde-format 7438 #| msgctxt "May short" 7439 #| msgid "May" 7440 msgctxt "Julian month 5 - KLocale::ShortName" 7441 msgid "May" 7442 msgstr "mai" 7443 7444 #: kdecore/kcalendarsystemjulian.cpp:244 7445 #, fuzzy, kde-format 7446 #| msgctxt "June" 7447 #| msgid "Jun" 7448 msgctxt "Julian month 6 - KLocale::ShortName" 7449 msgid "Jun" 7450 msgstr "jun" 7451 7452 #: kdecore/kcalendarsystemjulian.cpp:246 7453 #, fuzzy, kde-format 7454 #| msgctxt "July" 7455 #| msgid "Jul" 7456 msgctxt "Julian month 7 - KLocale::ShortName" 7457 msgid "Jul" 7458 msgstr "jul" 7459 7460 #: kdecore/kcalendarsystemjulian.cpp:248 7461 #, fuzzy, kde-format 7462 #| msgctxt "August" 7463 #| msgid "Aug" 7464 msgctxt "Julian month 8 - KLocale::ShortName" 7465 msgid "Aug" 7466 msgstr "aug" 7467 7468 #: kdecore/kcalendarsystemjulian.cpp:250 7469 #, fuzzy, kde-format 7470 #| msgctxt "September" 7471 #| msgid "Sep" 7472 msgctxt "Julian month 9 - KLocale::ShortName" 7473 msgid "Sep" 7474 msgstr "sep" 7475 7476 #: kdecore/kcalendarsystemjulian.cpp:252 7477 #, fuzzy, kde-format 7478 #| msgctxt "October" 7479 #| msgid "Oct" 7480 msgctxt "Julian month 10 - KLocale::ShortName" 7481 msgid "Oct" 7482 msgstr "okt" 7483 7484 #: kdecore/kcalendarsystemjulian.cpp:254 7485 #, fuzzy, kde-format 7486 #| msgctxt "November" 7487 #| msgid "Nov" 7488 msgctxt "Julian month 11 - KLocale::ShortName" 7489 msgid "Nov" 7490 msgstr "nov" 7491 7492 #: kdecore/kcalendarsystemjulian.cpp:256 7493 #, fuzzy, kde-format 7494 #| msgctxt "December" 7495 #| msgid "Dec" 7496 msgctxt "Julian month 12 - KLocale::ShortName" 7497 msgid "Dec" 7498 msgstr "des" 7499 7500 #: kdecore/kcalendarsystemjulian.cpp:265 7501 #, fuzzy, kde-format 7502 #| msgid "of January" 7503 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7504 msgid "of January" 7505 msgstr "fan jannewaris" 7506 7507 #: kdecore/kcalendarsystemjulian.cpp:267 7508 #, fuzzy, kde-format 7509 #| msgid "of February" 7510 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7511 msgid "of February" 7512 msgstr "fan febrewaris" 7513 7514 #: kdecore/kcalendarsystemjulian.cpp:269 7515 #, fuzzy, kde-format 7516 #| msgid "of March" 7517 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7518 msgid "of March" 7519 msgstr "fan maart" 7520 7521 #: kdecore/kcalendarsystemjulian.cpp:271 7522 #, fuzzy, kde-format 7523 #| msgid "of April" 7524 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7525 msgid "of April" 7526 msgstr "fan april" 7527 7528 #: kdecore/kcalendarsystemjulian.cpp:273 7529 #, fuzzy, kde-format 7530 #| msgctxt "of May short" 7531 #| msgid "of May" 7532 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7533 msgid "of May" 7534 msgstr "fan mai" 7535 7536 #: kdecore/kcalendarsystemjulian.cpp:275 7537 #, fuzzy, kde-format 7538 #| msgid "of June" 7539 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7540 msgid "of June" 7541 msgstr "fan juny" 7542 7543 #: kdecore/kcalendarsystemjulian.cpp:277 7544 #, fuzzy, kde-format 7545 #| msgid "of July" 7546 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7547 msgid "of July" 7548 msgstr "fan july" 7549 7550 #: kdecore/kcalendarsystemjulian.cpp:279 7551 #, fuzzy, kde-format 7552 #| msgid "of August" 7553 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7554 msgid "of August" 7555 msgstr "fan augustus" 7556 7557 #: kdecore/kcalendarsystemjulian.cpp:281 7558 #, fuzzy, kde-format 7559 #| msgid "of September" 7560 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7561 msgid "of September" 7562 msgstr "fan septimber" 7563 7564 #: kdecore/kcalendarsystemjulian.cpp:283 7565 #, fuzzy, kde-format 7566 #| msgid "of October" 7567 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7568 msgid "of October" 7569 msgstr "fan oktober" 7570 7571 #: kdecore/kcalendarsystemjulian.cpp:285 7572 #, fuzzy, kde-format 7573 #| msgid "of November" 7574 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7575 msgid "of November" 7576 msgstr "fan novimber" 7577 7578 #: kdecore/kcalendarsystemjulian.cpp:287 7579 #, fuzzy, kde-format 7580 #| msgid "of December" 7581 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7582 msgid "of December" 7583 msgstr "fan desimber" 7584 7585 #: kdecore/kcalendarsystemjulian.cpp:296 7586 #, fuzzy, kde-format 7587 #| msgid "January" 7588 msgctxt "Julian month 1 - KLocale::LongName" 7589 msgid "January" 7590 msgstr "Jannewaris" 7591 7592 #: kdecore/kcalendarsystemjulian.cpp:298 7593 #, fuzzy, kde-format 7594 #| msgid "February" 7595 msgctxt "Julian month 2 - KLocale::LongName" 7596 msgid "February" 7597 msgstr "Febrewaris" 7598 7599 #: kdecore/kcalendarsystemjulian.cpp:300 7600 #, fuzzy, kde-format 7601 #| msgctxt "March long" 7602 #| msgid "March" 7603 msgctxt "Julian month 3 - KLocale::LongName" 7604 msgid "March" 7605 msgstr "Maart" 7606 7607 #: kdecore/kcalendarsystemjulian.cpp:302 7608 #, fuzzy, kde-format 7609 #| msgid "April" 7610 msgctxt "Julian month 4 - KLocale::LongName" 7611 msgid "April" 7612 msgstr "April" 7613 7614 #: kdecore/kcalendarsystemjulian.cpp:304 7615 #, fuzzy, kde-format 7616 #| msgctxt "May short" 7617 #| msgid "May" 7618 msgctxt "Julian month 5 - KLocale::LongName" 7619 msgid "May" 7620 msgstr "mai" 7621 7622 #: kdecore/kcalendarsystemjulian.cpp:306 7623 #, fuzzy, kde-format 7624 #| msgid "June" 7625 msgctxt "Julian month 6 - KLocale::LongName" 7626 msgid "June" 7627 msgstr "Juny" 7628 7629 #: kdecore/kcalendarsystemjulian.cpp:308 7630 #, fuzzy, kde-format 7631 #| msgid "July" 7632 msgctxt "Julian month 7 - KLocale::LongName" 7633 msgid "July" 7634 msgstr "July" 7635 7636 #: kdecore/kcalendarsystemjulian.cpp:310 7637 #, fuzzy, kde-format 7638 #| msgctxt "August long" 7639 #| msgid "August" 7640 msgctxt "Julian month 8 - KLocale::LongName" 7641 msgid "August" 7642 msgstr "Augustus" 7643 7644 #: kdecore/kcalendarsystemjulian.cpp:312 7645 #, fuzzy, kde-format 7646 #| msgid "September" 7647 msgctxt "Julian month 9 - KLocale::LongName" 7648 msgid "September" 7649 msgstr "Septimber" 7650 7651 #: kdecore/kcalendarsystemjulian.cpp:314 7652 #, fuzzy, kde-format 7653 #| msgid "October" 7654 msgctxt "Julian month 10 - KLocale::LongName" 7655 msgid "October" 7656 msgstr "Oktober" 7657 7658 #: kdecore/kcalendarsystemjulian.cpp:316 7659 #, fuzzy, kde-format 7660 #| msgid "November" 7661 msgctxt "Julian month 11 - KLocale::LongName" 7662 msgid "November" 7663 msgstr "Novimber" 7664 7665 #: kdecore/kcalendarsystemjulian.cpp:318 7666 #, fuzzy, kde-format 7667 #| msgid "December" 7668 msgctxt "Julian month 12 - KLocale::LongName" 7669 msgid "December" 7670 msgstr "Desimber" 7671 7672 #: kdecore/kcalendarsystemjulian.cpp:331 7673 #, kde-format 7674 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7675 msgid "M" 7676 msgstr "" 7677 7678 #: kdecore/kcalendarsystemjulian.cpp:333 7679 #, kde-format 7680 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7681 msgid "T" 7682 msgstr "" 7683 7684 #: kdecore/kcalendarsystemjulian.cpp:335 7685 #, kde-format 7686 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7687 msgid "W" 7688 msgstr "" 7689 7690 #: kdecore/kcalendarsystemjulian.cpp:337 7691 #, kde-format 7692 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7693 msgid "T" 7694 msgstr "" 7695 7696 #: kdecore/kcalendarsystemjulian.cpp:339 7697 #, kde-format 7698 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7699 msgid "F" 7700 msgstr "" 7701 7702 #: kdecore/kcalendarsystemjulian.cpp:341 7703 #, kde-format 7704 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7705 msgid "S" 7706 msgstr "" 7707 7708 #: kdecore/kcalendarsystemjulian.cpp:343 7709 #, kde-format 7710 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7711 msgid "S" 7712 msgstr "" 7713 7714 #: kdecore/kcalendarsystemjulian.cpp:352 7715 #, fuzzy, kde-format 7716 #| msgctxt "Monday" 7717 #| msgid "Mon" 7718 msgctxt "Julian weekday 1 - KLocale::ShortName" 7719 msgid "Mon" 7720 msgstr "mo" 7721 7722 #: kdecore/kcalendarsystemjulian.cpp:354 7723 #, fuzzy, kde-format 7724 #| msgctxt "Tuesday" 7725 #| msgid "Tue" 7726 msgctxt "Julian weekday 2 - KLocale::ShortName" 7727 msgid "Tue" 7728 msgstr "ti" 7729 7730 #: kdecore/kcalendarsystemjulian.cpp:356 7731 #, fuzzy, kde-format 7732 #| msgctxt "Wednesday" 7733 #| msgid "Wed" 7734 msgctxt "Julian weekday 3 - KLocale::ShortName" 7735 msgid "Wed" 7736 msgstr "wo" 7737 7738 #: kdecore/kcalendarsystemjulian.cpp:358 7739 #, fuzzy, kde-format 7740 #| msgctxt "Thursday" 7741 #| msgid "Thu" 7742 msgctxt "Julian weekday 4 - KLocale::ShortName" 7743 msgid "Thu" 7744 msgstr "to" 7745 7746 #: kdecore/kcalendarsystemjulian.cpp:360 7747 #, fuzzy, kde-format 7748 #| msgctxt "Friday" 7749 #| msgid "Fri" 7750 msgctxt "Julian weekday 5 - KLocale::ShortName" 7751 msgid "Fri" 7752 msgstr "fr" 7753 7754 #: kdecore/kcalendarsystemjulian.cpp:362 7755 #, fuzzy, kde-format 7756 #| msgctxt "Saturday" 7757 #| msgid "Sat" 7758 msgctxt "Julian weekday 6 - KLocale::ShortName" 7759 msgid "Sat" 7760 msgstr "sno" 7761 7762 #: kdecore/kcalendarsystemjulian.cpp:364 7763 #, fuzzy, kde-format 7764 #| msgctxt "Sunday" 7765 #| msgid "Sun" 7766 msgctxt "Julian weekday 7 - KLocale::ShortName" 7767 msgid "Sun" 7768 msgstr "sne" 7769 7770 #: kdecore/kcalendarsystemjulian.cpp:371 7771 #, fuzzy, kde-format 7772 #| msgid "Monday" 7773 msgctxt "Julian weekday 1 - KLocale::LongName" 7774 msgid "Monday" 7775 msgstr "moandei" 7776 7777 #: kdecore/kcalendarsystemjulian.cpp:373 7778 #, fuzzy, kde-format 7779 #| msgid "Tuesday" 7780 msgctxt "Julian weekday 2 - KLocale::LongName" 7781 msgid "Tuesday" 7782 msgstr "tiisdei" 7783 7784 #: kdecore/kcalendarsystemjulian.cpp:375 7785 #, fuzzy, kde-format 7786 #| msgid "Wednesday" 7787 msgctxt "Julian weekday 3 - KLocale::LongName" 7788 msgid "Wednesday" 7789 msgstr "woansdei" 7790 7791 #: kdecore/kcalendarsystemjulian.cpp:377 7792 #, fuzzy, kde-format 7793 #| msgid "Thursday" 7794 msgctxt "Julian weekday 4 - KLocale::LongName" 7795 msgid "Thursday" 7796 msgstr "tongersdei" 7797 7798 #: kdecore/kcalendarsystemjulian.cpp:379 7799 #, fuzzy, kde-format 7800 #| msgid "Friday" 7801 msgctxt "Julian weekday 5 - KLocale::LongName" 7802 msgid "Friday" 7803 msgstr "freed" 7804 7805 #: kdecore/kcalendarsystemjulian.cpp:381 7806 #, fuzzy, kde-format 7807 #| msgid "Saturday" 7808 msgctxt "Julian weekday 6 - KLocale::LongName" 7809 msgid "Saturday" 7810 msgstr "sneon" 7811 7812 #: kdecore/kcalendarsystemjulian.cpp:383 7813 #, fuzzy, kde-format 7814 #| msgid "Sunday" 7815 msgctxt "Julian weekday 7 - KLocale::LongName" 7816 msgid "Sunday" 7817 msgstr "snein" 7818 7819 #: kdecore/kcalendarsystemminguo.cpp:57 7820 #, kde-format 7821 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7822 msgid "Republic of China Era" 7823 msgstr "" 7824 7825 #: kdecore/kcalendarsystemminguo.cpp:58 7826 #, kde-format 7827 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7828 msgid "ROC" 7829 msgstr "" 7830 7831 #: kdecore/kcalendarsystemminguo.cpp:59 7832 #, kde-format 7833 msgctxt "" 7834 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7835 msgid "%EC %Ey" 7836 msgstr "" 7837 7838 #: kdecore/kcalendarsystemthai.cpp:58 7839 #, kde-format 7840 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7841 msgid "Buddhist Era" 7842 msgstr "" 7843 7844 #: kdecore/kcalendarsystemthai.cpp:59 7845 #, kde-format 7846 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7847 msgid "BE" 7848 msgstr "" 7849 7850 #: kdecore/kcalendarsystemthai.cpp:60 7851 #, kde-format 7852 msgctxt "" 7853 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7854 msgid "%Ey %EC" 7855 msgstr "" 7856 7857 #: kdecore/kcmdlineargs.cpp:278 7858 #, kde-format 7859 msgid "Use the X-server display 'displayname'" 7860 msgstr "Brûk de X-server-display 'displayname'" 7861 7862 #: kdecore/kcmdlineargs.cpp:281 7863 #, kde-format 7864 msgid "Restore the application for the given 'sessionId'" 7865 msgstr "De applikaasje reparearje foar de beskate 'sessionId'." 7866 7867 #: kdecore/kcmdlineargs.cpp:282 7868 #, kde-format 7869 msgid "" 7870 "Causes the application to install a private color\n" 7871 "map on an 8-bit display" 7872 msgstr "" 7873 "Soarget der foar dat de applikaasje in privee\n" 7874 "kleurepallet ynstallearret op in 8-bit byldskerm" 7875 7876 #: kdecore/kcmdlineargs.cpp:283 7877 #, kde-format 7878 msgid "" 7879 "Limits the number of colors allocated in the color\n" 7880 "cube on an 8-bit display, if the application is\n" 7881 "using the QApplication::ManyColor color\n" 7882 "specification" 7883 msgstr "" 7884 "Beheint it tal kleuren dat tawiisd is oan it\n" 7885 "kleurepalet op in 8-bit byldskerm as de applikaasje de\n" 7886 "'QApplication::ManyColor' kleurespesifikaasje brûkt" 7887 7888 #: kdecore/kcmdlineargs.cpp:284 7889 #, kde-format 7890 msgid "tells Qt to never grab the mouse or the keyboard" 7891 msgstr "fertelt QT dat dy nea de mûs of it toetseboerd oernimme mei" 7892 7893 #: kdecore/kcmdlineargs.cpp:285 7894 #, kde-format 7895 msgid "" 7896 "running under a debugger can cause an implicit\n" 7897 "-nograb, use -dograb to override" 7898 msgstr "" 7899 "it útfieren ûnder in debugger kin in ymplisite\n" 7900 "-nograb feroarsaakje, brûk -dograb om dit oer te skriuwen." 7901 7902 #: kdecore/kcmdlineargs.cpp:286 7903 #, kde-format 7904 msgid "switches to synchronous mode for debugging" 7905 msgstr "giet oer nei de syngroane modus foar it debuggen" 7906 7907 #: kdecore/kcmdlineargs.cpp:288 7908 #, kde-format 7909 msgid "defines the application font" 7910 msgstr "definiearret it lettertype foar de applikaasjes" 7911 7912 #: kdecore/kcmdlineargs.cpp:290 7913 #, kde-format 7914 msgid "" 7915 "sets the default background color and an\n" 7916 "application palette (light and dark shades are\n" 7917 "calculated)" 7918 msgstr "" 7919 "bepaalt de standert eftergrûnkleur en in\n" 7920 "applikaasjepalet. (ljochte en tsjustere skaden wurde\n" 7921 "berekkene)" 7922 7923 #: kdecore/kcmdlineargs.cpp:292 7924 #, kde-format 7925 msgid "sets the default foreground color" 7926 msgstr "bepaalt de standert kleur fan de foargrûn" 7927 7928 #: kdecore/kcmdlineargs.cpp:294 7929 #, kde-format 7930 msgid "sets the default button color" 7931 msgstr "bepaalt de standert kleur fan de knoppen" 7932 7933 #: kdecore/kcmdlineargs.cpp:295 7934 #, kde-format 7935 msgid "sets the application name" 7936 msgstr "bepaalt de namme fan de applikaasje" 7937 7938 #: kdecore/kcmdlineargs.cpp:296 7939 #, kde-format 7940 msgid "sets the application title (caption)" 7941 msgstr "bepaalt de titel fan de applikaasje (titelbalke)" 7942 7943 #: kdecore/kcmdlineargs.cpp:297 7944 #, kde-format 7945 msgid "load the testability framework" 7946 msgstr "" 7947 7948 #: kdecore/kcmdlineargs.cpp:299 7949 #, kde-format 7950 msgid "" 7951 "forces the application to use a TrueColor visual on\n" 7952 "an 8-bit display" 7953 msgstr "" 7954 "soarget der foar dat de applikaasje 24 bits kleurwerjefte brûkt\n" 7955 "op in 8-bits byldskerm" 7956 7957 #: kdecore/kcmdlineargs.cpp:300 7958 #, kde-format 7959 msgid "" 7960 "sets XIM (X Input Method) input style. Possible\n" 7961 "values are onthespot, overthespot, offthespot and\n" 7962 "root" 7963 msgstr "" 7964 "bepaalt de XIM-ynfierstyl (X Ynfier Metoade).\n" 7965 "Mooglike wearden binne onthespot, overthespot, offthespot en\n" 7966 "root." 7967 7968 #: kdecore/kcmdlineargs.cpp:301 7969 #, kde-format 7970 msgid "set XIM server" 7971 msgstr "XIM-tsjinner ynstelle" 7972 7973 #: kdecore/kcmdlineargs.cpp:302 7974 #, kde-format 7975 msgid "disable XIM" 7976 msgstr "XIM útskeakelje" 7977 7978 #: kdecore/kcmdlineargs.cpp:304 7979 #, kde-format 7980 msgid "mirrors the whole layout of widgets" 7981 msgstr "spegelet de hiele opmaak fan dinkjes (widgets)" 7982 7983 #: kdecore/kcmdlineargs.cpp:305 7984 #, kde-format 7985 msgid "applies the Qt stylesheet to the application widgets" 7986 msgstr "sil de QT stylblêd tapasse op de programmawidget" 7987 7988 #: kdecore/kcmdlineargs.cpp:306 7989 #, kde-format 7990 msgid "" 7991 "use a different graphics system instead of the default one, options are " 7992 "raster and opengl (experimental)" 7993 msgstr "" 7994 7995 #: kdecore/kcmdlineargs.cpp:307 7996 #, kde-format 7997 msgid "" 7998 "QML JS debugger information. Application must be\n" 7999 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 8000 "enabled" 8001 msgstr "" 8002 8003 #: kdecore/kcmdlineargs.cpp:308 8004 #, kde-format 8005 msgid "The windowing system platform (e.g. xcb or wayland)" 8006 msgstr "" 8007 8008 #: kdecore/kcmdlineargs.cpp:310 8009 #, kde-format 8010 msgid "Use 'caption' as name in the titlebar" 8011 msgstr "Brûk 'caption' as namme yn de titelbalke" 8012 8013 #: kdecore/kcmdlineargs.cpp:311 8014 #, kde-format 8015 msgid "Use 'icon' as the application icon" 8016 msgstr "Brûk 'icon' as applikaasjebyldkaike" 8017 8018 #: kdecore/kcmdlineargs.cpp:312 8019 #, kde-format 8020 msgid "Use alternative configuration file" 8021 msgstr "Alternatyf konfiguraasjetriem brûke" 8022 8023 #: kdecore/kcmdlineargs.cpp:313 8024 #, kde-format 8025 msgid "Disable crash handler, to get core dumps" 8026 msgstr "Skeakelje de 'crashferwurker' út om 'core dumps' te krijen" 8027 8028 #: kdecore/kcmdlineargs.cpp:315 8029 #, kde-format 8030 msgid "Waits for a WM_NET compatible windowmanager" 8031 msgstr "Wachtsje op in mei WM_NET te kombinearjen finsterbehearder" 8032 8033 #: kdecore/kcmdlineargs.cpp:317 8034 #, kde-format 8035 msgid "sets the application GUI style" 8036 msgstr "Bepaalt de GUI-styl fan de applikaasje" 8037 8038 #: kdecore/kcmdlineargs.cpp:318 8039 #, kde-format 8040 msgid "" 8041 "sets the client geometry of the main widget - see man X for the argument " 8042 "format (usually WidthxHeight+XPos+YPos)" 8043 msgstr "" 8044 "Beskied de kliïnt ôfmjittingen fan de haadwidget - sjoch de mansided fan X " 8045 "foar mear ynformaasje oer de argumintopmaak (gewoanlik WidthxHeight+XPos" 8046 "+YPos)" 8047 8048 #: kdecore/kcmdlineargs.cpp:436 8049 #, kde-format 8050 msgid "KDE Application" 8051 msgstr "KDE applikaasje:" 8052 8053 #: kdecore/kcmdlineargs.cpp:497 8054 #, kde-format 8055 msgid "Qt" 8056 msgstr "Qt" 8057 8058 #: kdecore/kcmdlineargs.cpp:500 8059 #, kde-format 8060 msgid "KDE" 8061 msgstr "KDE" 8062 8063 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 8064 #, fuzzy, kde-format 8065 #| msgid "ERROR: Unknown protocol '%1'" 8066 msgid "Unknown option '%1'." 8067 msgstr "FLATER: Unbekend protokol '%1'" 8068 8069 #: kdecore/kcmdlineargs.cpp:841 8070 #, kde-format 8071 msgctxt "@info:shell %1 is cmdoption name" 8072 msgid "'%1' missing." 8073 msgstr "'%1' mist." 8074 8075 #: kdecore/kcmdlineargs.cpp:895 8076 #, kde-format 8077 msgctxt "" 8078 "@info:shell message on appcmd --version; do not translate 'Development " 8079 "Platform'%3 application name, other %n version strings" 8080 msgid "" 8081 "Qt: %1\n" 8082 "KDE Frameworks: %2\n" 8083 "%3: %4\n" 8084 msgstr "" 8085 8086 #: kdecore/kcmdlineargs.cpp:921 8087 #, kde-format 8088 msgctxt "the 2nd argument is a list of name+address, one on each line" 8089 msgid "" 8090 "%1 was written by\n" 8091 "%2" 8092 msgstr "" 8093 "%1 is skreaun troch\n" 8094 "%2" 8095 8096 #: kdecore/kcmdlineargs.cpp:924 8097 #, kde-format 8098 msgid "This application was written by somebody who wants to remain anonymous." 8099 msgstr "" 8100 8101 #: kdecore/kcmdlineargs.cpp:929 8102 #, kde-format 8103 msgid "Please use http://bugs.kde.org to report bugs.\n" 8104 msgstr "" 8105 8106 #: kdecore/kcmdlineargs.cpp:931 8107 #, kde-format 8108 msgid "Please report bugs to %1.\n" 8109 msgstr "" 8110 8111 #: kdecore/kcmdlineargs.cpp:961 8112 #, kde-format 8113 msgid "Unexpected argument '%1'." 8114 msgstr "" 8115 8116 #: kdecore/kcmdlineargs.cpp:1074 8117 #, kde-format 8118 msgid "Use --help to get a list of available command line options." 8119 msgstr "" 8120 8121 #: kdecore/kcmdlineargs.cpp:1096 8122 #, kde-format 8123 msgid "[options] " 8124 msgstr "" 8125 8126 #: kdecore/kcmdlineargs.cpp:1101 8127 #, kde-format 8128 msgid "[%1-options]" 8129 msgstr "" 8130 8131 #: kdecore/kcmdlineargs.cpp:1122 8132 #, kde-format 8133 msgid "Usage: %1 %2\n" 8134 msgstr "" 8135 8136 #: kdecore/kcmdlineargs.cpp:1125 8137 #, kde-format 8138 msgid "" 8139 "\n" 8140 "Generic options:\n" 8141 msgstr "" 8142 8143 #: kdecore/kcmdlineargs.cpp:1127 8144 #, kde-format 8145 msgid "Show help about options" 8146 msgstr "" 8147 8148 #: kdecore/kcmdlineargs.cpp:1133 8149 #, kde-format 8150 msgid "Show %1 specific options" 8151 msgstr "" 8152 8153 #: kdecore/kcmdlineargs.cpp:1140 8154 #, kde-format 8155 msgid "Show all options" 8156 msgstr "" 8157 8158 #: kdecore/kcmdlineargs.cpp:1141 8159 #, kde-format 8160 msgid "Show author information" 8161 msgstr "" 8162 8163 #: kdecore/kcmdlineargs.cpp:1142 8164 #, kde-format 8165 msgid "Show version information" 8166 msgstr "" 8167 8168 #: kdecore/kcmdlineargs.cpp:1143 8169 #, kde-format 8170 msgid "Show license information" 8171 msgstr "" 8172 8173 #: kdecore/kcmdlineargs.cpp:1144 8174 #, kde-format 8175 msgid "End of options" 8176 msgstr "" 8177 8178 #: kdecore/kcmdlineargs.cpp:1164 8179 #, kde-format 8180 msgid "" 8181 "\n" 8182 "%1 options:\n" 8183 msgstr "" 8184 8185 #: kdecore/kcmdlineargs.cpp:1166 8186 #, kde-format 8187 msgid "" 8188 "\n" 8189 "Options:\n" 8190 msgstr "" 8191 8192 #: kdecore/kcmdlineargs.cpp:1219 8193 #, kde-format 8194 msgid "" 8195 "\n" 8196 "Arguments:\n" 8197 msgstr "" 8198 8199 #: kdecore/kcmdlineargs.cpp:1580 8200 #, kde-format 8201 msgid "The files/URLs opened by the application will be deleted after use" 8202 msgstr "" 8203 "De triemmen/URL-adressen iepene troch de tapassing sille nei gebrûk " 8204 "fuortsmiten wurde" 8205 8206 #: kdecore/kcmdlineargs.cpp:1581 8207 #, kde-format 8208 msgid "KDE-tempfile" 8209 msgstr "KDE-temptriem" 8210 8211 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8212 #: kdecore/kdatetime.cpp:2985 8213 #, fuzzy, kde-format 8214 msgid "am" 8215 msgstr "am" 8216 8217 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 8218 #: kdecore/kdatetime.cpp:2990 8219 #, kde-format 8220 msgid "pm" 8221 msgstr "pm" 8222 8223 #: kdecore/klibloader.cpp:100 8224 #, kde-format 8225 msgid "Library \"%1\" not found" 8226 msgstr "Bibleteek \"%1\" net fûn" 8227 8228 #: kdecore/klocale_kde.cpp:785 8229 #, kde-format 8230 msgctxt "digit set" 8231 msgid "Arabic-Indic" 8232 msgstr "Arabysk-indysk" 8233 8234 #: kdecore/klocale_kde.cpp:788 8235 #, kde-format 8236 msgctxt "digit set" 8237 msgid "Bengali" 8238 msgstr "Bengaalsk" 8239 8240 #: kdecore/klocale_kde.cpp:791 8241 #, kde-format 8242 msgctxt "digit set" 8243 msgid "Devanagari" 8244 msgstr "Devanagarysk" 8245 8246 #: kdecore/klocale_kde.cpp:794 8247 #, kde-format 8248 msgctxt "digit set" 8249 msgid "Eastern Arabic-Indic" 8250 msgstr "Eastlik Arabysk-indysk" 8251 8252 #: kdecore/klocale_kde.cpp:797 8253 #, kde-format 8254 msgctxt "digit set" 8255 msgid "Gujarati" 8256 msgstr "Gujaratysk" 8257 8258 #: kdecore/klocale_kde.cpp:800 8259 #, kde-format 8260 msgctxt "digit set" 8261 msgid "Gurmukhi" 8262 msgstr "Gurmukhi" 8263 8264 #: kdecore/klocale_kde.cpp:803 8265 #, kde-format 8266 msgctxt "digit set" 8267 msgid "Kannada" 8268 msgstr "Kannada" 8269 8270 #: kdecore/klocale_kde.cpp:806 8271 #, kde-format 8272 msgctxt "digit set" 8273 msgid "Khmer" 8274 msgstr "Khmer" 8275 8276 #: kdecore/klocale_kde.cpp:809 8277 #, kde-format 8278 msgctxt "digit set" 8279 msgid "Malayalam" 8280 msgstr "Malayalam" 8281 8282 #: kdecore/klocale_kde.cpp:812 8283 #, kde-format 8284 msgctxt "digit set" 8285 msgid "Oriya" 8286 msgstr "Oriya" 8287 8288 #: kdecore/klocale_kde.cpp:815 8289 #, kde-format 8290 msgctxt "digit set" 8291 msgid "Tamil" 8292 msgstr "Tamil" 8293 8294 #: kdecore/klocale_kde.cpp:818 8295 #, kde-format 8296 msgctxt "digit set" 8297 msgid "Telugu" 8298 msgstr "Telûgû" 8299 8300 #: kdecore/klocale_kde.cpp:821 8301 #, fuzzy, kde-format 8302 #| msgid "R. Thaani" 8303 msgctxt "digit set" 8304 msgid "Thai" 8305 msgstr "R. Thaani" 8306 8307 #: kdecore/klocale_kde.cpp:824 8308 #, kde-format 8309 msgctxt "digit set" 8310 msgid "Arabic" 8311 msgstr "Arabysk" 8312 8313 #: kdecore/klocale_kde.cpp:829 8314 #, kde-format 8315 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 8316 msgid "%1 (%2)" 8317 msgstr "%1 (%2)" 8318 8319 #. i18n: comments below, they are used by the 8320 #. translators. 8321 #. This prefix is shared by all current dialects. 8322 #. i18n: Dumb message, avoid any markup or scripting. 8323 #: kdecore/klocale_kde.cpp:1327 8324 #, kde-format 8325 msgctxt "size in bytes" 8326 msgid "%1 B" 8327 msgstr "%1 B" 8328 8329 #. i18n: Dumb message, avoid any markup or scripting. 8330 #: kdecore/klocale_kde.cpp:1332 8331 #, kde-format 8332 msgctxt "size in 1000 bytes" 8333 msgid "%1 kB" 8334 msgstr "%1 kB" 8335 8336 #. i18n: Dumb message, avoid any markup or scripting. 8337 #: kdecore/klocale_kde.cpp:1334 8338 #, kde-format 8339 msgctxt "size in 10^6 bytes" 8340 msgid "%1 MB" 8341 msgstr "%1 MB" 8342 8343 #. i18n: Dumb message, avoid any markup or scripting. 8344 #: kdecore/klocale_kde.cpp:1336 8345 #, kde-format 8346 msgctxt "size in 10^9 bytes" 8347 msgid "%1 GB" 8348 msgstr "%1 GB" 8349 8350 #. i18n: Dumb message, avoid any markup or scripting. 8351 #: kdecore/klocale_kde.cpp:1338 8352 #, kde-format 8353 msgctxt "size in 10^12 bytes" 8354 msgid "%1 TB" 8355 msgstr "%1 TB" 8356 8357 #. i18n: Dumb message, avoid any markup or scripting. 8358 #: kdecore/klocale_kde.cpp:1340 8359 #, kde-format 8360 msgctxt "size in 10^15 bytes" 8361 msgid "%1 PB" 8362 msgstr "%1 PB" 8363 8364 #. i18n: Dumb message, avoid any markup or scripting. 8365 #: kdecore/klocale_kde.cpp:1342 8366 #, kde-format 8367 msgctxt "size in 10^18 bytes" 8368 msgid "%1 EB" 8369 msgstr "%1 EB" 8370 8371 #. i18n: Dumb message, avoid any markup or scripting. 8372 #: kdecore/klocale_kde.cpp:1344 8373 #, kde-format 8374 msgctxt "size in 10^21 bytes" 8375 msgid "%1 ZB" 8376 msgstr "%1 ZB" 8377 8378 #. i18n: Dumb message, avoid any markup or scripting. 8379 #: kdecore/klocale_kde.cpp:1346 8380 #, kde-format 8381 msgctxt "size in 10^24 bytes" 8382 msgid "%1 YB" 8383 msgstr "%1 YB" 8384 8385 #. i18n: Dumb message, avoid any markup or scripting. 8386 #: kdecore/klocale_kde.cpp:1351 8387 #, kde-format 8388 msgctxt "memory size in 1024 bytes" 8389 msgid "%1 KB" 8390 msgstr "%1 KB" 8391 8392 #. i18n: Dumb message, avoid any markup or scripting. 8393 #: kdecore/klocale_kde.cpp:1353 8394 #, kde-format 8395 msgctxt "memory size in 2^20 bytes" 8396 msgid "%1 MB" 8397 msgstr "%1 MB" 8398 8399 #. i18n: Dumb message, avoid any markup or scripting. 8400 #: kdecore/klocale_kde.cpp:1355 8401 #, kde-format 8402 msgctxt "memory size in 2^30 bytes" 8403 msgid "%1 GB" 8404 msgstr "%1 GB" 8405 8406 #. i18n: Dumb message, avoid any markup or scripting. 8407 #: kdecore/klocale_kde.cpp:1357 8408 #, kde-format 8409 msgctxt "memory size in 2^40 bytes" 8410 msgid "%1 TB" 8411 msgstr "%1 TB" 8412 8413 #. i18n: Dumb message, avoid any markup or scripting. 8414 #: kdecore/klocale_kde.cpp:1359 8415 #, kde-format 8416 msgctxt "memory size in 2^50 bytes" 8417 msgid "%1 PB" 8418 msgstr "%1 PB" 8419 8420 #. i18n: Dumb message, avoid any markup or scripting. 8421 #: kdecore/klocale_kde.cpp:1361 8422 #, kde-format 8423 msgctxt "memory size in 2^60 bytes" 8424 msgid "%1 EB" 8425 msgstr "%1 EB" 8426 8427 #. i18n: Dumb message, avoid any markup or scripting. 8428 #: kdecore/klocale_kde.cpp:1363 8429 #, kde-format 8430 msgctxt "memory size in 2^70 bytes" 8431 msgid "%1 ZB" 8432 msgstr "%1 ZB" 8433 8434 #. i18n: Dumb message, avoid any markup or scripting. 8435 #: kdecore/klocale_kde.cpp:1365 8436 #, kde-format 8437 msgctxt "memory size in 2^80 bytes" 8438 msgid "%1 YB" 8439 msgstr "%1 YB" 8440 8441 #. i18n: Dumb message, avoid any markup or scripting. 8442 #: kdecore/klocale_kde.cpp:1371 8443 #, kde-format 8444 msgctxt "size in 1024 bytes" 8445 msgid "%1 KiB" 8446 msgstr "%1 KiB" 8447 8448 #. i18n: Dumb message, avoid any markup or scripting. 8449 #: kdecore/klocale_kde.cpp:1373 8450 #, kde-format 8451 msgctxt "size in 2^20 bytes" 8452 msgid "%1 MiB" 8453 msgstr "%1 MiB" 8454 8455 #. i18n: Dumb message, avoid any markup or scripting. 8456 #: kdecore/klocale_kde.cpp:1375 8457 #, kde-format 8458 msgctxt "size in 2^30 bytes" 8459 msgid "%1 GiB" 8460 msgstr "%1 GiB" 8461 8462 #. i18n: Dumb message, avoid any markup or scripting. 8463 #: kdecore/klocale_kde.cpp:1377 8464 #, kde-format 8465 msgctxt "size in 2^40 bytes" 8466 msgid "%1 TiB" 8467 msgstr "%1 TiB" 8468 8469 #. i18n: Dumb message, avoid any markup or scripting. 8470 #: kdecore/klocale_kde.cpp:1379 8471 #, kde-format 8472 msgctxt "size in 2^50 bytes" 8473 msgid "%1 PiB" 8474 msgstr "%1 PiB" 8475 8476 #. i18n: Dumb message, avoid any markup or scripting. 8477 #: kdecore/klocale_kde.cpp:1381 8478 #, kde-format 8479 msgctxt "size in 2^60 bytes" 8480 msgid "%1 EiB" 8481 msgstr "%1 EiB" 8482 8483 #. i18n: Dumb message, avoid any markup or scripting. 8484 #: kdecore/klocale_kde.cpp:1383 8485 #, kde-format 8486 msgctxt "size in 2^70 bytes" 8487 msgid "%1 ZiB" 8488 msgstr "%1 ZiB" 8489 8490 #. i18n: Dumb message, avoid any markup or scripting. 8491 #: kdecore/klocale_kde.cpp:1385 8492 #, kde-format 8493 msgctxt "size in 2^80 bytes" 8494 msgid "%1 YiB" 8495 msgstr "%1 YiB" 8496 8497 #: kdecore/klocale_kde.cpp:1472 8498 #, kde-format 8499 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8500 msgid "%1 days" 8501 msgstr "%1 dagen" 8502 8503 #: kdecore/klocale_kde.cpp:1475 8504 #, kde-format 8505 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8506 msgid "%1 hours" 8507 msgstr "%1 oeren" 8508 8509 #: kdecore/klocale_kde.cpp:1478 8510 #, kde-format 8511 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8512 msgid "%1 minutes" 8513 msgstr "%1 minuten" 8514 8515 #: kdecore/klocale_kde.cpp:1481 8516 #, kde-format 8517 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8518 msgid "%1 seconds" 8519 msgstr "%1 sekonden" 8520 8521 #: kdecore/klocale_kde.cpp:1484 8522 #, kde-format 8523 msgctxt "@item:intext" 8524 msgid "%1 millisecond" 8525 msgid_plural "%1 milliseconds" 8526 msgstr[0] "" 8527 msgstr[1] "" 8528 8529 #: kdecore/klocale_kde.cpp:1491 8530 #, kde-format 8531 msgctxt "@item:intext" 8532 msgid "1 day" 8533 msgid_plural "%1 days" 8534 msgstr[0] "" 8535 msgstr[1] "" 8536 8537 #: kdecore/klocale_kde.cpp:1493 8538 #, kde-format 8539 msgctxt "@item:intext" 8540 msgid "1 hour" 8541 msgid_plural "%1 hours" 8542 msgstr[0] "" 8543 msgstr[1] "" 8544 8545 #: kdecore/klocale_kde.cpp:1495 8546 #, kde-format 8547 msgctxt "@item:intext" 8548 msgid "1 minute" 8549 msgid_plural "%1 minutes" 8550 msgstr[0] "" 8551 msgstr[1] "" 8552 8553 #: kdecore/klocale_kde.cpp:1497 8554 #, kde-format 8555 msgctxt "@item:intext" 8556 msgid "1 second" 8557 msgid_plural "%1 seconds" 8558 msgstr[0] "" 8559 msgstr[1] "" 8560 8561 #: kdecore/klocale_kde.cpp:1521 8562 #, kde-format 8563 msgctxt "" 8564 "@item:intext days and hours. This uses the previous item:intext messages. If " 8565 "this does not fit the grammar of your language please contact the i18n team " 8566 "to solve the problem" 8567 msgid "%1 and %2" 8568 msgstr "%1 en %2" 8569 8570 #: kdecore/klocale_kde.cpp:1527 8571 #, kde-format 8572 msgctxt "" 8573 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8574 "If this does not fit the grammar of your language please contact the i18n " 8575 "team to solve the problem" 8576 msgid "%1 and %2" 8577 msgstr "%1 en %2" 8578 8579 #: kdecore/klocale_kde.cpp:1534 8580 #, kde-format 8581 msgctxt "" 8582 "@item:intext minutes and seconds. This uses the previous item:intext " 8583 "messages. If this does not fit the grammar of your language please contact " 8584 "the i18n team to solve the problem" 8585 msgid "%1 and %2" 8586 msgstr "%1 en %2" 8587 8588 #: kdecore/klocale_kde.cpp:2153 8589 #, kde-format 8590 msgctxt "Before Noon KLocale::LongName" 8591 msgid "Ante Meridiem" 8592 msgstr "" 8593 8594 #: kdecore/klocale_kde.cpp:2154 8595 #, fuzzy, kde-format 8596 #| msgid "Av" 8597 msgctxt "Before Noon KLocale::ShortName" 8598 msgid "AM" 8599 msgstr "Av" 8600 8601 #: kdecore/klocale_kde.cpp:2155 8602 #, fuzzy, kde-format 8603 #| msgid "Av" 8604 msgctxt "Before Noon KLocale::NarrowName" 8605 msgid "A" 8606 msgstr "Av" 8607 8608 #: kdecore/klocale_kde.cpp:2158 8609 #, kde-format 8610 msgctxt "After Noon KLocale::LongName" 8611 msgid "Post Meridiem" 8612 msgstr "" 8613 8614 #: kdecore/klocale_kde.cpp:2159 8615 #, kde-format 8616 msgctxt "After Noon KLocale::ShortName" 8617 msgid "PM" 8618 msgstr "" 8619 8620 #: kdecore/klocale_kde.cpp:2160 8621 #, kde-format 8622 msgctxt "After Noon KLocale::NarrowName" 8623 msgid "P" 8624 msgstr "" 8625 8626 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8627 #, kde-format 8628 msgctxt "concatenation of dates and time" 8629 msgid "%1 %2" 8630 msgstr "%1 %2" 8631 8632 #: kdecore/klocale_kde.cpp:2267 8633 #, kde-format 8634 msgctxt "concatenation of date/time and time zone" 8635 msgid "%1 %2" 8636 msgstr "%1 %2" 8637 8638 #: kdecore/ksavefile.cpp:99 8639 #, kde-format 8640 msgid "No target filename has been given." 8641 msgstr "" 8642 8643 #: kdecore/ksavefile.cpp:106 8644 #, kde-format 8645 msgid "Already opened." 8646 msgstr "" 8647 8648 #: kdecore/ksavefile.cpp:135 8649 #, kde-format 8650 msgid "Insufficient permissions in target directory." 8651 msgstr "" 8652 8653 #: kdecore/ksavefile.cpp:139 8654 #, kde-format 8655 msgid "Unable to open temporary file." 8656 msgstr "" 8657 8658 #: kdecore/ksavefile.cpp:249 8659 #, kde-format 8660 msgid "Synchronization to disk failed" 8661 msgstr "" 8662 8663 #: kdecore/ksavefile.cpp:280 8664 #, kde-format 8665 msgid "Error during rename." 8666 msgstr "" 8667 8668 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8669 #, kde-format 8670 msgid "Timed out trying to connect to remote host" 8671 msgstr "De tiid foar besykjen te ferbinen nei in eksterne host is ferrûn" 8672 8673 #: kdecore/netsupp.cpp:866 8674 #, kde-format 8675 msgid "address family for nodename not supported" 8676 msgstr "Adressefamylje foar nodenamme wurdt net stipe" 8677 8678 #: kdecore/netsupp.cpp:868 8679 #, kde-format 8680 msgid "invalid value for 'ai_flags'" 8681 msgstr "ûnjildige wearde foar 'ai_flags'" 8682 8683 #: kdecore/netsupp.cpp:870 8684 #, kde-format 8685 msgid "'ai_family' not supported" 8686 msgstr "'ai_family' wurdt net stipe" 8687 8688 #: kdecore/netsupp.cpp:872 8689 #, kde-format 8690 msgid "no address associated with nodename" 8691 msgstr "gjin adres yn relaasje mei nodenamme" 8692 8693 #: kdecore/netsupp.cpp:874 8694 #, kde-format 8695 msgid "servname not supported for ai_socktype" 8696 msgstr "tsjinnernamme wurdt net stipe foar 'ai_sockettype'" 8697 8698 #: kdecore/netsupp.cpp:875 8699 #, kde-format 8700 msgid "'ai_socktype' not supported" 8701 msgstr "'ai_sockettype' wurdt net stipe" 8702 8703 #: kdecore/netsupp.cpp:876 8704 #, kde-format 8705 msgid "system error" 8706 msgstr "systeemflater" 8707 8708 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8709 #, kde-format 8710 msgid "KDE Test Program" 8711 msgstr "KDE test programma" 8712 8713 #: kdecore/TIMEZONES:1 8714 #, kde-format 8715 msgid "Africa/Abidjan" 8716 msgstr "Afrika/Abidjan" 8717 8718 #: kdecore/TIMEZONES:2 8719 #, kde-format 8720 msgid "Africa/Accra" 8721 msgstr "Afrika/Accra" 8722 8723 #: kdecore/TIMEZONES:3 8724 #, kde-format 8725 msgid "Africa/Addis_Ababa" 8726 msgstr "Afrika/Addis_Abeba" 8727 8728 #: kdecore/TIMEZONES:4 8729 #, kde-format 8730 msgid "Africa/Algiers" 8731 msgstr "Afrika/Algiers" 8732 8733 #: kdecore/TIMEZONES:5 8734 #, fuzzy, kde-format 8735 #| msgid "Africa/Asmera" 8736 msgid "Africa/Asmara" 8737 msgstr "Afrika/Asmera" 8738 8739 #: kdecore/TIMEZONES:6 8740 #, kde-format 8741 msgid "Africa/Asmera" 8742 msgstr "Afrika/Asmera" 8743 8744 #: kdecore/TIMEZONES:7 8745 #, kde-format 8746 msgid "Africa/Bamako" 8747 msgstr "Afrika/Bamako" 8748 8749 #: kdecore/TIMEZONES:8 8750 #, kde-format 8751 msgid "Africa/Bangui" 8752 msgstr "Afrika/Bangui" 8753 8754 #: kdecore/TIMEZONES:9 8755 #, kde-format 8756 msgid "Africa/Banjul" 8757 msgstr "Afrika/Banjul" 8758 8759 #: kdecore/TIMEZONES:10 8760 #, kde-format 8761 msgid "Africa/Bissau" 8762 msgstr "Afrika/Bissau" 8763 8764 #: kdecore/TIMEZONES:11 8765 #, kde-format 8766 msgid "Africa/Blantyre" 8767 msgstr "Afrika/Blantyre" 8768 8769 #: kdecore/TIMEZONES:12 8770 #, kde-format 8771 msgid "Africa/Brazzaville" 8772 msgstr "Afrika/Brazzaville" 8773 8774 #: kdecore/TIMEZONES:13 8775 #, kde-format 8776 msgid "Africa/Bujumbura" 8777 msgstr "Afrika/Bujumbura" 8778 8779 #: kdecore/TIMEZONES:14 8780 #, kde-format 8781 msgid "Africa/Cairo" 8782 msgstr "Afrika/Cairo" 8783 8784 #: kdecore/TIMEZONES:15 8785 #, kde-format 8786 msgid "Africa/Casablanca" 8787 msgstr "Afrika/Kasablanka" 8788 8789 #: kdecore/TIMEZONES:16 8790 #, kde-format 8791 msgid "Africa/Ceuta" 8792 msgstr "Afrika/Ceuta" 8793 8794 #. i18n: comment to the previous timezone 8795 #: kdecore/TIMEZONES:18 8796 #, kde-format 8797 msgid "Ceuta & Melilla" 8798 msgstr "" 8799 8800 #. i18n: comment to the previous timezone 8801 #: kdecore/TIMEZONES:20 8802 #, kde-format 8803 msgid "Ceuta, Melilla" 8804 msgstr "" 8805 8806 #: kdecore/TIMEZONES:21 8807 #, kde-format 8808 msgid "Africa/Conakry" 8809 msgstr "Afrika/Conakry" 8810 8811 #: kdecore/TIMEZONES:22 8812 #, kde-format 8813 msgid "Africa/Dakar" 8814 msgstr "Afrika/Dakar" 8815 8816 #: kdecore/TIMEZONES:23 8817 #, kde-format 8818 msgid "Africa/Dar_es_Salaam" 8819 msgstr "Afrika/Dar_es_Salaam" 8820 8821 #: kdecore/TIMEZONES:24 8822 #, kde-format 8823 msgid "Africa/Djibouti" 8824 msgstr "Afrika/Djibouti" 8825 8826 #: kdecore/TIMEZONES:25 8827 #, kde-format 8828 msgid "Africa/Douala" 8829 msgstr "Afrika/Douala" 8830 8831 #: kdecore/TIMEZONES:26 8832 #, kde-format 8833 msgid "Africa/El_Aaiun" 8834 msgstr "Afrika/El_Aaiun" 8835 8836 #: kdecore/TIMEZONES:27 8837 #, kde-format 8838 msgid "Africa/Freetown" 8839 msgstr "Afrika/Freetown" 8840 8841 #: kdecore/TIMEZONES:28 8842 #, kde-format 8843 msgid "Africa/Gaborone" 8844 msgstr "Afrika/Gaborone" 8845 8846 #: kdecore/TIMEZONES:29 8847 #, kde-format 8848 msgid "Africa/Harare" 8849 msgstr "Afrika/Harare" 8850 8851 #: kdecore/TIMEZONES:30 8852 #, kde-format 8853 msgid "Africa/Johannesburg" 8854 msgstr "Afrika/Johannesburg" 8855 8856 #: kdecore/TIMEZONES:31 8857 #, fuzzy, kde-format 8858 #| msgid "Africa/Ceuta" 8859 msgid "Africa/Juba" 8860 msgstr "Afrika/Ceuta" 8861 8862 #: kdecore/TIMEZONES:32 8863 #, kde-format 8864 msgid "Africa/Kampala" 8865 msgstr "Afrika/Kampala" 8866 8867 #: kdecore/TIMEZONES:33 8868 #, kde-format 8869 msgid "Africa/Khartoum" 8870 msgstr "Afrika/Khartoem" 8871 8872 #: kdecore/TIMEZONES:34 8873 #, kde-format 8874 msgid "Africa/Kigali" 8875 msgstr "Afrika/Kigali" 8876 8877 #: kdecore/TIMEZONES:35 8878 #, kde-format 8879 msgid "Africa/Kinshasa" 8880 msgstr "Afrika/Kinshasa" 8881 8882 #. i18n: comment to the previous timezone 8883 #: kdecore/TIMEZONES:37 8884 #, kde-format 8885 msgid "west Dem. Rep. of Congo" 8886 msgstr "" 8887 8888 #. i18n: comment to the previous timezone 8889 #: kdecore/TIMEZONES:39 8890 #, kde-format 8891 msgid "Dem. Rep. of Congo (west)" 8892 msgstr "" 8893 8894 #: kdecore/TIMEZONES:40 8895 #, kde-format 8896 msgid "Africa/Lagos" 8897 msgstr "Afrika/Lagos" 8898 8899 #: kdecore/TIMEZONES:41 8900 #, kde-format 8901 msgid "Africa/Libreville" 8902 msgstr "Afrika/Libreville" 8903 8904 #: kdecore/TIMEZONES:42 8905 #, kde-format 8906 msgid "Africa/Lome" 8907 msgstr "Afrika/Lome" 8908 8909 #: kdecore/TIMEZONES:43 8910 #, kde-format 8911 msgid "Africa/Luanda" 8912 msgstr "Afrika/Lûanda" 8913 8914 #: kdecore/TIMEZONES:44 8915 #, kde-format 8916 msgid "Africa/Lubumbashi" 8917 msgstr "Afrika/Lubumbashi" 8918 8919 #. i18n: comment to the previous timezone 8920 #: kdecore/TIMEZONES:46 8921 #, kde-format 8922 msgid "east Dem. Rep. of Congo" 8923 msgstr "" 8924 8925 #. i18n: comment to the previous timezone 8926 #: kdecore/TIMEZONES:48 8927 #, kde-format 8928 msgid "Dem. Rep. of Congo (east)" 8929 msgstr "" 8930 8931 #: kdecore/TIMEZONES:49 8932 #, kde-format 8933 msgid "Africa/Lusaka" 8934 msgstr "Afrika/Lusaka" 8935 8936 #: kdecore/TIMEZONES:50 8937 #, kde-format 8938 msgid "Africa/Malabo" 8939 msgstr "Afrika/Malabo" 8940 8941 #: kdecore/TIMEZONES:51 8942 #, kde-format 8943 msgid "Africa/Maputo" 8944 msgstr "Afrika/Maputo" 8945 8946 #: kdecore/TIMEZONES:52 8947 #, kde-format 8948 msgid "Africa/Maseru" 8949 msgstr "Afrika/Maseru" 8950 8951 #: kdecore/TIMEZONES:53 8952 #, kde-format 8953 msgid "Africa/Mbabane" 8954 msgstr "Afrika/Mbabane" 8955 8956 #: kdecore/TIMEZONES:54 8957 #, kde-format 8958 msgid "Africa/Mogadishu" 8959 msgstr "Afrika/Mogadiscio" 8960 8961 #: kdecore/TIMEZONES:55 8962 #, kde-format 8963 msgid "Africa/Monrovia" 8964 msgstr "Afrika/Monrovia" 8965 8966 #: kdecore/TIMEZONES:56 8967 #, kde-format 8968 msgid "Africa/Nairobi" 8969 msgstr "Afrika/Nairobi" 8970 8971 #: kdecore/TIMEZONES:57 8972 #, kde-format 8973 msgid "Africa/Ndjamena" 8974 msgstr "Afrika/Ndjamena" 8975 8976 #: kdecore/TIMEZONES:58 8977 #, kde-format 8978 msgid "Africa/Niamey" 8979 msgstr "Afrika/Niamey" 8980 8981 #: kdecore/TIMEZONES:59 8982 #, kde-format 8983 msgid "Africa/Nouakchott" 8984 msgstr "Afrika/Nouakchott" 8985 8986 #: kdecore/TIMEZONES:60 8987 #, kde-format 8988 msgid "Africa/Ouagadougou" 8989 msgstr "Afrika/Ouagadougou" 8990 8991 #: kdecore/TIMEZONES:61 8992 #, kde-format 8993 msgid "Africa/Porto-Novo" 8994 msgstr "Afrika/Porto-Novo" 8995 8996 #: kdecore/TIMEZONES:62 8997 #, fuzzy, kde-format 8998 #| msgid "Africa/Ceuta" 8999 msgid "Africa/Pretoria" 9000 msgstr "Afrika/Ceuta" 9001 9002 #: kdecore/TIMEZONES:63 9003 #, kde-format 9004 msgid "Africa/Sao_Tome" 9005 msgstr "Afrika/Sao_Tome" 9006 9007 #: kdecore/TIMEZONES:64 9008 #, kde-format 9009 msgid "Africa/Timbuktu" 9010 msgstr "Afrika/Timboektoe" 9011 9012 #: kdecore/TIMEZONES:65 9013 #, kde-format 9014 msgid "Africa/Tripoli" 9015 msgstr "Afrika/Tripoli" 9016 9017 #: kdecore/TIMEZONES:66 9018 #, kde-format 9019 msgid "Africa/Tunis" 9020 msgstr "Afrika/Tunis" 9021 9022 #: kdecore/TIMEZONES:67 9023 #, kde-format 9024 msgid "Africa/Windhoek" 9025 msgstr "Afrika/Windhoek" 9026 9027 #: kdecore/TIMEZONES:68 9028 #, kde-format 9029 msgid "America/Adak" 9030 msgstr "Amearika/Adak" 9031 9032 #. i18n: comment to the previous timezone 9033 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 9034 #, kde-format 9035 msgid "Aleutian Islands" 9036 msgstr "" 9037 9038 #: kdecore/TIMEZONES:71 9039 #, kde-format 9040 msgid "America/Anchorage" 9041 msgstr "Amearika/Anchorage" 9042 9043 #. i18n: comment to the previous timezone 9044 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 9045 #, kde-format 9046 msgid "Alaska Time" 9047 msgstr "" 9048 9049 #. i18n: comment to the previous timezone 9050 #: kdecore/TIMEZONES:75 9051 #, kde-format 9052 msgid "Alaska (most areas)" 9053 msgstr "" 9054 9055 #: kdecore/TIMEZONES:76 9056 #, kde-format 9057 msgid "America/Anguilla" 9058 msgstr "Amearika/Anguilla" 9059 9060 #: kdecore/TIMEZONES:77 9061 #, kde-format 9062 msgid "America/Antigua" 9063 msgstr "Amearika/Antigua" 9064 9065 #: kdecore/TIMEZONES:78 9066 #, kde-format 9067 msgid "America/Araguaina" 9068 msgstr "Amearika/Araguaina" 9069 9070 #. i18n: comment to the previous timezone 9071 #: kdecore/TIMEZONES:80 9072 #, kde-format 9073 msgid "Tocantins" 9074 msgstr "" 9075 9076 #: kdecore/TIMEZONES:81 9077 #, kde-format 9078 msgid "America/Argentina/Buenos_Aires" 9079 msgstr "Amearika/Argentinië/Buenos_Aires" 9080 9081 #. i18n: comment to the previous timezone 9082 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 9083 #, kde-format 9084 msgid "Buenos Aires (BA, CF)" 9085 msgstr "" 9086 9087 #: kdecore/TIMEZONES:84 9088 #, kde-format 9089 msgid "America/Argentina/Catamarca" 9090 msgstr "Amearika/Argentinië/Catamarca" 9091 9092 #. i18n: comment to the previous timezone 9093 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 9094 #, kde-format 9095 msgid "Catamarca (CT), Chubut (CH)" 9096 msgstr "" 9097 9098 #. i18n: comment to the previous timezone 9099 #: kdecore/TIMEZONES:88 9100 #, kde-format 9101 msgid "Catamarca (CT); Chubut (CH)" 9102 msgstr "" 9103 9104 #: kdecore/TIMEZONES:89 9105 #, kde-format 9106 msgid "America/Argentina/ComodRivadavia" 9107 msgstr "Amearika/Argentinië/ComodRivadavia" 9108 9109 #: kdecore/TIMEZONES:92 9110 #, kde-format 9111 msgid "America/Argentina/Cordoba" 9112 msgstr "Amearika/Argentinië/Cordoba" 9113 9114 #. i18n: comment to the previous timezone 9115 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 9116 #, kde-format 9117 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 9118 msgstr "" 9119 9120 #. i18n: comment to the previous timezone 9121 #: kdecore/TIMEZONES:96 9122 #, kde-format 9123 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 9124 msgstr "" 9125 9126 #. i18n: comment to the previous timezone 9127 #: kdecore/TIMEZONES:98 9128 #, kde-format 9129 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 9130 msgstr "" 9131 9132 #: kdecore/TIMEZONES:99 9133 #, kde-format 9134 msgid "America/Argentina/Jujuy" 9135 msgstr "Amearika/Argentinië/Jujuy" 9136 9137 #. i18n: comment to the previous timezone 9138 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 9139 #, kde-format 9140 msgid "Jujuy (JY)" 9141 msgstr "" 9142 9143 #: kdecore/TIMEZONES:102 9144 #, kde-format 9145 msgid "America/Argentina/La_Rioja" 9146 msgstr "Amearika/Argentinië/Araguaina" 9147 9148 #. i18n: comment to the previous timezone 9149 #: kdecore/TIMEZONES:104 9150 #, kde-format 9151 msgid "La Rioja (LR)" 9152 msgstr "" 9153 9154 #: kdecore/TIMEZONES:105 9155 #, kde-format 9156 msgid "America/Argentina/Mendoza" 9157 msgstr "Amearika/Argentinië/Mendoza" 9158 9159 #. i18n: comment to the previous timezone 9160 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 9161 #, kde-format 9162 msgid "Mendoza (MZ)" 9163 msgstr "" 9164 9165 #: kdecore/TIMEZONES:108 9166 #, kde-format 9167 msgid "America/Argentina/Rio_Gallegos" 9168 msgstr "Amearika/Argentinië/Rio_Gallegos" 9169 9170 #. i18n: comment to the previous timezone 9171 #: kdecore/TIMEZONES:110 9172 #, kde-format 9173 msgid "Santa Cruz (SC)" 9174 msgstr "" 9175 9176 #: kdecore/TIMEZONES:111 9177 #, fuzzy, kde-format 9178 #| msgid "America/Argentina/San_Juan" 9179 msgid "America/Argentina/Salta" 9180 msgstr "Amearika/Argentinië/San_juan" 9181 9182 #. i18n: comment to the previous timezone 9183 #: kdecore/TIMEZONES:113 9184 #, kde-format 9185 msgid "(SA, LP, NQ, RN)" 9186 msgstr "" 9187 9188 #. i18n: comment to the previous timezone 9189 #: kdecore/TIMEZONES:115 9190 #, kde-format 9191 msgid "Salta (SA, LP, NQ, RN)" 9192 msgstr "" 9193 9194 #: kdecore/TIMEZONES:116 9195 #, kde-format 9196 msgid "America/Argentina/San_Juan" 9197 msgstr "Amearika/Argentinië/San_juan" 9198 9199 #. i18n: comment to the previous timezone 9200 #: kdecore/TIMEZONES:118 9201 #, kde-format 9202 msgid "San Juan (SJ)" 9203 msgstr "" 9204 9205 #: kdecore/TIMEZONES:119 9206 #, fuzzy, kde-format 9207 #| msgid "America/Argentina/San_Juan" 9208 msgid "America/Argentina/San_Luis" 9209 msgstr "Amearika/Argentinië/San_juan" 9210 9211 #. i18n: comment to the previous timezone 9212 #: kdecore/TIMEZONES:121 9213 #, kde-format 9214 msgid "San Luis (SL)" 9215 msgstr "" 9216 9217 #: kdecore/TIMEZONES:122 9218 #, kde-format 9219 msgid "America/Argentina/Tucuman" 9220 msgstr "Amearika/Argentinië/Tucuman" 9221 9222 #. i18n: comment to the previous timezone 9223 #: kdecore/TIMEZONES:124 9224 #, kde-format 9225 msgid "Tucuman (TM)" 9226 msgstr "" 9227 9228 #: kdecore/TIMEZONES:125 9229 #, kde-format 9230 msgid "America/Argentina/Ushuaia" 9231 msgstr "Amearika/Argentinië/Ashuaia" 9232 9233 #. i18n: comment to the previous timezone 9234 #: kdecore/TIMEZONES:127 9235 #, kde-format 9236 msgid "Tierra del Fuego (TF)" 9237 msgstr "" 9238 9239 #: kdecore/TIMEZONES:128 9240 #, kde-format 9241 msgid "America/Aruba" 9242 msgstr "Amearika/Aruba" 9243 9244 #: kdecore/TIMEZONES:129 9245 #, kde-format 9246 msgid "America/Asuncion" 9247 msgstr "Amearika/Asunción" 9248 9249 #: kdecore/TIMEZONES:130 9250 #, fuzzy, kde-format 9251 #| msgid "America/Antigua" 9252 msgid "America/Atikokan" 9253 msgstr "Amearika/Antigua" 9254 9255 #. i18n: comment to the previous timezone 9256 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 9257 #, kde-format 9258 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 9259 msgstr "" 9260 9261 #. i18n: comment to the previous timezone 9262 #: kdecore/TIMEZONES:134 9263 #, kde-format 9264 msgid "EST - ON (Atikokan); NU (Coral H)" 9265 msgstr "" 9266 9267 #: kdecore/TIMEZONES:135 9268 #, fuzzy, kde-format 9269 #| msgid "America/Antigua" 9270 msgid "America/Atka" 9271 msgstr "Amearika/Antigua" 9272 9273 #: kdecore/TIMEZONES:138 9274 #, kde-format 9275 msgid "America/Bahia" 9276 msgstr "Amearika/Bahia" 9277 9278 #. i18n: comment to the previous timezone 9279 #: kdecore/TIMEZONES:140 9280 #, kde-format 9281 msgid "Bahia" 9282 msgstr "" 9283 9284 #: kdecore/TIMEZONES:141 9285 #, fuzzy, kde-format 9286 #| msgid "America/Bahia" 9287 msgid "America/Bahia_Banderas" 9288 msgstr "Amearika/Bahia" 9289 9290 #. i18n: comment to the previous timezone 9291 #: kdecore/TIMEZONES:143 9292 #, kde-format 9293 msgid "Mexican Central Time - Bahia de Banderas" 9294 msgstr "" 9295 9296 #. i18n: comment to the previous timezone 9297 #: kdecore/TIMEZONES:145 9298 #, kde-format 9299 msgid "Central Time - Bahia de Banderas" 9300 msgstr "" 9301 9302 #: kdecore/TIMEZONES:146 9303 #, kde-format 9304 msgid "America/Barbados" 9305 msgstr "Amearika/Barbados" 9306 9307 #: kdecore/TIMEZONES:147 9308 #, kde-format 9309 msgid "America/Belem" 9310 msgstr "Amearika/Belem" 9311 9312 #. i18n: comment to the previous timezone 9313 #: kdecore/TIMEZONES:149 9314 #, kde-format 9315 msgid "Amapa, E Para" 9316 msgstr "" 9317 9318 #. i18n: comment to the previous timezone 9319 #: kdecore/TIMEZONES:151 9320 #, kde-format 9321 msgid "Para (east); Amapa" 9322 msgstr "" 9323 9324 #: kdecore/TIMEZONES:152 9325 #, kde-format 9326 msgid "America/Belize" 9327 msgstr "Amearika/Belize" 9328 9329 #: kdecore/TIMEZONES:153 9330 #, fuzzy, kde-format 9331 #| msgid "America/Cancun" 9332 msgid "America/Blanc-Sablon" 9333 msgstr "Amearika/Cancun" 9334 9335 #. i18n: comment to the previous timezone 9336 #: kdecore/TIMEZONES:155 9337 #, kde-format 9338 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9339 msgstr "" 9340 9341 #. i18n: comment to the previous timezone 9342 #: kdecore/TIMEZONES:157 9343 #, kde-format 9344 msgid "AST - QC (Lower North Shore)" 9345 msgstr "" 9346 9347 #: kdecore/TIMEZONES:158 9348 #, kde-format 9349 msgid "America/Boa_Vista" 9350 msgstr "Amearika/Boa_Vista" 9351 9352 #. i18n: comment to the previous timezone 9353 #: kdecore/TIMEZONES:160 9354 #, kde-format 9355 msgid "Roraima" 9356 msgstr "" 9357 9358 #: kdecore/TIMEZONES:161 9359 #, kde-format 9360 msgid "America/Bogota" 9361 msgstr "Amearika/Bogotá" 9362 9363 #: kdecore/TIMEZONES:162 9364 #, kde-format 9365 msgid "America/Boise" 9366 msgstr "Amearika/Boise" 9367 9368 #. i18n: comment to the previous timezone 9369 #: kdecore/TIMEZONES:164 9370 #, kde-format 9371 msgid "Mountain Time - south Idaho & east Oregon" 9372 msgstr "" 9373 9374 #. i18n: comment to the previous timezone 9375 #: kdecore/TIMEZONES:166 9376 #, kde-format 9377 msgid "Mountain - ID (south); OR (east)" 9378 msgstr "" 9379 9380 #: kdecore/TIMEZONES:167 9381 #, kde-format 9382 msgid "America/Buenos_Aires" 9383 msgstr "Amearika/Buenos_Aires" 9384 9385 #: kdecore/TIMEZONES:170 9386 #, fuzzy, kde-format 9387 #| msgid "America/Cayman" 9388 msgid "America/Calgary" 9389 msgstr "Amearika/Kaaiman_Eilannen" 9390 9391 #. i18n: comment to the previous timezone 9392 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9393 #, kde-format 9394 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9395 msgstr "" 9396 9397 #: kdecore/TIMEZONES:173 9398 #, kde-format 9399 msgid "America/Cambridge_Bay" 9400 msgstr "Amearika/Cambridge_Bay" 9401 9402 #. i18n: comment to the previous timezone 9403 #: kdecore/TIMEZONES:175 9404 #, kde-format 9405 msgid "Mountain Time - west Nunavut" 9406 msgstr "" 9407 9408 #. i18n: comment to the previous timezone 9409 #: kdecore/TIMEZONES:177 9410 #, kde-format 9411 msgid "Mountain - NU (west)" 9412 msgstr "" 9413 9414 #: kdecore/TIMEZONES:178 9415 #, kde-format 9416 msgid "America/Campo_Grande" 9417 msgstr "Amearika/Campo_Grande" 9418 9419 #. i18n: comment to the previous timezone 9420 #: kdecore/TIMEZONES:180 9421 #, kde-format 9422 msgid "Mato Grosso do Sul" 9423 msgstr "" 9424 9425 #: kdecore/TIMEZONES:181 9426 #, kde-format 9427 msgid "America/Cancun" 9428 msgstr "Amearika/Cancun" 9429 9430 #. i18n: comment to the previous timezone 9431 #: kdecore/TIMEZONES:183 9432 #, kde-format 9433 msgid "Central Time - Quintana Roo" 9434 msgstr "" 9435 9436 #. i18n: comment to the previous timezone 9437 #: kdecore/TIMEZONES:185 9438 #, kde-format 9439 msgid "Eastern Standard Time - Quintana Roo" 9440 msgstr "" 9441 9442 #: kdecore/TIMEZONES:186 9443 #, kde-format 9444 msgid "America/Caracas" 9445 msgstr "Amearika/Caracas" 9446 9447 #: kdecore/TIMEZONES:187 9448 #, kde-format 9449 msgid "America/Catamarca" 9450 msgstr "Amearika/Catamarca" 9451 9452 #: kdecore/TIMEZONES:190 9453 #, kde-format 9454 msgid "America/Cayenne" 9455 msgstr "Amearika/Cayenne" 9456 9457 #: kdecore/TIMEZONES:191 9458 #, kde-format 9459 msgid "America/Cayman" 9460 msgstr "Amearika/Kaaiman_Eilannen" 9461 9462 #: kdecore/TIMEZONES:192 9463 #, kde-format 9464 msgid "America/Chicago" 9465 msgstr "Amearika/Chicago" 9466 9467 #. i18n: comment to the previous timezone 9468 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9469 #, kde-format 9470 msgid "Central Time" 9471 msgstr "" 9472 9473 #. i18n: comment to the previous timezone 9474 #: kdecore/TIMEZONES:196 9475 #, kde-format 9476 msgid "Central (most areas)" 9477 msgstr "" 9478 9479 #: kdecore/TIMEZONES:197 9480 #, kde-format 9481 msgid "America/Chihuahua" 9482 msgstr "Amearika/Chihuahua" 9483 9484 #. i18n: comment to the previous timezone 9485 #: kdecore/TIMEZONES:199 9486 #, kde-format 9487 msgid "Mountain Time - Chihuahua" 9488 msgstr "" 9489 9490 #. i18n: comment to the previous timezone 9491 #: kdecore/TIMEZONES:201 9492 #, kde-format 9493 msgid "Mexican Mountain Time - Chihuahua away from US border" 9494 msgstr "" 9495 9496 #. i18n: comment to the previous timezone 9497 #: kdecore/TIMEZONES:203 9498 #, kde-format 9499 msgid "Mountain Time - Chihuahua (most areas)" 9500 msgstr "" 9501 9502 #: kdecore/TIMEZONES:204 9503 #, fuzzy, kde-format 9504 #| msgid "America/Curacao" 9505 msgid "America/Coral_Harbour" 9506 msgstr "Amearika/Curaçao" 9507 9508 #: kdecore/TIMEZONES:207 9509 #, kde-format 9510 msgid "America/Cordoba" 9511 msgstr "Amearika/Cordoba" 9512 9513 #: kdecore/TIMEZONES:210 9514 #, kde-format 9515 msgid "America/Costa_Rica" 9516 msgstr "Amearika/Costa_Rica" 9517 9518 #: kdecore/TIMEZONES:211 9519 #, fuzzy, kde-format 9520 #| msgid "Africa/Freetown" 9521 msgid "America/Creston" 9522 msgstr "Afrika/Freetown" 9523 9524 #. i18n: comment to the previous timezone 9525 #: kdecore/TIMEZONES:213 9526 #, kde-format 9527 msgid "Mountain Standard Time - Creston, British Columbia" 9528 msgstr "" 9529 9530 #. i18n: comment to the previous timezone 9531 #: kdecore/TIMEZONES:215 9532 #, kde-format 9533 msgid "MST - BC (Creston)" 9534 msgstr "" 9535 9536 #: kdecore/TIMEZONES:216 9537 #, kde-format 9538 msgid "America/Cuiaba" 9539 msgstr "Amearika/Cuiaba" 9540 9541 #. i18n: comment to the previous timezone 9542 #: kdecore/TIMEZONES:218 9543 #, kde-format 9544 msgid "Mato Grosso" 9545 msgstr "" 9546 9547 #: kdecore/TIMEZONES:219 9548 #, kde-format 9549 msgid "America/Curacao" 9550 msgstr "Amearika/Curaçao" 9551 9552 #: kdecore/TIMEZONES:220 9553 #, kde-format 9554 msgid "America/Danmarkshavn" 9555 msgstr "Amearika/Danmarkshavn" 9556 9557 #. i18n: comment to the previous timezone 9558 #: kdecore/TIMEZONES:222 9559 #, kde-format 9560 msgid "east coast, north of Scoresbysund" 9561 msgstr "" 9562 9563 #. i18n: comment to the previous timezone 9564 #: kdecore/TIMEZONES:224 9565 #, kde-format 9566 msgid "National Park (east coast)" 9567 msgstr "" 9568 9569 #: kdecore/TIMEZONES:225 9570 #, kde-format 9571 msgid "America/Dawson" 9572 msgstr "Amearika/Dawson" 9573 9574 #. i18n: comment to the previous timezone 9575 #: kdecore/TIMEZONES:227 9576 #, kde-format 9577 msgid "Pacific Time - north Yukon" 9578 msgstr "" 9579 9580 #. i18n: comment to the previous timezone 9581 #: kdecore/TIMEZONES:229 9582 #, kde-format 9583 msgid "MST - Yukon (west)" 9584 msgstr "" 9585 9586 #: kdecore/TIMEZONES:230 9587 #, kde-format 9588 msgid "America/Dawson_Creek" 9589 msgstr "Amearika/Dawson_Creek" 9590 9591 #. i18n: comment to the previous timezone 9592 #: kdecore/TIMEZONES:232 9593 #, kde-format 9594 msgid "" 9595 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9596 msgstr "" 9597 9598 #. i18n: comment to the previous timezone 9599 #: kdecore/TIMEZONES:234 9600 #, kde-format 9601 msgid "MST - BC (Dawson Cr, Ft St John)" 9602 msgstr "" 9603 9604 #: kdecore/TIMEZONES:235 9605 #, kde-format 9606 msgid "America/Denver" 9607 msgstr "Amearika/Denver" 9608 9609 #. i18n: comment to the previous timezone 9610 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9611 #, kde-format 9612 msgid "Mountain Time" 9613 msgstr "" 9614 9615 #. i18n: comment to the previous timezone 9616 #: kdecore/TIMEZONES:239 9617 #, kde-format 9618 msgid "Mountain (most areas)" 9619 msgstr "" 9620 9621 #: kdecore/TIMEZONES:240 9622 #, kde-format 9623 msgid "America/Detroit" 9624 msgstr "Amearika/Detroit" 9625 9626 #. i18n: comment to the previous timezone 9627 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9628 #, kde-format 9629 msgid "Eastern Time - Michigan - most locations" 9630 msgstr "" 9631 9632 #. i18n: comment to the previous timezone 9633 #: kdecore/TIMEZONES:244 9634 #, kde-format 9635 msgid "Eastern - MI (most areas)" 9636 msgstr "" 9637 9638 #: kdecore/TIMEZONES:245 9639 #, kde-format 9640 msgid "America/Dominica" 9641 msgstr "Amearika/Dominica" 9642 9643 #: kdecore/TIMEZONES:246 9644 #, kde-format 9645 msgid "America/Edmonton" 9646 msgstr "Amearika/Edmonton" 9647 9648 #. i18n: comment to the previous timezone 9649 #: kdecore/TIMEZONES:250 9650 #, kde-format 9651 msgid "Mountain - AB; BC (E); SK (W)" 9652 msgstr "" 9653 9654 #: kdecore/TIMEZONES:251 9655 #, kde-format 9656 msgid "America/Eirunepe" 9657 msgstr "Amearika/Eirunepe" 9658 9659 #. i18n: comment to the previous timezone 9660 #: kdecore/TIMEZONES:253 9661 #, kde-format 9662 msgid "W Amazonas" 9663 msgstr "" 9664 9665 #. i18n: comment to the previous timezone 9666 #: kdecore/TIMEZONES:255 9667 #, kde-format 9668 msgid "Amazonas (west)" 9669 msgstr "" 9670 9671 #: kdecore/TIMEZONES:256 9672 #, kde-format 9673 msgid "America/El_Salvador" 9674 msgstr "Amearika/El_Salvador" 9675 9676 #: kdecore/TIMEZONES:257 9677 #, fuzzy, kde-format 9678 #| msgid "America/Grenada" 9679 msgid "America/Ensenada" 9680 msgstr "Amearika/Grenada" 9681 9682 #. i18n: comment to the previous timezone 9683 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9684 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9685 #, fuzzy, kde-format 9686 #| msgid "Pacific/Niue" 9687 msgid "Pacific Time" 9688 msgstr "Grutte_Oseaan/Niue" 9689 9690 #: kdecore/TIMEZONES:260 9691 #, fuzzy, kde-format 9692 #| msgid "America/Porto_Velho" 9693 msgid "America/Fort_Nelson" 9694 msgstr "Amearika/Porto_Velho" 9695 9696 #. i18n: comment to the previous timezone 9697 #: kdecore/TIMEZONES:262 9698 #, kde-format 9699 msgid "MST - BC (Ft Nelson)" 9700 msgstr "" 9701 9702 #: kdecore/TIMEZONES:263 9703 #, fuzzy, kde-format 9704 #| msgid "America/Fortaleza" 9705 msgid "America/Fort_Wayne" 9706 msgstr "Amearika/Fortaleza" 9707 9708 #. i18n: comment to the previous timezone 9709 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9710 #: kdecore/TIMEZONES:1419 9711 #, kde-format 9712 msgid "Eastern Time - Indiana - most locations" 9713 msgstr "" 9714 9715 #: kdecore/TIMEZONES:266 9716 #, kde-format 9717 msgid "America/Fortaleza" 9718 msgstr "Amearika/Fortaleza" 9719 9720 #. i18n: comment to the previous timezone 9721 #: kdecore/TIMEZONES:268 9722 #, kde-format 9723 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9724 msgstr "" 9725 9726 #. i18n: comment to the previous timezone 9727 #: kdecore/TIMEZONES:270 9728 #, kde-format 9729 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9730 msgstr "" 9731 9732 #: kdecore/TIMEZONES:271 9733 #, fuzzy, kde-format 9734 #| msgid "Africa/Freetown" 9735 msgid "America/Fredericton" 9736 msgstr "Afrika/Freetown" 9737 9738 #. i18n: comment to the previous timezone 9739 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9740 #, kde-format 9741 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9742 msgstr "" 9743 9744 #: kdecore/TIMEZONES:274 9745 #, kde-format 9746 msgid "America/Glace_Bay" 9747 msgstr "Amearika/Glace_Bay" 9748 9749 #. i18n: comment to the previous timezone 9750 #: kdecore/TIMEZONES:276 9751 #, kde-format 9752 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9753 msgstr "" 9754 9755 #. i18n: comment to the previous timezone 9756 #: kdecore/TIMEZONES:278 9757 #, fuzzy, kde-format 9758 #| msgid "Atlantic/Cape_Verde" 9759 msgid "Atlantic - NS (Cape Breton)" 9760 msgstr "Atlantyske_Oseaan/Kaapferdyske_Eilannen" 9761 9762 #: kdecore/TIMEZONES:279 9763 #, kde-format 9764 msgid "America/Godthab" 9765 msgstr "Amearika/Godthab" 9766 9767 #. i18n: comment to the previous timezone 9768 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9769 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9770 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9771 #: kdecore/TIMEZONES:1350 9772 #, kde-format 9773 msgid "most locations" 9774 msgstr "" 9775 9776 #: kdecore/TIMEZONES:282 9777 #, kde-format 9778 msgid "America/Goose_Bay" 9779 msgstr "Amearika/Goose_Bay" 9780 9781 #. i18n: comment to the previous timezone 9782 #: kdecore/TIMEZONES:284 9783 #, kde-format 9784 msgid "Atlantic Time - Labrador - most locations" 9785 msgstr "" 9786 9787 #. i18n: comment to the previous timezone 9788 #: kdecore/TIMEZONES:286 9789 #, kde-format 9790 msgid "Atlantic - Labrador (most areas)" 9791 msgstr "" 9792 9793 #: kdecore/TIMEZONES:287 9794 #, kde-format 9795 msgid "America/Grand_Turk" 9796 msgstr "Amearika/Grand_Turk" 9797 9798 #: kdecore/TIMEZONES:288 9799 #, kde-format 9800 msgid "America/Grenada" 9801 msgstr "Amearika/Grenada" 9802 9803 #: kdecore/TIMEZONES:289 9804 #, kde-format 9805 msgid "America/Guadeloupe" 9806 msgstr "Amearika/Guadeloupe" 9807 9808 #: kdecore/TIMEZONES:290 9809 #, kde-format 9810 msgid "America/Guatemala" 9811 msgstr "Amearika/Guatemala" 9812 9813 #: kdecore/TIMEZONES:291 9814 #, kde-format 9815 msgid "America/Guayaquil" 9816 msgstr "Amearika/Guayaquil" 9817 9818 #. i18n: comment to the previous timezone 9819 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9820 #: kdecore/TIMEZONES:1400 9821 #, kde-format 9822 msgid "mainland" 9823 msgstr "" 9824 9825 #. i18n: comment to the previous timezone 9826 #: kdecore/TIMEZONES:295 9827 #, kde-format 9828 msgid "Ecuador (mainland)" 9829 msgstr "" 9830 9831 #: kdecore/TIMEZONES:296 9832 #, kde-format 9833 msgid "America/Guyana" 9834 msgstr "Amearika/Guyana" 9835 9836 #: kdecore/TIMEZONES:297 9837 #, kde-format 9838 msgid "America/Halifax" 9839 msgstr "Amearika/Halifax" 9840 9841 #. i18n: comment to the previous timezone 9842 #: kdecore/TIMEZONES:301 9843 #, kde-format 9844 msgid "Atlantic - NS (most areas); PE" 9845 msgstr "" 9846 9847 #: kdecore/TIMEZONES:302 9848 #, kde-format 9849 msgid "America/Havana" 9850 msgstr "Amearika/Havana" 9851 9852 #: kdecore/TIMEZONES:303 9853 #, kde-format 9854 msgid "America/Hermosillo" 9855 msgstr "Amearika/Hermosillo" 9856 9857 #. i18n: comment to the previous timezone 9858 #: kdecore/TIMEZONES:305 9859 #, kde-format 9860 msgid "Mountain Standard Time - Sonora" 9861 msgstr "" 9862 9863 #: kdecore/TIMEZONES:306 9864 #, fuzzy, kde-format 9865 #| msgid "America/Indianapolis" 9866 msgid "America/Indiana/Indianapolis" 9867 msgstr "Amearika/Indianapolis" 9868 9869 #. i18n: comment to the previous timezone 9870 #: kdecore/TIMEZONES:310 9871 #, kde-format 9872 msgid "Eastern - IN (most areas)" 9873 msgstr "" 9874 9875 #: kdecore/TIMEZONES:311 9876 #, kde-format 9877 msgid "America/Indiana/Knox" 9878 msgstr "Amearika/Indiana/Knox" 9879 9880 #. i18n: comment to the previous timezone 9881 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9882 #, kde-format 9883 msgid "Eastern Time - Indiana - Starke County" 9884 msgstr "" 9885 9886 #. i18n: comment to the previous timezone 9887 #: kdecore/TIMEZONES:315 9888 #, kde-format 9889 msgid "Central Time - Indiana - Starke County" 9890 msgstr "" 9891 9892 #. i18n: comment to the previous timezone 9893 #: kdecore/TIMEZONES:317 9894 #, kde-format 9895 msgid "Central - IN (Starke)" 9896 msgstr "" 9897 9898 #: kdecore/TIMEZONES:318 9899 #, kde-format 9900 msgid "America/Indiana/Marengo" 9901 msgstr "Amearika/Indiana/Marengo" 9902 9903 #. i18n: comment to the previous timezone 9904 #: kdecore/TIMEZONES:320 9905 #, kde-format 9906 msgid "Eastern Time - Indiana - Crawford County" 9907 msgstr "" 9908 9909 #. i18n: comment to the previous timezone 9910 #: kdecore/TIMEZONES:322 9911 #, kde-format 9912 msgid "Eastern - IN (Crawford)" 9913 msgstr "" 9914 9915 #: kdecore/TIMEZONES:323 9916 #, fuzzy, kde-format 9917 #| msgid "America/Indiana/Marengo" 9918 msgid "America/Indiana/Petersburg" 9919 msgstr "Amearika/Indiana/Marengo" 9920 9921 #. i18n: comment to the previous timezone 9922 #: kdecore/TIMEZONES:325 9923 #, kde-format 9924 msgid "Central Time - Indiana - Pike County" 9925 msgstr "" 9926 9927 #. i18n: comment to the previous timezone 9928 #: kdecore/TIMEZONES:327 9929 #, kde-format 9930 msgid "Eastern Time - Indiana - Pike County" 9931 msgstr "" 9932 9933 #. i18n: comment to the previous timezone 9934 #: kdecore/TIMEZONES:329 9935 #, kde-format 9936 msgid "Eastern - IN (Pike)" 9937 msgstr "" 9938 9939 #: kdecore/TIMEZONES:330 9940 #, fuzzy, kde-format 9941 #| msgid "America/Indiana/Vevay" 9942 msgid "America/Indiana/Tell_City" 9943 msgstr "Amearika/Indiana/Vevay" 9944 9945 #. i18n: comment to the previous timezone 9946 #: kdecore/TIMEZONES:332 9947 #, kde-format 9948 msgid "Central Time - Indiana - Perry County" 9949 msgstr "" 9950 9951 #. i18n: comment to the previous timezone 9952 #: kdecore/TIMEZONES:334 9953 #, kde-format 9954 msgid "Central - IN (Perry)" 9955 msgstr "" 9956 9957 #: kdecore/TIMEZONES:335 9958 #, kde-format 9959 msgid "America/Indiana/Vevay" 9960 msgstr "Amearika/Indiana/Vevay" 9961 9962 #. i18n: comment to the previous timezone 9963 #: kdecore/TIMEZONES:337 9964 #, kde-format 9965 msgid "Eastern Time - Indiana - Switzerland County" 9966 msgstr "" 9967 9968 #. i18n: comment to the previous timezone 9969 #: kdecore/TIMEZONES:339 9970 #, kde-format 9971 msgid "Eastern - IN (Switzerland)" 9972 msgstr "" 9973 9974 #: kdecore/TIMEZONES:340 9975 #, fuzzy, kde-format 9976 #| msgid "America/Indiana/Vevay" 9977 msgid "America/Indiana/Vincennes" 9978 msgstr "Amearika/Indiana/Vevay" 9979 9980 #. i18n: comment to the previous timezone 9981 #: kdecore/TIMEZONES:342 9982 #, kde-format 9983 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9984 msgstr "" 9985 9986 #. i18n: comment to the previous timezone 9987 #: kdecore/TIMEZONES:344 9988 #, kde-format 9989 msgid "Eastern - IN (Da, Du, K, Mn)" 9990 msgstr "" 9991 9992 #: kdecore/TIMEZONES:345 9993 #, fuzzy, kde-format 9994 #| msgid "America/Indiana/Knox" 9995 msgid "America/Indiana/Winamac" 9996 msgstr "Amearika/Indiana/Knox" 9997 9998 #. i18n: comment to the previous timezone 9999 #: kdecore/TIMEZONES:347 10000 #, kde-format 10001 msgid "Eastern Time - Indiana - Pulaski County" 10002 msgstr "" 10003 10004 #. i18n: comment to the previous timezone 10005 #: kdecore/TIMEZONES:349 10006 #, kde-format 10007 msgid "Eastern - IN (Pulaski)" 10008 msgstr "" 10009 10010 #: kdecore/TIMEZONES:350 10011 #, kde-format 10012 msgid "America/Indianapolis" 10013 msgstr "Amearika/Indianapolis" 10014 10015 #: kdecore/TIMEZONES:353 10016 #, kde-format 10017 msgid "America/Inuvik" 10018 msgstr "Amearika/Inuvik" 10019 10020 #. i18n: comment to the previous timezone 10021 #: kdecore/TIMEZONES:355 10022 #, kde-format 10023 msgid "Mountain Time - west Northwest Territories" 10024 msgstr "" 10025 10026 #. i18n: comment to the previous timezone 10027 #: kdecore/TIMEZONES:357 10028 #, kde-format 10029 msgid "Mountain - NT (west)" 10030 msgstr "" 10031 10032 #: kdecore/TIMEZONES:358 10033 #, kde-format 10034 msgid "America/Iqaluit" 10035 msgstr "Amearika/Iqaluit" 10036 10037 #. i18n: comment to the previous timezone 10038 #: kdecore/TIMEZONES:360 10039 #, kde-format 10040 msgid "Eastern Time - east Nunavut - most locations" 10041 msgstr "" 10042 10043 #. i18n: comment to the previous timezone 10044 #: kdecore/TIMEZONES:362 10045 #, kde-format 10046 msgid "Eastern - NU (most east areas)" 10047 msgstr "" 10048 10049 #: kdecore/TIMEZONES:363 10050 #, kde-format 10051 msgid "America/Jamaica" 10052 msgstr "Amearika/Jamaica" 10053 10054 #: kdecore/TIMEZONES:364 10055 #, kde-format 10056 msgid "America/Jujuy" 10057 msgstr "Amearika/Jujuy" 10058 10059 #: kdecore/TIMEZONES:367 10060 #, kde-format 10061 msgid "America/Juneau" 10062 msgstr "Amearika/Juneau" 10063 10064 #. i18n: comment to the previous timezone 10065 #: kdecore/TIMEZONES:369 10066 #, kde-format 10067 msgid "Alaska Time - Alaska panhandle" 10068 msgstr "" 10069 10070 #. i18n: comment to the previous timezone 10071 #: kdecore/TIMEZONES:371 10072 #, kde-format 10073 msgid "Alaska - Juneau area" 10074 msgstr "" 10075 10076 #: kdecore/TIMEZONES:372 10077 #, fuzzy, kde-format 10078 #| msgid "America/Louisville" 10079 msgid "America/Kentucky/Louisville" 10080 msgstr "Amearika/Louisville" 10081 10082 #. i18n: comment to the previous timezone 10083 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 10084 #, fuzzy, kde-format 10085 #| msgid "America/Louisville" 10086 msgid "Eastern Time - Kentucky - Louisville area" 10087 msgstr "Amearika/Louisville" 10088 10089 #. i18n: comment to the previous timezone 10090 #: kdecore/TIMEZONES:376 10091 #, fuzzy, kde-format 10092 #| msgid "America/Louisville" 10093 msgid "Eastern - KY (Louisville area)" 10094 msgstr "Amearika/Louisville" 10095 10096 #: kdecore/TIMEZONES:377 10097 #, kde-format 10098 msgid "America/Kentucky/Monticello" 10099 msgstr "Amearika/Kentucky/Monticello" 10100 10101 #. i18n: comment to the previous timezone 10102 #: kdecore/TIMEZONES:379 10103 #, kde-format 10104 msgid "Eastern Time - Kentucky - Wayne County" 10105 msgstr "" 10106 10107 #. i18n: comment to the previous timezone 10108 #: kdecore/TIMEZONES:381 10109 #, kde-format 10110 msgid "Eastern - KY (Wayne)" 10111 msgstr "" 10112 10113 #: kdecore/TIMEZONES:382 10114 #, fuzzy, kde-format 10115 #| msgid "America/Indiana/Knox" 10116 msgid "America/Knox_IN" 10117 msgstr "Amearika/Indiana/Knox" 10118 10119 #: kdecore/TIMEZONES:385 10120 #, fuzzy, kde-format 10121 #| msgid "America/Grenada" 10122 msgid "America/Kralendijk" 10123 msgstr "Amearika/Grenada" 10124 10125 #: kdecore/TIMEZONES:386 10126 #, kde-format 10127 msgid "America/La_Paz" 10128 msgstr "Amearika/La_Paz" 10129 10130 #: kdecore/TIMEZONES:387 10131 #, kde-format 10132 msgid "America/Lima" 10133 msgstr "Amearika/Lima" 10134 10135 #: kdecore/TIMEZONES:388 10136 #, kde-format 10137 msgid "America/Los_Angeles" 10138 msgstr "Amearika/Los_Angeles" 10139 10140 #. i18n: comment to the previous timezone 10141 #: kdecore/TIMEZONES:392 10142 #, fuzzy, kde-format 10143 #| msgid "Pacific/Yap" 10144 msgid "Pacific" 10145 msgstr "Grutte_Oseaan/Yap" 10146 10147 #: kdecore/TIMEZONES:393 10148 #, kde-format 10149 msgid "America/Louisville" 10150 msgstr "Amearika/Louisville" 10151 10152 #: kdecore/TIMEZONES:396 10153 #, fuzzy, kde-format 10154 #| msgid "America/Port-au-Prince" 10155 msgid "America/Lower_Princes" 10156 msgstr "Amearika/Port-au-Prince" 10157 10158 #: kdecore/TIMEZONES:397 10159 #, kde-format 10160 msgid "America/Maceio" 10161 msgstr "Amearika/Maceio" 10162 10163 #. i18n: comment to the previous timezone 10164 #: kdecore/TIMEZONES:399 10165 #, kde-format 10166 msgid "Alagoas, Sergipe" 10167 msgstr "" 10168 10169 #: kdecore/TIMEZONES:400 10170 #, kde-format 10171 msgid "America/Managua" 10172 msgstr "Amearika/Managua" 10173 10174 #: kdecore/TIMEZONES:401 10175 #, kde-format 10176 msgid "America/Manaus" 10177 msgstr "Amearika/Manaus" 10178 10179 #. i18n: comment to the previous timezone 10180 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 10181 #, kde-format 10182 msgid "E Amazonas" 10183 msgstr "" 10184 10185 #. i18n: comment to the previous timezone 10186 #: kdecore/TIMEZONES:405 10187 #, kde-format 10188 msgid "Amazonas (east)" 10189 msgstr "" 10190 10191 #: kdecore/TIMEZONES:406 10192 #, fuzzy, kde-format 10193 #| msgid "America/Maceio" 10194 msgid "America/Marigot" 10195 msgstr "Amearika/Maceio" 10196 10197 #: kdecore/TIMEZONES:407 10198 #, kde-format 10199 msgid "America/Martinique" 10200 msgstr "Amearika/Martinique" 10201 10202 #: kdecore/TIMEZONES:408 10203 #, fuzzy, kde-format 10204 #| msgid "America/Manaus" 10205 msgid "America/Matamoros" 10206 msgstr "Amearika/Manaus" 10207 10208 #. i18n: comment to the previous timezone 10209 #: kdecore/TIMEZONES:410 10210 #, kde-format 10211 msgid "" 10212 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 10213 msgstr "" 10214 10215 #. i18n: comment to the previous timezone 10216 #: kdecore/TIMEZONES:412 10217 #, kde-format 10218 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 10219 msgstr "" 10220 10221 #: kdecore/TIMEZONES:413 10222 #, kde-format 10223 msgid "America/Mazatlan" 10224 msgstr "Amearika/Mazatlan" 10225 10226 #. i18n: comment to the previous timezone 10227 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 10228 #, kde-format 10229 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 10230 msgstr "" 10231 10232 #. i18n: comment to the previous timezone 10233 #: kdecore/TIMEZONES:417 10234 #, kde-format 10235 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 10236 msgstr "" 10237 10238 #: kdecore/TIMEZONES:418 10239 #, kde-format 10240 msgid "America/Mendoza" 10241 msgstr "Amearika/Mendoza" 10242 10243 #: kdecore/TIMEZONES:421 10244 #, kde-format 10245 msgid "America/Menominee" 10246 msgstr "Amearika/Menominee" 10247 10248 #. i18n: comment to the previous timezone 10249 #: kdecore/TIMEZONES:423 10250 #, kde-format 10251 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 10252 msgstr "" 10253 10254 #. i18n: comment to the previous timezone 10255 #: kdecore/TIMEZONES:425 10256 #, kde-format 10257 msgid "Central - MI (Wisconsin border)" 10258 msgstr "" 10259 10260 #: kdecore/TIMEZONES:426 10261 #, kde-format 10262 msgid "America/Merida" 10263 msgstr "Amearika/Merida" 10264 10265 #. i18n: comment to the previous timezone 10266 #: kdecore/TIMEZONES:428 10267 #, kde-format 10268 msgid "Central Time - Campeche, Yucatan" 10269 msgstr "" 10270 10271 #: kdecore/TIMEZONES:429 10272 #, fuzzy, kde-format 10273 #| msgid "America/Mazatlan" 10274 msgid "America/Metlakatla" 10275 msgstr "Amearika/Mazatlan" 10276 10277 #. i18n: comment to the previous timezone 10278 #: kdecore/TIMEZONES:431 10279 #, kde-format 10280 msgid "Metlakatla Time - Annette Island" 10281 msgstr "" 10282 10283 #. i18n: comment to the previous timezone 10284 #: kdecore/TIMEZONES:433 10285 #, kde-format 10286 msgid "Alaska - Annette Island" 10287 msgstr "" 10288 10289 #: kdecore/TIMEZONES:434 10290 #, kde-format 10291 msgid "America/Mexico_City" 10292 msgstr "Amearika/Mexico_City" 10293 10294 #. i18n: comment to the previous timezone 10295 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 10296 #, kde-format 10297 msgid "Central Time - most locations" 10298 msgstr "" 10299 10300 #: kdecore/TIMEZONES:439 10301 #, kde-format 10302 msgid "America/Miquelon" 10303 msgstr "Amearika/Miquelon" 10304 10305 #: kdecore/TIMEZONES:440 10306 #, fuzzy, kde-format 10307 #| msgid "America/Edmonton" 10308 msgid "America/Moncton" 10309 msgstr "Amearika/Edmonton" 10310 10311 #. i18n: comment to the previous timezone 10312 #: kdecore/TIMEZONES:442 10313 #, kde-format 10314 msgid "Atlantic Time - New Brunswick" 10315 msgstr "" 10316 10317 #. i18n: comment to the previous timezone 10318 #: kdecore/TIMEZONES:444 10319 #, kde-format 10320 msgid "Atlantic - New Brunswick" 10321 msgstr "" 10322 10323 #: kdecore/TIMEZONES:445 10324 #, kde-format 10325 msgid "America/Monterrey" 10326 msgstr "Amearika/Monterrey" 10327 10328 #. i18n: comment to the previous timezone 10329 #: kdecore/TIMEZONES:447 10330 #, kde-format 10331 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10332 msgstr "" 10333 10334 #. i18n: comment to the previous timezone 10335 #: kdecore/TIMEZONES:449 10336 #, kde-format 10337 msgid "" 10338 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10339 "US border" 10340 msgstr "" 10341 10342 #. i18n: comment to the previous timezone 10343 #: kdecore/TIMEZONES:451 10344 #, kde-format 10345 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10346 msgstr "" 10347 10348 #: kdecore/TIMEZONES:452 10349 #, kde-format 10350 msgid "America/Montevideo" 10351 msgstr "Amearika/Montevideo" 10352 10353 #: kdecore/TIMEZONES:453 10354 #, kde-format 10355 msgid "America/Montreal" 10356 msgstr "Amearika/Montreal" 10357 10358 #. i18n: comment to the previous timezone 10359 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10360 #, kde-format 10361 msgid "Eastern Time - Quebec - most locations" 10362 msgstr "" 10363 10364 #: kdecore/TIMEZONES:456 10365 #, kde-format 10366 msgid "America/Montserrat" 10367 msgstr "Amearika/Montserrat" 10368 10369 #: kdecore/TIMEZONES:457 10370 #, kde-format 10371 msgid "America/Nassau" 10372 msgstr "Amearika/Nassau" 10373 10374 #: kdecore/TIMEZONES:458 10375 #, kde-format 10376 msgid "America/New_York" 10377 msgstr "Amearika/New_York" 10378 10379 #. i18n: comment to the previous timezone 10380 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10381 #, kde-format 10382 msgid "Eastern Time" 10383 msgstr "" 10384 10385 #. i18n: comment to the previous timezone 10386 #: kdecore/TIMEZONES:462 10387 #, kde-format 10388 msgid "Eastern (most areas)" 10389 msgstr "" 10390 10391 #: kdecore/TIMEZONES:463 10392 #, kde-format 10393 msgid "America/Nipigon" 10394 msgstr "Amearika/Nipigon" 10395 10396 #. i18n: comment to the previous timezone 10397 #: kdecore/TIMEZONES:465 10398 #, kde-format 10399 msgid "" 10400 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10401 msgstr "" 10402 10403 #. i18n: comment to the previous timezone 10404 #: kdecore/TIMEZONES:467 10405 #, kde-format 10406 msgid "Eastern - ON, QC (no DST 1967-73)" 10407 msgstr "" 10408 10409 #: kdecore/TIMEZONES:468 10410 #, kde-format 10411 msgid "America/Nome" 10412 msgstr "Amearika/Nome" 10413 10414 #. i18n: comment to the previous timezone 10415 #: kdecore/TIMEZONES:470 10416 #, kde-format 10417 msgid "Alaska Time - west Alaska" 10418 msgstr "" 10419 10420 #. i18n: comment to the previous timezone 10421 #: kdecore/TIMEZONES:472 10422 #, kde-format 10423 msgid "Alaska (west)" 10424 msgstr "" 10425 10426 #: kdecore/TIMEZONES:473 10427 #, kde-format 10428 msgid "America/Noronha" 10429 msgstr "Amearika/Noronha" 10430 10431 #. i18n: comment to the previous timezone 10432 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10433 #, fuzzy, kde-format 10434 #| msgid "Atlantic/Canary" 10435 msgid "Atlantic islands" 10436 msgstr "Atlantyske_Oseaan/Kanaryske_Eilannen" 10437 10438 #: kdecore/TIMEZONES:476 10439 #, fuzzy, kde-format 10440 #| msgid "America/North_Dakota/Center" 10441 msgid "America/North_Dakota/Beulah" 10442 msgstr "Amearika/North_Dakota/Center" 10443 10444 #. i18n: comment to the previous timezone 10445 #: kdecore/TIMEZONES:478 10446 #, kde-format 10447 msgid "Central Time - North Dakota - Mercer County" 10448 msgstr "" 10449 10450 #. i18n: comment to the previous timezone 10451 #: kdecore/TIMEZONES:480 10452 #, kde-format 10453 msgid "Central - ND (Mercer)" 10454 msgstr "" 10455 10456 #: kdecore/TIMEZONES:481 10457 #, kde-format 10458 msgid "America/North_Dakota/Center" 10459 msgstr "Amearika/North_Dakota/Center" 10460 10461 #. i18n: comment to the previous timezone 10462 #: kdecore/TIMEZONES:483 10463 #, kde-format 10464 msgid "Central Time - North Dakota - Oliver County" 10465 msgstr "" 10466 10467 #. i18n: comment to the previous timezone 10468 #: kdecore/TIMEZONES:485 10469 #, kde-format 10470 msgid "Central - ND (Oliver)" 10471 msgstr "" 10472 10473 #: kdecore/TIMEZONES:486 10474 #, fuzzy, kde-format 10475 #| msgid "America/North_Dakota/Center" 10476 msgid "America/North_Dakota/New_Salem" 10477 msgstr "Amearika/North_Dakota/Center" 10478 10479 #. i18n: comment to the previous timezone 10480 #: kdecore/TIMEZONES:488 10481 #, kde-format 10482 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10483 msgstr "" 10484 10485 #. i18n: comment to the previous timezone 10486 #: kdecore/TIMEZONES:490 10487 #, kde-format 10488 msgid "Central - ND (Morton rural)" 10489 msgstr "" 10490 10491 #: kdecore/TIMEZONES:491 10492 #, fuzzy, kde-format 10493 #| msgid "America/Jujuy" 10494 msgid "America/Nuuk" 10495 msgstr "Amearika/Jujuy" 10496 10497 #. i18n: comment to the previous timezone 10498 #: kdecore/TIMEZONES:493 10499 #, kde-format 10500 msgid "Greenland (most areas)" 10501 msgstr "" 10502 10503 #: kdecore/TIMEZONES:494 10504 #, fuzzy, kde-format 10505 #| msgid "America/Managua" 10506 msgid "America/Ojinaga" 10507 msgstr "Amearika/Managua" 10508 10509 #. i18n: comment to the previous timezone 10510 #: kdecore/TIMEZONES:496 10511 #, kde-format 10512 msgid "US Mountain Time - Chihuahua near US border" 10513 msgstr "" 10514 10515 #. i18n: comment to the previous timezone 10516 #: kdecore/TIMEZONES:498 10517 #, kde-format 10518 msgid "Mountain Time US - Chihuahua (US border)" 10519 msgstr "" 10520 10521 #: kdecore/TIMEZONES:499 10522 #, fuzzy, kde-format 10523 #| msgid "America/Maceio" 10524 msgid "America/Ontario" 10525 msgstr "Amearika/Maceio" 10526 10527 #: kdecore/TIMEZONES:502 10528 #, kde-format 10529 msgid "America/Panama" 10530 msgstr "Amearika/Panama" 10531 10532 #: kdecore/TIMEZONES:503 10533 #, kde-format 10534 msgid "America/Pangnirtung" 10535 msgstr "Amearika/Pangnirtung" 10536 10537 #. i18n: comment to the previous timezone 10538 #: kdecore/TIMEZONES:505 10539 #, kde-format 10540 msgid "Eastern Time - Pangnirtung, Nunavut" 10541 msgstr "" 10542 10543 #. i18n: comment to the previous timezone 10544 #: kdecore/TIMEZONES:507 10545 #, kde-format 10546 msgid "Eastern - NU (Pangnirtung)" 10547 msgstr "" 10548 10549 #: kdecore/TIMEZONES:508 10550 #, kde-format 10551 msgid "America/Paramaribo" 10552 msgstr "Amearika/Paramaribo" 10553 10554 #: kdecore/TIMEZONES:509 10555 #, kde-format 10556 msgid "America/Phoenix" 10557 msgstr "Amearika/Phoenix" 10558 10559 #. i18n: comment to the previous timezone 10560 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10561 #, kde-format 10562 msgid "Mountain Standard Time - Arizona" 10563 msgstr "" 10564 10565 #. i18n: comment to the previous timezone 10566 #: kdecore/TIMEZONES:513 10567 #, kde-format 10568 msgid "MST - Arizona (except Navajo)" 10569 msgstr "" 10570 10571 #: kdecore/TIMEZONES:514 10572 #, kde-format 10573 msgid "America/Port-au-Prince" 10574 msgstr "Amearika/Port-au-Prince" 10575 10576 #: kdecore/TIMEZONES:515 10577 #, kde-format 10578 msgid "America/Port_of_Spain" 10579 msgstr "Amearika/Port_of_Spain" 10580 10581 #: kdecore/TIMEZONES:516 10582 #, fuzzy, kde-format 10583 #| msgid "America/Porto_Velho" 10584 msgid "America/Porto_Acre" 10585 msgstr "Amearika/Porto_Velho" 10586 10587 #. i18n: comment to the previous timezone 10588 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10589 #, kde-format 10590 msgid "Acre" 10591 msgstr "" 10592 10593 #: kdecore/TIMEZONES:519 10594 #, kde-format 10595 msgid "America/Porto_Velho" 10596 msgstr "Amearika/Porto_Velho" 10597 10598 #. i18n: comment to the previous timezone 10599 #: kdecore/TIMEZONES:521 10600 #, kde-format 10601 msgid "Rondonia" 10602 msgstr "" 10603 10604 #: kdecore/TIMEZONES:522 10605 #, kde-format 10606 msgid "America/Puerto_Rico" 10607 msgstr "Amearika/Puerto_Rico" 10608 10609 #: kdecore/TIMEZONES:523 10610 #, fuzzy, kde-format 10611 #| msgid "America/Buenos_Aires" 10612 msgid "America/Punta_Arenas" 10613 msgstr "Amearika/Buenos_Aires" 10614 10615 #. i18n: comment to the previous timezone 10616 #: kdecore/TIMEZONES:525 10617 #, kde-format 10618 msgid "Region of Magallanes" 10619 msgstr "" 10620 10621 #: kdecore/TIMEZONES:526 10622 #, kde-format 10623 msgid "America/Rainy_River" 10624 msgstr "Amearika/Rainy_River" 10625 10626 #. i18n: comment to the previous timezone 10627 #: kdecore/TIMEZONES:528 10628 #, kde-format 10629 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10630 msgstr "" 10631 10632 #. i18n: comment to the previous timezone 10633 #: kdecore/TIMEZONES:530 10634 #, kde-format 10635 msgid "Central - ON (Rainy R, Ft Frances)" 10636 msgstr "" 10637 10638 #: kdecore/TIMEZONES:531 10639 #, kde-format 10640 msgid "America/Rankin_Inlet" 10641 msgstr "Amearika/Rankin_Inlet" 10642 10643 #. i18n: comment to the previous timezone 10644 #: kdecore/TIMEZONES:533 10645 #, kde-format 10646 msgid "Central Time - central Nunavut" 10647 msgstr "" 10648 10649 #. i18n: comment to the previous timezone 10650 #: kdecore/TIMEZONES:535 10651 #, kde-format 10652 msgid "Central - NU (central)" 10653 msgstr "" 10654 10655 #: kdecore/TIMEZONES:536 10656 #, kde-format 10657 msgid "America/Recife" 10658 msgstr "Amearika/Recife" 10659 10660 #. i18n: comment to the previous timezone 10661 #: kdecore/TIMEZONES:538 10662 #, kde-format 10663 msgid "Pernambuco" 10664 msgstr "" 10665 10666 #: kdecore/TIMEZONES:539 10667 #, kde-format 10668 msgid "America/Regina" 10669 msgstr "Amearika/Regina" 10670 10671 #. i18n: comment to the previous timezone 10672 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10673 #: kdecore/TIMEZONES:1123 10674 #, kde-format 10675 msgid "Central Standard Time - Saskatchewan - most locations" 10676 msgstr "" 10677 10678 #. i18n: comment to the previous timezone 10679 #: kdecore/TIMEZONES:543 10680 #, kde-format 10681 msgid "CST - SK (most areas)" 10682 msgstr "" 10683 10684 #: kdecore/TIMEZONES:544 10685 #, fuzzy, kde-format 10686 #| msgid "America/Belem" 10687 msgid "America/Resolute" 10688 msgstr "Amearika/Belem" 10689 10690 #. i18n: comment to the previous timezone 10691 #: kdecore/TIMEZONES:546 10692 #, kde-format 10693 msgid "Eastern Time - Resolute, Nunavut" 10694 msgstr "" 10695 10696 #. i18n: comment to the previous timezone 10697 #: kdecore/TIMEZONES:548 10698 #, kde-format 10699 msgid "Central Standard Time - Resolute, Nunavut" 10700 msgstr "" 10701 10702 #. i18n: comment to the previous timezone 10703 #: kdecore/TIMEZONES:550 10704 #, kde-format 10705 msgid "Central - NU (Resolute)" 10706 msgstr "" 10707 10708 #: kdecore/TIMEZONES:551 10709 #, kde-format 10710 msgid "America/Rio_Branco" 10711 msgstr "Amearika/Rio_Branco" 10712 10713 #: kdecore/TIMEZONES:554 10714 #, kde-format 10715 msgid "America/Rosario" 10716 msgstr "Amearika/Rosario" 10717 10718 #: kdecore/TIMEZONES:557 10719 #, fuzzy, kde-format 10720 #| msgid "America/Santiago" 10721 msgid "America/Santa_Isabel" 10722 msgstr "Amearika/Santiago" 10723 10724 #. i18n: comment to the previous timezone 10725 #: kdecore/TIMEZONES:559 10726 #, kde-format 10727 msgid "Mexican Pacific Time - Baja California away from US border" 10728 msgstr "" 10729 10730 #: kdecore/TIMEZONES:560 10731 #, fuzzy, kde-format 10732 #| msgid "America/Santiago" 10733 msgid "America/Santarem" 10734 msgstr "Amearika/Santiago" 10735 10736 #. i18n: comment to the previous timezone 10737 #: kdecore/TIMEZONES:562 10738 #, fuzzy, kde-format 10739 msgid "W Para" 10740 msgstr "fan mrt" 10741 10742 #. i18n: comment to the previous timezone 10743 #: kdecore/TIMEZONES:564 10744 #, kde-format 10745 msgid "Para (west)" 10746 msgstr "" 10747 10748 #: kdecore/TIMEZONES:565 10749 #, kde-format 10750 msgid "America/Santiago" 10751 msgstr "Amearika/Santiago" 10752 10753 #. i18n: comment to the previous timezone 10754 #: kdecore/TIMEZONES:569 10755 #, kde-format 10756 msgid "Chile (most areas)" 10757 msgstr "" 10758 10759 #: kdecore/TIMEZONES:570 10760 #, kde-format 10761 msgid "America/Santo_Domingo" 10762 msgstr "Amearika/Santo_Domingo" 10763 10764 #: kdecore/TIMEZONES:571 10765 #, kde-format 10766 msgid "America/Sao_Paulo" 10767 msgstr "Amearika/Sao_Paulo" 10768 10769 #. i18n: comment to the previous timezone 10770 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10771 #, kde-format 10772 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10773 msgstr "" 10774 10775 #. i18n: comment to the previous timezone 10776 #: kdecore/TIMEZONES:575 10777 #, kde-format 10778 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10779 msgstr "" 10780 10781 #: kdecore/TIMEZONES:576 10782 #, fuzzy, kde-format 10783 #| msgid "America/Dawson" 10784 msgid "America/Saskatoon" 10785 msgstr "Amearika/Dawson" 10786 10787 #: kdecore/TIMEZONES:579 10788 #, kde-format 10789 msgid "America/Scoresbysund" 10790 msgstr "Amearika/Scoresbysund" 10791 10792 #. i18n: comment to the previous timezone 10793 #: kdecore/TIMEZONES:581 10794 #, kde-format 10795 msgid "Scoresbysund / Ittoqqortoormiit" 10796 msgstr "" 10797 10798 #. i18n: comment to the previous timezone 10799 #: kdecore/TIMEZONES:583 10800 #, kde-format 10801 msgid "Scoresbysund/Ittoqqortoormiit" 10802 msgstr "" 10803 10804 #: kdecore/TIMEZONES:584 10805 #, kde-format 10806 msgid "America/Shiprock" 10807 msgstr "Amearika/Shiprock" 10808 10809 #. i18n: comment to the previous timezone 10810 #: kdecore/TIMEZONES:586 10811 #, kde-format 10812 msgid "Mountain Time - Navajo" 10813 msgstr "" 10814 10815 #: kdecore/TIMEZONES:587 10816 #, fuzzy, kde-format 10817 #| msgid "America/Antigua" 10818 msgid "America/Sitka" 10819 msgstr "Amearika/Antigua" 10820 10821 #. i18n: comment to the previous timezone 10822 #: kdecore/TIMEZONES:589 10823 #, kde-format 10824 msgid "Alaska Time - southeast Alaska panhandle" 10825 msgstr "" 10826 10827 #. i18n: comment to the previous timezone 10828 #: kdecore/TIMEZONES:591 10829 #, kde-format 10830 msgid "Alaska - Sitka area" 10831 msgstr "" 10832 10833 #: kdecore/TIMEZONES:592 10834 #, fuzzy, kde-format 10835 #| msgid "America/Belem" 10836 msgid "America/St_Barthelemy" 10837 msgstr "Amearika/Belem" 10838 10839 #: kdecore/TIMEZONES:593 10840 #, kde-format 10841 msgid "America/St_Johns" 10842 msgstr "Amearika/St._Johns" 10843 10844 #. i18n: comment to the previous timezone 10845 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10846 #, kde-format 10847 msgid "Newfoundland Time, including SE Labrador" 10848 msgstr "" 10849 10850 #. i18n: comment to the previous timezone 10851 #: kdecore/TIMEZONES:597 10852 #, kde-format 10853 msgid "Newfoundland; Labrador (southeast)" 10854 msgstr "" 10855 10856 #: kdecore/TIMEZONES:598 10857 #, kde-format 10858 msgid "America/St_Kitts" 10859 msgstr "Amearika/St_Kitts" 10860 10861 #: kdecore/TIMEZONES:599 10862 #, kde-format 10863 msgid "America/St_Lucia" 10864 msgstr "Amearika/St._Lucia" 10865 10866 #: kdecore/TIMEZONES:600 10867 #, kde-format 10868 msgid "America/St_Thomas" 10869 msgstr "Amearika/St._Thomas" 10870 10871 #: kdecore/TIMEZONES:601 10872 #, kde-format 10873 msgid "America/St_Vincent" 10874 msgstr "Amearika/St._Vincent" 10875 10876 #: kdecore/TIMEZONES:602 10877 #, kde-format 10878 msgid "America/Swift_Current" 10879 msgstr "Amearika/Swift_Current" 10880 10881 #. i18n: comment to the previous timezone 10882 #: kdecore/TIMEZONES:604 10883 #, kde-format 10884 msgid "Central Standard Time - Saskatchewan - midwest" 10885 msgstr "" 10886 10887 #. i18n: comment to the previous timezone 10888 #: kdecore/TIMEZONES:606 10889 #, kde-format 10890 msgid "CST - SK (midwest)" 10891 msgstr "" 10892 10893 #: kdecore/TIMEZONES:607 10894 #, kde-format 10895 msgid "America/Tegucigalpa" 10896 msgstr "Amearika/Tegucigalpa" 10897 10898 #: kdecore/TIMEZONES:608 10899 #, kde-format 10900 msgid "America/Thule" 10901 msgstr "Amearika/Thule" 10902 10903 #. i18n: comment to the previous timezone 10904 #: kdecore/TIMEZONES:610 10905 #, kde-format 10906 msgid "Thule / Pituffik" 10907 msgstr "" 10908 10909 #. i18n: comment to the previous timezone 10910 #: kdecore/TIMEZONES:612 10911 #, kde-format 10912 msgid "Thule/Pituffik" 10913 msgstr "" 10914 10915 #: kdecore/TIMEZONES:613 10916 #, kde-format 10917 msgid "America/Thunder_Bay" 10918 msgstr "Amearika/Thunder_Bay" 10919 10920 #. i18n: comment to the previous timezone 10921 #: kdecore/TIMEZONES:615 10922 #, kde-format 10923 msgid "Eastern Time - Thunder Bay, Ontario" 10924 msgstr "" 10925 10926 #. i18n: comment to the previous timezone 10927 #: kdecore/TIMEZONES:617 10928 #, kde-format 10929 msgid "Eastern - ON (Thunder Bay)" 10930 msgstr "" 10931 10932 #: kdecore/TIMEZONES:618 10933 #, kde-format 10934 msgid "America/Tijuana" 10935 msgstr "Amearika/Tijuana" 10936 10937 #. i18n: comment to the previous timezone 10938 #: kdecore/TIMEZONES:622 10939 #, kde-format 10940 msgid "US Pacific Time - Baja California near US border" 10941 msgstr "" 10942 10943 #. i18n: comment to the previous timezone 10944 #: kdecore/TIMEZONES:624 10945 #, kde-format 10946 msgid "Pacific Time US - Baja California" 10947 msgstr "" 10948 10949 #: kdecore/TIMEZONES:625 10950 #, kde-format 10951 msgid "America/Toronto" 10952 msgstr "Amearika/Toronto" 10953 10954 #. i18n: comment to the previous timezone 10955 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10956 #, kde-format 10957 msgid "Eastern Time - Ontario - most locations" 10958 msgstr "" 10959 10960 #. i18n: comment to the previous timezone 10961 #: kdecore/TIMEZONES:629 10962 #, kde-format 10963 msgid "Eastern - ON, QC (most areas)" 10964 msgstr "" 10965 10966 #: kdecore/TIMEZONES:630 10967 #, kde-format 10968 msgid "America/Tortola" 10969 msgstr "Amearika/Tortola" 10970 10971 #: kdecore/TIMEZONES:631 10972 #, kde-format 10973 msgid "America/Vancouver" 10974 msgstr "Amearika/Vancouver" 10975 10976 #. i18n: comment to the previous timezone 10977 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10978 #, kde-format 10979 msgid "Pacific Time - west British Columbia" 10980 msgstr "" 10981 10982 #. i18n: comment to the previous timezone 10983 #: kdecore/TIMEZONES:635 10984 #, kde-format 10985 msgid "Pacific - BC (most areas)" 10986 msgstr "" 10987 10988 #: kdecore/TIMEZONES:636 10989 #, fuzzy, kde-format 10990 #| msgid "America/Regina" 10991 msgid "America/Virgin" 10992 msgstr "Amearika/Regina" 10993 10994 #: kdecore/TIMEZONES:637 10995 #, kde-format 10996 msgid "America/Whitehorse" 10997 msgstr "Amearika/Whitehorse" 10998 10999 #. i18n: comment to the previous timezone 11000 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 11001 #, kde-format 11002 msgid "Pacific Time - south Yukon" 11003 msgstr "" 11004 11005 #. i18n: comment to the previous timezone 11006 #: kdecore/TIMEZONES:641 11007 #, kde-format 11008 msgid "MST - Yukon (east)" 11009 msgstr "" 11010 11011 #: kdecore/TIMEZONES:642 11012 #, kde-format 11013 msgid "America/Winnipeg" 11014 msgstr "Amearika/Winnipeg" 11015 11016 #. i18n: comment to the previous timezone 11017 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 11018 #, kde-format 11019 msgid "Central Time - Manitoba & west Ontario" 11020 msgstr "" 11021 11022 #. i18n: comment to the previous timezone 11023 #: kdecore/TIMEZONES:646 11024 #, kde-format 11025 msgid "Central - ON (west); Manitoba" 11026 msgstr "" 11027 11028 #: kdecore/TIMEZONES:647 11029 #, kde-format 11030 msgid "America/Yakutat" 11031 msgstr "Amearika/Yakutat" 11032 11033 #. i18n: comment to the previous timezone 11034 #: kdecore/TIMEZONES:649 11035 #, kde-format 11036 msgid "Alaska Time - Alaska panhandle neck" 11037 msgstr "" 11038 11039 #. i18n: comment to the previous timezone 11040 #: kdecore/TIMEZONES:651 11041 #, kde-format 11042 msgid "Alaska - Yakutat" 11043 msgstr "" 11044 11045 #: kdecore/TIMEZONES:652 11046 #, kde-format 11047 msgid "America/Yellowknife" 11048 msgstr "Amearika/Yellowknife" 11049 11050 #. i18n: comment to the previous timezone 11051 #: kdecore/TIMEZONES:654 11052 #, kde-format 11053 msgid "Mountain Time - central Northwest Territories" 11054 msgstr "" 11055 11056 #. i18n: comment to the previous timezone 11057 #: kdecore/TIMEZONES:656 11058 #, kde-format 11059 msgid "Mountain - NT (central)" 11060 msgstr "" 11061 11062 #: kdecore/TIMEZONES:657 11063 #, kde-format 11064 msgid "Antarctica/Casey" 11065 msgstr "Antarktika/Casey" 11066 11067 #. i18n: comment to the previous timezone 11068 #: kdecore/TIMEZONES:659 11069 #, kde-format 11070 msgid "Casey Station, Bailey Peninsula" 11071 msgstr "" 11072 11073 #. i18n: comment to the previous timezone 11074 #: kdecore/TIMEZONES:661 11075 #, kde-format 11076 msgid "Casey" 11077 msgstr "" 11078 11079 #: kdecore/TIMEZONES:662 11080 #, kde-format 11081 msgid "Antarctica/Davis" 11082 msgstr "Antarktika/Davis" 11083 11084 #. i18n: comment to the previous timezone 11085 #: kdecore/TIMEZONES:664 11086 #, kde-format 11087 msgid "Davis Station, Vestfold Hills" 11088 msgstr "" 11089 11090 #. i18n: comment to the previous timezone 11091 #: kdecore/TIMEZONES:666 11092 #, kde-format 11093 msgid "Davis" 11094 msgstr "" 11095 11096 #: kdecore/TIMEZONES:667 11097 #, kde-format 11098 msgid "Antarctica/DumontDUrville" 11099 msgstr "Antarktika/DumontDUrville" 11100 11101 #. i18n: comment to the previous timezone 11102 #: kdecore/TIMEZONES:669 11103 #, kde-format 11104 msgid "Dumont-d'Urville Station, Terre Adelie" 11105 msgstr "" 11106 11107 #. i18n: comment to the previous timezone 11108 #: kdecore/TIMEZONES:671 11109 #, fuzzy, kde-format 11110 #| msgid "Antarctica/DumontDUrville" 11111 msgid "Dumont-d'Urville" 11112 msgstr "Antarktika/DumontDUrville" 11113 11114 #: kdecore/TIMEZONES:672 11115 #, fuzzy, kde-format 11116 #| msgid "Antarctica/McMurdo" 11117 msgid "Antarctica/Macquarie" 11118 msgstr "Antarktika/McMurdo" 11119 11120 #. i18n: comment to the previous timezone 11121 #: kdecore/TIMEZONES:674 11122 #, kde-format 11123 msgid "Macquarie Island Station, Macquarie Island" 11124 msgstr "" 11125 11126 #. i18n: comment to the previous timezone 11127 #: kdecore/TIMEZONES:676 11128 #, kde-format 11129 msgid "Macquarie Island" 11130 msgstr "" 11131 11132 #: kdecore/TIMEZONES:677 11133 #, kde-format 11134 msgid "Antarctica/Mawson" 11135 msgstr "Antarktika/Mawson" 11136 11137 #. i18n: comment to the previous timezone 11138 #: kdecore/TIMEZONES:679 11139 #, kde-format 11140 msgid "Mawson Station, Holme Bay" 11141 msgstr "" 11142 11143 #. i18n: comment to the previous timezone 11144 #: kdecore/TIMEZONES:681 11145 #, kde-format 11146 msgid "Mawson" 11147 msgstr "" 11148 11149 #: kdecore/TIMEZONES:682 11150 #, kde-format 11151 msgid "Antarctica/McMurdo" 11152 msgstr "Antarktika/McMurdo" 11153 11154 #. i18n: comment to the previous timezone 11155 #: kdecore/TIMEZONES:684 11156 #, kde-format 11157 msgid "McMurdo Station, Ross Island" 11158 msgstr "" 11159 11160 #. i18n: comment to the previous timezone 11161 #: kdecore/TIMEZONES:686 11162 #, kde-format 11163 msgid "New Zealand time - McMurdo, South Pole" 11164 msgstr "" 11165 11166 #: kdecore/TIMEZONES:687 11167 #, kde-format 11168 msgid "Antarctica/Palmer" 11169 msgstr "Antarktika/Palmer" 11170 11171 #. i18n: comment to the previous timezone 11172 #: kdecore/TIMEZONES:689 11173 #, kde-format 11174 msgid "Palmer Station, Anvers Island" 11175 msgstr "" 11176 11177 #. i18n: comment to the previous timezone 11178 #: kdecore/TIMEZONES:691 11179 #, kde-format 11180 msgid "Palmer" 11181 msgstr "" 11182 11183 #: kdecore/TIMEZONES:692 11184 #, kde-format 11185 msgid "Antarctica/Rothera" 11186 msgstr "Antarktika/Rothera" 11187 11188 #. i18n: comment to the previous timezone 11189 #: kdecore/TIMEZONES:694 11190 #, kde-format 11191 msgid "Rothera Station, Adelaide Island" 11192 msgstr "" 11193 11194 #. i18n: comment to the previous timezone 11195 #: kdecore/TIMEZONES:696 11196 #, kde-format 11197 msgid "Rothera" 11198 msgstr "" 11199 11200 #: kdecore/TIMEZONES:697 11201 #, kde-format 11202 msgid "Antarctica/South_Pole" 11203 msgstr "Antarktika/Súdpoal" 11204 11205 #. i18n: comment to the previous timezone 11206 #: kdecore/TIMEZONES:699 11207 #, kde-format 11208 msgid "Amundsen-Scott Station, South Pole" 11209 msgstr "" 11210 11211 #: kdecore/TIMEZONES:700 11212 #, kde-format 11213 msgid "Antarctica/Syowa" 11214 msgstr "Antarktika/Syowa" 11215 11216 #. i18n: comment to the previous timezone 11217 #: kdecore/TIMEZONES:702 11218 #, kde-format 11219 msgid "Syowa Station, E Ongul I" 11220 msgstr "" 11221 11222 #. i18n: comment to the previous timezone 11223 #: kdecore/TIMEZONES:704 11224 #, kde-format 11225 msgid "Syowa" 11226 msgstr "" 11227 11228 #: kdecore/TIMEZONES:705 11229 #, fuzzy, kde-format 11230 #| msgid "Antarctica/McMurdo" 11231 msgid "Antarctica/Troll" 11232 msgstr "Antarktika/McMurdo" 11233 11234 #. i18n: comment to the previous timezone 11235 #: kdecore/TIMEZONES:707 11236 #, kde-format 11237 msgid "Troll" 11238 msgstr "" 11239 11240 #: kdecore/TIMEZONES:708 11241 #, kde-format 11242 msgid "Antarctica/Vostok" 11243 msgstr "Antarktika/Vostok" 11244 11245 #. i18n: comment to the previous timezone 11246 #: kdecore/TIMEZONES:710 11247 #, kde-format 11248 msgid "Vostok Station, S Magnetic Pole" 11249 msgstr "" 11250 11251 #. i18n: comment to the previous timezone 11252 #: kdecore/TIMEZONES:712 11253 #, kde-format 11254 msgid "Vostok Station, Lake Vostok" 11255 msgstr "" 11256 11257 #. i18n: comment to the previous timezone 11258 #: kdecore/TIMEZONES:714 11259 #, kde-format 11260 msgid "Vostok" 11261 msgstr "" 11262 11263 #: kdecore/TIMEZONES:715 11264 #, kde-format 11265 msgid "Arctic/Longyearbyen" 11266 msgstr "Noardpoal/Longyearbyen" 11267 11268 #: kdecore/TIMEZONES:716 11269 #, kde-format 11270 msgid "Asia/Aden" 11271 msgstr "Azië/Aden" 11272 11273 #: kdecore/TIMEZONES:717 11274 #, kde-format 11275 msgid "Asia/Almaty" 11276 msgstr "Azië/Almaty" 11277 11278 #. i18n: comment to the previous timezone 11279 #: kdecore/TIMEZONES:721 11280 #, kde-format 11281 msgid "Kazakhstan (most areas)" 11282 msgstr "" 11283 11284 #: kdecore/TIMEZONES:722 11285 #, kde-format 11286 msgid "Asia/Amman" 11287 msgstr "Azië/Amman" 11288 11289 #: kdecore/TIMEZONES:723 11290 #, kde-format 11291 msgid "Asia/Anadyr" 11292 msgstr "Azië/Anadyr" 11293 11294 #. i18n: comment to the previous timezone 11295 #: kdecore/TIMEZONES:725 11296 #, kde-format 11297 msgid "Moscow+10 - Bering Sea" 11298 msgstr "" 11299 11300 #. i18n: comment to the previous timezone 11301 #: kdecore/TIMEZONES:727 11302 #, kde-format 11303 msgid "Moscow+08 - Bering Sea" 11304 msgstr "" 11305 11306 #. i18n: comment to the previous timezone 11307 #: kdecore/TIMEZONES:729 11308 #, kde-format 11309 msgid "MSK+09 - Bering Sea" 11310 msgstr "" 11311 11312 #: kdecore/TIMEZONES:730 11313 #, kde-format 11314 msgid "Asia/Aqtau" 11315 msgstr "Azië/Aqtau" 11316 11317 #. i18n: comment to the previous timezone 11318 #: kdecore/TIMEZONES:732 11319 #, kde-format 11320 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 11321 msgstr "" 11322 11323 #. i18n: comment to the previous timezone 11324 #: kdecore/TIMEZONES:734 11325 #, kde-format 11326 msgid "Mangghystau/Mankistau" 11327 msgstr "" 11328 11329 #: kdecore/TIMEZONES:735 11330 #, kde-format 11331 msgid "Asia/Aqtobe" 11332 msgstr "Azië/Aqtobe" 11333 11334 #. i18n: comment to the previous timezone 11335 #: kdecore/TIMEZONES:737 11336 #, kde-format 11337 msgid "Aqtobe (Aktobe)" 11338 msgstr "" 11339 11340 #. i18n: comment to the previous timezone 11341 #: kdecore/TIMEZONES:739 11342 #, kde-format 11343 msgid "Aqtobe/Aktobe" 11344 msgstr "" 11345 11346 #: kdecore/TIMEZONES:740 11347 #, kde-format 11348 msgid "Asia/Ashgabat" 11349 msgstr "Azië/Ashgabat" 11350 11351 #: kdecore/TIMEZONES:741 11352 #, fuzzy, kde-format 11353 #| msgid "Asia/Ashgabat" 11354 msgid "Asia/Ashkhabad" 11355 msgstr "Azië/Ashgabat" 11356 11357 #: kdecore/TIMEZONES:742 11358 #, fuzzy, kde-format 11359 #| msgid "Asia/Aqtau" 11360 msgid "Asia/Atyrau" 11361 msgstr "Azië/Aqtau" 11362 11363 #. i18n: comment to the previous timezone 11364 #: kdecore/TIMEZONES:744 11365 #, kde-format 11366 msgid "Atyrau/Atirau/Gur'yev" 11367 msgstr "" 11368 11369 #: kdecore/TIMEZONES:745 11370 #, kde-format 11371 msgid "Asia/Baghdad" 11372 msgstr "Azië/Bagdad" 11373 11374 #: kdecore/TIMEZONES:746 11375 #, kde-format 11376 msgid "Asia/Bahrain" 11377 msgstr "Azië/Bachrein" 11378 11379 #: kdecore/TIMEZONES:747 11380 #, kde-format 11381 msgid "Asia/Baku" 11382 msgstr "Azië/Bakoe" 11383 11384 #: kdecore/TIMEZONES:748 11385 #, kde-format 11386 msgid "Asia/Bangkok" 11387 msgstr "Azië/Bangkok" 11388 11389 #: kdecore/TIMEZONES:749 11390 #, fuzzy, kde-format 11391 #| msgid "Asia/Baku" 11392 msgid "Asia/Barnaul" 11393 msgstr "Azië/Bakoe" 11394 11395 #. i18n: comment to the previous timezone 11396 #: kdecore/TIMEZONES:751 11397 #, kde-format 11398 msgid "MSK+04 - Altai" 11399 msgstr "" 11400 11401 #: kdecore/TIMEZONES:752 11402 #, fuzzy, kde-format 11403 #| msgid "Asia/Beirut" 11404 msgid "Asia/Beijing" 11405 msgstr "Azië/Beirût" 11406 11407 #. i18n: comment to the previous timezone 11408 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11409 #, kde-format 11410 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11411 msgstr "" 11412 11413 #. i18n: comment to the previous timezone 11414 #: kdecore/TIMEZONES:756 11415 #, kde-format 11416 msgid "China Standard Time" 11417 msgstr "" 11418 11419 #: kdecore/TIMEZONES:757 11420 #, kde-format 11421 msgid "Asia/Beirut" 11422 msgstr "Azië/Beirût" 11423 11424 #: kdecore/TIMEZONES:758 11425 #, kde-format 11426 msgid "Asia/Bishkek" 11427 msgstr "Azië/Bishkek" 11428 11429 #: kdecore/TIMEZONES:759 11430 #, kde-format 11431 msgid "Asia/Brunei" 11432 msgstr "Azië/Brunei" 11433 11434 #: kdecore/TIMEZONES:760 11435 #, kde-format 11436 msgid "Asia/Calcutta" 11437 msgstr "Azië/Calcutta" 11438 11439 #: kdecore/TIMEZONES:761 11440 #, fuzzy, kde-format 11441 #| msgid "Asia/Choibalsan" 11442 msgid "Asia/Chita" 11443 msgstr "Azië/Choibalsan" 11444 11445 #. i18n: comment to the previous timezone 11446 #: kdecore/TIMEZONES:763 11447 #, kde-format 11448 msgid "MSK+06 - Zabaykalsky" 11449 msgstr "" 11450 11451 #: kdecore/TIMEZONES:764 11452 #, kde-format 11453 msgid "Asia/Choibalsan" 11454 msgstr "Azië/Choibalsan" 11455 11456 #. i18n: comment to the previous timezone 11457 #: kdecore/TIMEZONES:766 11458 #, kde-format 11459 msgid "Dornod, Sukhbaatar" 11460 msgstr "" 11461 11462 #: kdecore/TIMEZONES:767 11463 #, kde-format 11464 msgid "Asia/Chongqing" 11465 msgstr "Azië/Chongqing" 11466 11467 #. i18n: comment to the previous timezone 11468 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11469 #, kde-format 11470 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11471 msgstr "" 11472 11473 #. i18n: comment to the previous timezone 11474 #: kdecore/TIMEZONES:771 11475 #, kde-format 11476 msgid "China mountains" 11477 msgstr "" 11478 11479 #: kdecore/TIMEZONES:772 11480 #, fuzzy, kde-format 11481 #| msgid "Asia/Chongqing" 11482 msgid "Asia/Chungking" 11483 msgstr "Azië/Chongqing" 11484 11485 #: kdecore/TIMEZONES:775 11486 #, kde-format 11487 msgid "Asia/Colombo" 11488 msgstr "Azië/Kolombo" 11489 11490 #: kdecore/TIMEZONES:776 11491 #, fuzzy, kde-format 11492 #| msgid "Asia/Dhaka" 11493 msgid "Asia/Dacca" 11494 msgstr "Azië/Dhaka" 11495 11496 #: kdecore/TIMEZONES:777 11497 #, kde-format 11498 msgid "Asia/Damascus" 11499 msgstr "Azië/Damaskus" 11500 11501 #: kdecore/TIMEZONES:778 11502 #, kde-format 11503 msgid "Asia/Dhaka" 11504 msgstr "Azië/Dhaka" 11505 11506 #: kdecore/TIMEZONES:779 11507 #, kde-format 11508 msgid "Asia/Dili" 11509 msgstr "Azië/Dili" 11510 11511 #: kdecore/TIMEZONES:780 11512 #, kde-format 11513 msgid "Asia/Dubai" 11514 msgstr "Azië/Dubai" 11515 11516 #: kdecore/TIMEZONES:781 11517 #, fuzzy, kde-format 11518 #| msgid "Do shanbe" 11519 msgid "Asia/Dushanbe" 11520 msgstr "Do shanbe" 11521 11522 #: kdecore/TIMEZONES:782 11523 #, fuzzy, kde-format 11524 #| msgid "Asia/Damascus" 11525 msgid "Asia/Famagusta" 11526 msgstr "Azië/Damaskus" 11527 11528 #. i18n: comment to the previous timezone 11529 #: kdecore/TIMEZONES:784 11530 #, kde-format 11531 msgid "Northern Cyprus" 11532 msgstr "" 11533 11534 #: kdecore/TIMEZONES:785 11535 #, kde-format 11536 msgid "Asia/Gaza" 11537 msgstr "Azië/Gaza" 11538 11539 #. i18n: comment to the previous timezone 11540 #: kdecore/TIMEZONES:787 11541 #, kde-format 11542 msgid "Gaza Strip" 11543 msgstr "" 11544 11545 #: kdecore/TIMEZONES:788 11546 #, kde-format 11547 msgid "Asia/Harbin" 11548 msgstr "Azië/Harbin" 11549 11550 #. i18n: comment to the previous timezone 11551 #: kdecore/TIMEZONES:790 11552 #, kde-format 11553 msgid "Heilongjiang (except Mohe), Jilin" 11554 msgstr "" 11555 11556 #. i18n: comment to the previous timezone 11557 #: kdecore/TIMEZONES:792 11558 #, kde-format 11559 msgid "China north" 11560 msgstr "" 11561 11562 #: kdecore/TIMEZONES:793 11563 #, fuzzy, kde-format 11564 #| msgid "Asia/Harbin" 11565 msgid "Asia/Hebron" 11566 msgstr "Azië/Harbin" 11567 11568 #. i18n: comment to the previous timezone 11569 #: kdecore/TIMEZONES:795 11570 #, kde-format 11571 msgid "West Bank" 11572 msgstr "" 11573 11574 #: kdecore/TIMEZONES:796 11575 #, fuzzy, kde-format 11576 #| msgid "Asia/Chongqing" 11577 msgid "Asia/Ho_Chi_Minh" 11578 msgstr "Azië/Chongqing" 11579 11580 #: kdecore/TIMEZONES:797 11581 #, kde-format 11582 msgid "Asia/Hong_Kong" 11583 msgstr "Azië/Hong_Kong" 11584 11585 #: kdecore/TIMEZONES:798 11586 #, kde-format 11587 msgid "Asia/Hovd" 11588 msgstr "Azië/Hovd" 11589 11590 #. i18n: comment to the previous timezone 11591 #: kdecore/TIMEZONES:800 11592 #, kde-format 11593 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11594 msgstr "" 11595 11596 #: kdecore/TIMEZONES:801 11597 #, kde-format 11598 msgid "Asia/Irkutsk" 11599 msgstr "Azië/Irkoetsk" 11600 11601 #. i18n: comment to the previous timezone 11602 #: kdecore/TIMEZONES:803 11603 #, kde-format 11604 msgid "Moscow+05 - Lake Baikal" 11605 msgstr "" 11606 11607 #. i18n: comment to the previous timezone 11608 #: kdecore/TIMEZONES:805 11609 #, kde-format 11610 msgid "MSK+05 - Irkutsk, Buryatia" 11611 msgstr "" 11612 11613 #: kdecore/TIMEZONES:806 11614 #, kde-format 11615 msgid "Asia/Jakarta" 11616 msgstr "Azië/Jakarta" 11617 11618 #. i18n: comment to the previous timezone 11619 #: kdecore/TIMEZONES:808 11620 #, kde-format 11621 msgid "Java & Sumatra" 11622 msgstr "" 11623 11624 #. i18n: comment to the previous timezone 11625 #: kdecore/TIMEZONES:810 11626 #, kde-format 11627 msgid "Java, Sumatra" 11628 msgstr "" 11629 11630 #: kdecore/TIMEZONES:811 11631 #, kde-format 11632 msgid "Asia/Jayapura" 11633 msgstr "Azië/Jayapura" 11634 11635 #. i18n: comment to the previous timezone 11636 #: kdecore/TIMEZONES:813 11637 #, kde-format 11638 msgid "Irian Jaya & the Moluccas" 11639 msgstr "" 11640 11641 #. i18n: comment to the previous timezone 11642 #: kdecore/TIMEZONES:815 11643 #, kde-format 11644 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11645 msgstr "" 11646 11647 #. i18n: comment to the previous timezone 11648 #: kdecore/TIMEZONES:817 11649 #, kde-format 11650 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11651 msgstr "" 11652 11653 #: kdecore/TIMEZONES:818 11654 #, kde-format 11655 msgid "Asia/Jerusalem" 11656 msgstr "Azië/Jeruzalem" 11657 11658 #: kdecore/TIMEZONES:819 11659 #, kde-format 11660 msgid "Asia/Kabul" 11661 msgstr "Azië/Kaboel" 11662 11663 #: kdecore/TIMEZONES:820 11664 #, kde-format 11665 msgid "Asia/Kamchatka" 11666 msgstr "Azië/Kamtsjatka" 11667 11668 #. i18n: comment to the previous timezone 11669 #: kdecore/TIMEZONES:822 11670 #, kde-format 11671 msgid "Moscow+09 - Kamchatka" 11672 msgstr "" 11673 11674 #. i18n: comment to the previous timezone 11675 #: kdecore/TIMEZONES:824 11676 #, kde-format 11677 msgid "Moscow+08 - Kamchatka" 11678 msgstr "" 11679 11680 #. i18n: comment to the previous timezone 11681 #: kdecore/TIMEZONES:826 11682 #, kde-format 11683 msgid "MSK+09 - Kamchatka" 11684 msgstr "" 11685 11686 #: kdecore/TIMEZONES:827 11687 #, kde-format 11688 msgid "Asia/Karachi" 11689 msgstr "Azië/Karachi" 11690 11691 #: kdecore/TIMEZONES:828 11692 #, kde-format 11693 msgid "Asia/Kashgar" 11694 msgstr "Azië/Kashgar" 11695 11696 #. i18n: comment to the previous timezone 11697 #: kdecore/TIMEZONES:830 11698 #, kde-format 11699 msgid "west Tibet & Xinjiang" 11700 msgstr "" 11701 11702 #. i18n: comment to the previous timezone 11703 #: kdecore/TIMEZONES:832 11704 #, kde-format 11705 msgid "China west Xinjiang" 11706 msgstr "" 11707 11708 #: kdecore/TIMEZONES:833 11709 #, fuzzy, kde-format 11710 #| msgid "Asia/Katmandu" 11711 msgid "Asia/Kathmandu" 11712 msgstr "Azië/Katmandu" 11713 11714 #: kdecore/TIMEZONES:834 11715 #, kde-format 11716 msgid "Asia/Katmandu" 11717 msgstr "Azië/Katmandu" 11718 11719 #: kdecore/TIMEZONES:835 11720 #, fuzzy, kde-format 11721 #| msgid "Asia/Shanghai" 11722 msgid "Asia/Khandyga" 11723 msgstr "Azië/Sjanghai" 11724 11725 #. i18n: comment to the previous timezone 11726 #: kdecore/TIMEZONES:837 11727 #, kde-format 11728 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11729 msgstr "" 11730 11731 #: kdecore/TIMEZONES:838 11732 #, fuzzy, kde-format 11733 #| msgid "Asia/Jakarta" 11734 msgid "Asia/Kolkata" 11735 msgstr "Azië/Jakarta" 11736 11737 #: kdecore/TIMEZONES:839 11738 #, kde-format 11739 msgid "Asia/Krasnoyarsk" 11740 msgstr "Azië/Krasnoyarsk" 11741 11742 #. i18n: comment to the previous timezone 11743 #: kdecore/TIMEZONES:841 11744 #, kde-format 11745 msgid "Moscow+04 - Yenisei River" 11746 msgstr "" 11747 11748 #. i18n: comment to the previous timezone 11749 #: kdecore/TIMEZONES:843 11750 #, kde-format 11751 msgid "MSK+04 - Krasnoyarsk area" 11752 msgstr "" 11753 11754 #: kdecore/TIMEZONES:844 11755 #, kde-format 11756 msgid "Asia/Kuala_Lumpur" 11757 msgstr "Azië/Kuala_Lumpur" 11758 11759 #. i18n: comment to the previous timezone 11760 #: kdecore/TIMEZONES:846 11761 #, kde-format 11762 msgid "peninsular Malaysia" 11763 msgstr "" 11764 11765 #. i18n: comment to the previous timezone 11766 #: kdecore/TIMEZONES:848 11767 #, kde-format 11768 msgid "Malaysia (peninsula)" 11769 msgstr "" 11770 11771 #: kdecore/TIMEZONES:849 11772 #, kde-format 11773 msgid "Asia/Kuching" 11774 msgstr "Azië/Kuching" 11775 11776 #. i18n: comment to the previous timezone 11777 #: kdecore/TIMEZONES:851 11778 #, kde-format 11779 msgid "Sabah & Sarawak" 11780 msgstr "" 11781 11782 #. i18n: comment to the previous timezone 11783 #: kdecore/TIMEZONES:853 11784 #, kde-format 11785 msgid "Sabah, Sarawak" 11786 msgstr "" 11787 11788 #: kdecore/TIMEZONES:854 11789 #, kde-format 11790 msgid "Asia/Kuwait" 11791 msgstr "Azië/Koeweit" 11792 11793 #: kdecore/TIMEZONES:855 11794 #, fuzzy, kde-format 11795 #| msgid "Asia/Macau" 11796 msgid "Asia/Macao" 11797 msgstr "Azië/Macau" 11798 11799 #: kdecore/TIMEZONES:856 11800 #, kde-format 11801 msgid "Asia/Macau" 11802 msgstr "Azië/Macau" 11803 11804 #: kdecore/TIMEZONES:857 11805 #, kde-format 11806 msgid "Asia/Magadan" 11807 msgstr "Azië/Magadan" 11808 11809 #. i18n: comment to the previous timezone 11810 #: kdecore/TIMEZONES:859 11811 #, kde-format 11812 msgid "Moscow+08 - Magadan" 11813 msgstr "" 11814 11815 #. i18n: comment to the previous timezone 11816 #: kdecore/TIMEZONES:861 11817 #, kde-format 11818 msgid "MSK+08 - Magadan" 11819 msgstr "" 11820 11821 #: kdecore/TIMEZONES:862 11822 #, kde-format 11823 msgid "Asia/Makassar" 11824 msgstr "Azië/Makassar" 11825 11826 #. i18n: comment to the previous timezone 11827 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11828 #, kde-format 11829 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11830 msgstr "" 11831 11832 #. i18n: comment to the previous timezone 11833 #: kdecore/TIMEZONES:866 11834 #, kde-format 11835 msgid "" 11836 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11837 msgstr "" 11838 11839 #. i18n: comment to the previous timezone 11840 #: kdecore/TIMEZONES:868 11841 #, kde-format 11842 msgid "" 11843 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11844 msgstr "" 11845 11846 #: kdecore/TIMEZONES:869 11847 #, kde-format 11848 msgid "Asia/Manila" 11849 msgstr "Azië/Manila" 11850 11851 #: kdecore/TIMEZONES:870 11852 #, kde-format 11853 msgid "Asia/Muscat" 11854 msgstr "Azië/Muscat" 11855 11856 #: kdecore/TIMEZONES:871 11857 #, kde-format 11858 msgid "Asia/Nicosia" 11859 msgstr "Azië/Nikosia" 11860 11861 #. i18n: comment to the previous timezone 11862 #: kdecore/TIMEZONES:873 11863 #, kde-format 11864 msgid "Cyprus (most areas)" 11865 msgstr "" 11866 11867 #: kdecore/TIMEZONES:874 11868 #, fuzzy, kde-format 11869 #| msgid "Asia/Irkutsk" 11870 msgid "Asia/Novokuznetsk" 11871 msgstr "Azië/Irkoetsk" 11872 11873 #. i18n: comment to the previous timezone 11874 #: kdecore/TIMEZONES:876 11875 #, fuzzy, kde-format 11876 #| msgid "Asia/Novosibirsk" 11877 msgid "Moscow+03 - Novokuznetsk" 11878 msgstr "Azië/Novosibirsk" 11879 11880 #. i18n: comment to the previous timezone 11881 #: kdecore/TIMEZONES:878 11882 #, kde-format 11883 msgid "MSK+04 - Kemerovo" 11884 msgstr "" 11885 11886 #: kdecore/TIMEZONES:879 11887 #, kde-format 11888 msgid "Asia/Novosibirsk" 11889 msgstr "Azië/Novosibirsk" 11890 11891 #. i18n: comment to the previous timezone 11892 #: kdecore/TIMEZONES:881 11893 #, fuzzy, kde-format 11894 #| msgid "Asia/Novosibirsk" 11895 msgid "Moscow+03 - Novosibirsk" 11896 msgstr "Azië/Novosibirsk" 11897 11898 #. i18n: comment to the previous timezone 11899 #: kdecore/TIMEZONES:883 11900 #, fuzzy, kde-format 11901 #| msgid "Asia/Novosibirsk" 11902 msgid "MSK+04 - Novosibirsk" 11903 msgstr "Azië/Novosibirsk" 11904 11905 #: kdecore/TIMEZONES:884 11906 #, kde-format 11907 msgid "Asia/Omsk" 11908 msgstr "Azië/Omsk" 11909 11910 #. i18n: comment to the previous timezone 11911 #: kdecore/TIMEZONES:886 11912 #, kde-format 11913 msgid "Moscow+03 - west Siberia" 11914 msgstr "" 11915 11916 #. i18n: comment to the previous timezone 11917 #: kdecore/TIMEZONES:888 11918 #, kde-format 11919 msgid "MSK+03 - Omsk" 11920 msgstr "" 11921 11922 #: kdecore/TIMEZONES:889 11923 #, kde-format 11924 msgid "Asia/Oral" 11925 msgstr "Azië/Oeral" 11926 11927 #. i18n: comment to the previous timezone 11928 #: kdecore/TIMEZONES:891 11929 #, kde-format 11930 msgid "West Kazakhstan" 11931 msgstr "" 11932 11933 #: kdecore/TIMEZONES:892 11934 #, kde-format 11935 msgid "Asia/Phnom_Penh" 11936 msgstr "Azië/Phnom_Penh" 11937 11938 #: kdecore/TIMEZONES:893 11939 #, kde-format 11940 msgid "Asia/Pontianak" 11941 msgstr "Azië/Pontianak" 11942 11943 #. i18n: comment to the previous timezone 11944 #: kdecore/TIMEZONES:895 11945 #, kde-format 11946 msgid "west & central Borneo" 11947 msgstr "" 11948 11949 #. i18n: comment to the previous timezone 11950 #: kdecore/TIMEZONES:897 11951 #, kde-format 11952 msgid "Borneo (west, central)" 11953 msgstr "" 11954 11955 #: kdecore/TIMEZONES:898 11956 #, kde-format 11957 msgid "Asia/Pyongyang" 11958 msgstr "Azië/Pyongyang" 11959 11960 #: kdecore/TIMEZONES:899 11961 #, kde-format 11962 msgid "Asia/Qatar" 11963 msgstr "Azië/Qatar" 11964 11965 #: kdecore/TIMEZONES:900 11966 #, fuzzy, kde-format 11967 #| msgid "Asia/Pontianak" 11968 msgid "Asia/Qostanay" 11969 msgstr "Azië/Pontianak" 11970 11971 #. i18n: comment to the previous timezone 11972 #: kdecore/TIMEZONES:902 11973 #, kde-format 11974 msgid "Qostanay/Kostanay/Kustanay" 11975 msgstr "" 11976 11977 #: kdecore/TIMEZONES:903 11978 #, kde-format 11979 msgid "Asia/Qyzylorda" 11980 msgstr "Azië/Qyzylorda" 11981 11982 #. i18n: comment to the previous timezone 11983 #: kdecore/TIMEZONES:905 11984 #, kde-format 11985 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11986 msgstr "" 11987 11988 #. i18n: comment to the previous timezone 11989 #: kdecore/TIMEZONES:907 11990 #, kde-format 11991 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11992 msgstr "" 11993 11994 #: kdecore/TIMEZONES:908 11995 #, kde-format 11996 msgid "Asia/Rangoon" 11997 msgstr "Azië/Rangoon" 11998 11999 #: kdecore/TIMEZONES:909 12000 #, kde-format 12001 msgid "Asia/Riyadh" 12002 msgstr "Azië/Riaad" 12003 12004 #: kdecore/TIMEZONES:910 12005 #, kde-format 12006 msgid "Asia/Saigon" 12007 msgstr "Azië/Saigon" 12008 12009 #: kdecore/TIMEZONES:911 12010 #, kde-format 12011 msgid "Asia/Sakhalin" 12012 msgstr "Azië/Sakhalin" 12013 12014 #. i18n: comment to the previous timezone 12015 #: kdecore/TIMEZONES:913 12016 #, kde-format 12017 msgid "Moscow+07 - Sakhalin Island" 12018 msgstr "" 12019 12020 #. i18n: comment to the previous timezone 12021 #: kdecore/TIMEZONES:915 12022 #, kde-format 12023 msgid "MSK+08 - Sakhalin Island" 12024 msgstr "" 12025 12026 #: kdecore/TIMEZONES:916 12027 #, kde-format 12028 msgid "Asia/Samarkand" 12029 msgstr "Azië/Samarkand" 12030 12031 #. i18n: comment to the previous timezone 12032 #: kdecore/TIMEZONES:918 12033 #, kde-format 12034 msgid "west Uzbekistan" 12035 msgstr "" 12036 12037 #. i18n: comment to the previous timezone 12038 #: kdecore/TIMEZONES:920 12039 #, kde-format 12040 msgid "Uzbekistan (west)" 12041 msgstr "" 12042 12043 #: kdecore/TIMEZONES:921 12044 #, kde-format 12045 msgid "Asia/Seoul" 12046 msgstr "Azië/Seoel" 12047 12048 #: kdecore/TIMEZONES:922 12049 #, kde-format 12050 msgid "Asia/Shanghai" 12051 msgstr "Azië/Sjanghai" 12052 12053 #. i18n: comment to the previous timezone 12054 #: kdecore/TIMEZONES:926 12055 #, kde-format 12056 msgid "China east" 12057 msgstr "" 12058 12059 #. i18n: comment to the previous timezone 12060 #: kdecore/TIMEZONES:928 12061 #, kde-format 12062 msgid "Beijing Time" 12063 msgstr "" 12064 12065 #: kdecore/TIMEZONES:929 12066 #, kde-format 12067 msgid "Asia/Singapore" 12068 msgstr "Azië/Singapore" 12069 12070 #: kdecore/TIMEZONES:930 12071 #, fuzzy, kde-format 12072 #| msgid "Asia/Krasnoyarsk" 12073 msgid "Asia/Srednekolymsk" 12074 msgstr "Azië/Krasnoyarsk" 12075 12076 #. i18n: comment to the previous timezone 12077 #: kdecore/TIMEZONES:932 12078 #, kde-format 12079 msgid "MSK+08 - Sakha (E); North Kuril Is" 12080 msgstr "" 12081 12082 #: kdecore/TIMEZONES:933 12083 #, kde-format 12084 msgid "Asia/Taipei" 12085 msgstr "Azië/Taipei" 12086 12087 #: kdecore/TIMEZONES:934 12088 #, kde-format 12089 msgid "Asia/Tashkent" 12090 msgstr "Azië/Tasjkent" 12091 12092 #. i18n: comment to the previous timezone 12093 #: kdecore/TIMEZONES:936 12094 #, kde-format 12095 msgid "east Uzbekistan" 12096 msgstr "" 12097 12098 #. i18n: comment to the previous timezone 12099 #: kdecore/TIMEZONES:938 12100 #, kde-format 12101 msgid "Uzbekistan (east)" 12102 msgstr "" 12103 12104 #: kdecore/TIMEZONES:939 12105 #, kde-format 12106 msgid "Asia/Tbilisi" 12107 msgstr "Azië/Tbilisi" 12108 12109 #: kdecore/TIMEZONES:940 12110 #, kde-format 12111 msgid "Asia/Tehran" 12112 msgstr "Azië/Teheran" 12113 12114 #: kdecore/TIMEZONES:941 12115 #, fuzzy, kde-format 12116 #| msgid "Asia/Taipei" 12117 msgid "Asia/Tel_Aviv" 12118 msgstr "Azië/Taipei" 12119 12120 #: kdecore/TIMEZONES:942 12121 #, fuzzy, kde-format 12122 #| msgid "Asia/Thimphu" 12123 msgid "Asia/Thimbu" 12124 msgstr "Azië/Thimphu" 12125 12126 #: kdecore/TIMEZONES:943 12127 #, kde-format 12128 msgid "Asia/Thimphu" 12129 msgstr "Azië/Thimphu" 12130 12131 #: kdecore/TIMEZONES:944 12132 #, kde-format 12133 msgid "Asia/Tokyo" 12134 msgstr "Azië/Tokio" 12135 12136 #: kdecore/TIMEZONES:945 12137 #, fuzzy, kde-format 12138 #| msgid "Asia/Omsk" 12139 msgid "Asia/Tomsk" 12140 msgstr "Azië/Omsk" 12141 12142 #. i18n: comment to the previous timezone 12143 #: kdecore/TIMEZONES:947 12144 #, kde-format 12145 msgid "MSK+04 - Tomsk" 12146 msgstr "" 12147 12148 #: kdecore/TIMEZONES:948 12149 #, kde-format 12150 msgid "Asia/Ujung_Pandang" 12151 msgstr "Azië/Ujung_Pandang" 12152 12153 #: kdecore/TIMEZONES:951 12154 #, kde-format 12155 msgid "Asia/Ulaanbaatar" 12156 msgstr "Azië/Ulaanbaatar" 12157 12158 #. i18n: comment to the previous timezone 12159 #: kdecore/TIMEZONES:955 12160 #, kde-format 12161 msgid "Mongolia (most areas)" 12162 msgstr "" 12163 12164 #: kdecore/TIMEZONES:956 12165 #, fuzzy, kde-format 12166 #| msgid "Asia/Ulaanbaatar" 12167 msgid "Asia/Ulan_Bator" 12168 msgstr "Azië/Ulaanbaatar" 12169 12170 #: kdecore/TIMEZONES:959 12171 #, kde-format 12172 msgid "Asia/Urumqi" 12173 msgstr "Azië/Urumqi" 12174 12175 #. i18n: comment to the previous timezone 12176 #: kdecore/TIMEZONES:961 12177 #, kde-format 12178 msgid "most of Tibet & Xinjiang" 12179 msgstr "" 12180 12181 #. i18n: comment to the previous timezone 12182 #: kdecore/TIMEZONES:963 12183 #, kde-format 12184 msgid "China Xinjiang-Tibet" 12185 msgstr "" 12186 12187 #. i18n: comment to the previous timezone 12188 #: kdecore/TIMEZONES:965 12189 #, kde-format 12190 msgid "Xinjiang Time" 12191 msgstr "" 12192 12193 #: kdecore/TIMEZONES:966 12194 #, fuzzy, kde-format 12195 #| msgid "Asia/Tehran" 12196 msgid "Asia/Ust-Nera" 12197 msgstr "Azië/Teheran" 12198 12199 #. i18n: comment to the previous timezone 12200 #: kdecore/TIMEZONES:968 12201 #, kde-format 12202 msgid "MSK+07 - Oymyakonsky" 12203 msgstr "" 12204 12205 #: kdecore/TIMEZONES:969 12206 #, kde-format 12207 msgid "Asia/Vientiane" 12208 msgstr "Azië/Vientiane" 12209 12210 #: kdecore/TIMEZONES:970 12211 #, kde-format 12212 msgid "Asia/Vladivostok" 12213 msgstr "Azië/Wladiwostok" 12214 12215 #. i18n: comment to the previous timezone 12216 #: kdecore/TIMEZONES:972 12217 #, kde-format 12218 msgid "Moscow+07 - Amur River" 12219 msgstr "" 12220 12221 #. i18n: comment to the previous timezone 12222 #: kdecore/TIMEZONES:974 12223 #, kde-format 12224 msgid "MSK+07 - Amur River" 12225 msgstr "" 12226 12227 #: kdecore/TIMEZONES:975 12228 #, kde-format 12229 msgid "Asia/Yakutsk" 12230 msgstr "Azië/Jakoetsk" 12231 12232 #. i18n: comment to the previous timezone 12233 #: kdecore/TIMEZONES:977 12234 #, kde-format 12235 msgid "Moscow+06 - Lena River" 12236 msgstr "" 12237 12238 #. i18n: comment to the previous timezone 12239 #: kdecore/TIMEZONES:979 12240 #, kde-format 12241 msgid "MSK+06 - Lena River" 12242 msgstr "" 12243 12244 #: kdecore/TIMEZONES:980 12245 #, fuzzy, kde-format 12246 #| msgid "Asia/Rangoon" 12247 msgid "Asia/Yangon" 12248 msgstr "Azië/Rangoon" 12249 12250 #: kdecore/TIMEZONES:981 12251 #, kde-format 12252 msgid "Asia/Yekaterinburg" 12253 msgstr "Azië/Yekaterinburg" 12254 12255 #. i18n: comment to the previous timezone 12256 #: kdecore/TIMEZONES:983 12257 #, kde-format 12258 msgid "Moscow+02 - Urals" 12259 msgstr "" 12260 12261 #. i18n: comment to the previous timezone 12262 #: kdecore/TIMEZONES:985 12263 #, kde-format 12264 msgid "MSK+02 - Urals" 12265 msgstr "" 12266 12267 #: kdecore/TIMEZONES:986 12268 #, kde-format 12269 msgid "Asia/Yerevan" 12270 msgstr "Azië/Yerevan" 12271 12272 #: kdecore/TIMEZONES:987 12273 #, kde-format 12274 msgid "Atlantic/Azores" 12275 msgstr "Atlantyske_Oseaan/Azoaren" 12276 12277 #. i18n: comment to the previous timezone 12278 #: kdecore/TIMEZONES:989 12279 #, kde-format 12280 msgid "Azores" 12281 msgstr "" 12282 12283 #: kdecore/TIMEZONES:990 12284 #, kde-format 12285 msgid "Atlantic/Bermuda" 12286 msgstr "Atlantyske_Oseaan/Bermuda" 12287 12288 #: kdecore/TIMEZONES:991 12289 #, kde-format 12290 msgid "Atlantic/Canary" 12291 msgstr "Atlantyske_Oseaan/Kanaryske_Eilannen" 12292 12293 #. i18n: comment to the previous timezone 12294 #: kdecore/TIMEZONES:993 12295 #, kde-format 12296 msgid "Canary Islands" 12297 msgstr "" 12298 12299 #: kdecore/TIMEZONES:994 12300 #, kde-format 12301 msgid "Atlantic/Cape_Verde" 12302 msgstr "Atlantyske_Oseaan/Kaapferdyske_Eilannen" 12303 12304 #: kdecore/TIMEZONES:995 12305 #, kde-format 12306 msgid "Atlantic/Faeroe" 12307 msgstr "Atlantyske_Oseaan/Faeroer" 12308 12309 #: kdecore/TIMEZONES:996 12310 #, fuzzy, kde-format 12311 #| msgid "Atlantic/Faeroe" 12312 msgid "Atlantic/Faroe" 12313 msgstr "Atlantyske_Oseaan/Faeroer" 12314 12315 #: kdecore/TIMEZONES:997 12316 #, kde-format 12317 msgid "Atlantic/Jan_Mayen" 12318 msgstr "Atlantyske_Oseaan/Jan_Mayen" 12319 12320 #: kdecore/TIMEZONES:998 12321 #, kde-format 12322 msgid "Atlantic/Madeira" 12323 msgstr "Atlantyske_Oseaan/Madeira" 12324 12325 #. i18n: comment to the previous timezone 12326 #: kdecore/TIMEZONES:1000 12327 #, kde-format 12328 msgid "Madeira Islands" 12329 msgstr "" 12330 12331 #: kdecore/TIMEZONES:1001 12332 #, kde-format 12333 msgid "Atlantic/Reykjavik" 12334 msgstr "Atlantyske_Oseaan/Reykjavik" 12335 12336 #: kdecore/TIMEZONES:1002 12337 #, kde-format 12338 msgid "Atlantic/South_Georgia" 12339 msgstr "Atlantyske_Oseaan/Súd_Georgia" 12340 12341 #: kdecore/TIMEZONES:1003 12342 #, kde-format 12343 msgid "Atlantic/St_Helena" 12344 msgstr "Atlantyske_Oseaan/St._Helena" 12345 12346 #: kdecore/TIMEZONES:1004 12347 #, kde-format 12348 msgid "Atlantic/Stanley" 12349 msgstr "Atlantyske_Oseaan/Stanley" 12350 12351 #: kdecore/TIMEZONES:1005 12352 #, fuzzy, kde-format 12353 #| msgid "Australia/Brisbane" 12354 msgid "Australia/ACT" 12355 msgstr "Australië/Brisbane" 12356 12357 #. i18n: comment to the previous timezone 12358 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12359 #: kdecore/TIMEZONES:1073 12360 #, kde-format 12361 msgid "New South Wales - most locations" 12362 msgstr "" 12363 12364 #: kdecore/TIMEZONES:1008 12365 #, kde-format 12366 msgid "Australia/Adelaide" 12367 msgstr "Australië/Adelaïde" 12368 12369 #. i18n: comment to the previous timezone 12370 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12371 #, fuzzy, kde-format 12372 #| msgid "Australia/Adelaide" 12373 msgid "South Australia" 12374 msgstr "Australië/Adelaïde" 12375 12376 #: kdecore/TIMEZONES:1011 12377 #, kde-format 12378 msgid "Australia/Brisbane" 12379 msgstr "Australië/Brisbane" 12380 12381 #. i18n: comment to the previous timezone 12382 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12383 #, kde-format 12384 msgid "Queensland - most locations" 12385 msgstr "" 12386 12387 #. i18n: comment to the previous timezone 12388 #: kdecore/TIMEZONES:1015 12389 #, kde-format 12390 msgid "Queensland (most areas)" 12391 msgstr "" 12392 12393 #: kdecore/TIMEZONES:1016 12394 #, kde-format 12395 msgid "Australia/Broken_Hill" 12396 msgstr "Australië/Broken_Hill" 12397 12398 #. i18n: comment to the previous timezone 12399 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12400 #, kde-format 12401 msgid "New South Wales - Yancowinna" 12402 msgstr "" 12403 12404 #. i18n: comment to the previous timezone 12405 #: kdecore/TIMEZONES:1020 12406 #, kde-format 12407 msgid "New South Wales (Yancowinna)" 12408 msgstr "" 12409 12410 #: kdecore/TIMEZONES:1021 12411 #, fuzzy, kde-format 12412 #| msgid "Australia/Brisbane" 12413 msgid "Australia/Canberra" 12414 msgstr "Australië/Brisbane" 12415 12416 #: kdecore/TIMEZONES:1024 12417 #, fuzzy, kde-format 12418 #| msgid "Australia/Brisbane" 12419 msgid "Australia/Currie" 12420 msgstr "Australië/Brisbane" 12421 12422 #. i18n: comment to the previous timezone 12423 #: kdecore/TIMEZONES:1026 12424 #, kde-format 12425 msgid "Tasmania - King Island" 12426 msgstr "" 12427 12428 #: kdecore/TIMEZONES:1027 12429 #, kde-format 12430 msgid "Australia/Darwin" 12431 msgstr "Australië/Darwin" 12432 12433 #. i18n: comment to the previous timezone 12434 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12435 #, kde-format 12436 msgid "Northern Territory" 12437 msgstr "" 12438 12439 #: kdecore/TIMEZONES:1030 12440 #, fuzzy, kde-format 12441 #| msgid "Australia/Adelaide" 12442 msgid "Australia/Eucla" 12443 msgstr "Australië/Adelaïde" 12444 12445 #. i18n: comment to the previous timezone 12446 #: kdecore/TIMEZONES:1032 12447 #, fuzzy, kde-format 12448 #| msgid "Australia/Adelaide" 12449 msgid "Western Australia - Eucla area" 12450 msgstr "Australië/Adelaïde" 12451 12452 #. i18n: comment to the previous timezone 12453 #: kdecore/TIMEZONES:1034 12454 #, fuzzy, kde-format 12455 #| msgid "Australia/Adelaide" 12456 msgid "Western Australia (Eucla)" 12457 msgstr "Australië/Adelaïde" 12458 12459 #: kdecore/TIMEZONES:1035 12460 #, kde-format 12461 msgid "Australia/Hobart" 12462 msgstr "Australië/Hobart" 12463 12464 #. i18n: comment to the previous timezone 12465 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12466 #, kde-format 12467 msgid "Tasmania - most locations" 12468 msgstr "" 12469 12470 #. i18n: comment to the previous timezone 12471 #: kdecore/TIMEZONES:1039 12472 #, fuzzy, kde-format 12473 #| msgid "Australia/Brisbane" 12474 msgid "Tasmania" 12475 msgstr "Australië/Brisbane" 12476 12477 #: kdecore/TIMEZONES:1040 12478 #, fuzzy, kde-format 12479 #| msgid "Australia/Hobart" 12480 msgid "Australia/LHI" 12481 msgstr "Australië/Hobart" 12482 12483 #. i18n: comment to the previous timezone 12484 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12485 #, kde-format 12486 msgid "Lord Howe Island" 12487 msgstr "" 12488 12489 #: kdecore/TIMEZONES:1043 12490 #, kde-format 12491 msgid "Australia/Lindeman" 12492 msgstr "Australië/Lindeman" 12493 12494 #. i18n: comment to the previous timezone 12495 #: kdecore/TIMEZONES:1045 12496 #, kde-format 12497 msgid "Queensland - Holiday Islands" 12498 msgstr "" 12499 12500 #. i18n: comment to the previous timezone 12501 #: kdecore/TIMEZONES:1047 12502 #, kde-format 12503 msgid "Queensland (Whitsunday Islands)" 12504 msgstr "" 12505 12506 #: kdecore/TIMEZONES:1048 12507 #, kde-format 12508 msgid "Australia/Lord_Howe" 12509 msgstr "Australië/Lord_Howe" 12510 12511 #: kdecore/TIMEZONES:1051 12512 #, kde-format 12513 msgid "Australia/Melbourne" 12514 msgstr "Australië/Melbourne" 12515 12516 #. i18n: comment to the previous timezone 12517 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12518 #, kde-format 12519 msgid "Victoria" 12520 msgstr "" 12521 12522 #: kdecore/TIMEZONES:1054 12523 #, fuzzy, kde-format 12524 #| msgid "Australia/Sydney" 12525 msgid "Australia/NSW" 12526 msgstr "Australië/Sydney" 12527 12528 #: kdecore/TIMEZONES:1057 12529 #, fuzzy, kde-format 12530 #| msgid "Australia/Perth" 12531 msgid "Australia/North" 12532 msgstr "Australië/Perth" 12533 12534 #: kdecore/TIMEZONES:1060 12535 #, kde-format 12536 msgid "Australia/Perth" 12537 msgstr "Australië/Perth" 12538 12539 #. i18n: comment to the previous timezone 12540 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12541 #, kde-format 12542 msgid "Western Australia - most locations" 12543 msgstr "" 12544 12545 #. i18n: comment to the previous timezone 12546 #: kdecore/TIMEZONES:1064 12547 #, fuzzy, kde-format 12548 #| msgid "Australia/Adelaide" 12549 msgid "Western Australia (most areas)" 12550 msgstr "Australië/Adelaïde" 12551 12552 #: kdecore/TIMEZONES:1065 12553 #, fuzzy, kde-format 12554 #| msgid "Australia/Adelaide" 12555 msgid "Australia/Queensland" 12556 msgstr "Australië/Adelaïde" 12557 12558 #: kdecore/TIMEZONES:1068 12559 #, fuzzy, kde-format 12560 #| msgid "Australia/Perth" 12561 msgid "Australia/South" 12562 msgstr "Australië/Perth" 12563 12564 #: kdecore/TIMEZONES:1071 12565 #, kde-format 12566 msgid "Australia/Sydney" 12567 msgstr "Australië/Sydney" 12568 12569 #. i18n: comment to the previous timezone 12570 #: kdecore/TIMEZONES:1075 12571 #, kde-format 12572 msgid "New South Wales (most areas)" 12573 msgstr "" 12574 12575 #: kdecore/TIMEZONES:1076 12576 #, fuzzy, kde-format 12577 #| msgid "Australia/Brisbane" 12578 msgid "Australia/Tasmania" 12579 msgstr "Australië/Brisbane" 12580 12581 #: kdecore/TIMEZONES:1079 12582 #, fuzzy, kde-format 12583 #| msgid "Australia/Adelaide" 12584 msgid "Australia/Victoria" 12585 msgstr "Australië/Adelaïde" 12586 12587 #: kdecore/TIMEZONES:1082 12588 #, fuzzy, kde-format 12589 #| msgid "Australia/Perth" 12590 msgid "Australia/West" 12591 msgstr "Australië/Perth" 12592 12593 #: kdecore/TIMEZONES:1085 12594 #, fuzzy, kde-format 12595 #| msgid "Australia/Darwin" 12596 msgid "Australia/Yancowinna" 12597 msgstr "Australië/Darwin" 12598 12599 #: kdecore/TIMEZONES:1088 12600 #, kde-format 12601 msgid "Brazil/Acre" 12602 msgstr "" 12603 12604 #: kdecore/TIMEZONES:1091 12605 #, fuzzy, kde-format 12606 #| msgid "America/Noronha" 12607 msgid "Brazil/DeNoronha" 12608 msgstr "Amearika/Noronha" 12609 12610 #: kdecore/TIMEZONES:1094 12611 #, kde-format 12612 msgid "Brazil/East" 12613 msgstr "" 12614 12615 #: kdecore/TIMEZONES:1097 12616 #, kde-format 12617 msgid "Brazil/West" 12618 msgstr "" 12619 12620 #: kdecore/TIMEZONES:1100 12621 #, kde-format 12622 msgid "Canada/Atlantic" 12623 msgstr "" 12624 12625 #: kdecore/TIMEZONES:1103 12626 #, kde-format 12627 msgid "Canada/Central" 12628 msgstr "" 12629 12630 #: kdecore/TIMEZONES:1106 12631 #, kde-format 12632 msgid "Canada/East-Saskatchewan" 12633 msgstr "" 12634 12635 #: kdecore/TIMEZONES:1109 12636 #, kde-format 12637 msgid "Canada/Eastern" 12638 msgstr "" 12639 12640 #: kdecore/TIMEZONES:1112 12641 #, kde-format 12642 msgid "Canada/Mountain" 12643 msgstr "" 12644 12645 #: kdecore/TIMEZONES:1115 12646 #, kde-format 12647 msgid "Canada/Newfoundland" 12648 msgstr "" 12649 12650 #: kdecore/TIMEZONES:1118 12651 #, kde-format 12652 msgid "Canada/Pacific" 12653 msgstr "" 12654 12655 #: kdecore/TIMEZONES:1121 12656 #, kde-format 12657 msgid "Canada/Saskatchewan" 12658 msgstr "" 12659 12660 #: kdecore/TIMEZONES:1124 12661 #, kde-format 12662 msgid "Canada/Yukon" 12663 msgstr "" 12664 12665 #: kdecore/TIMEZONES:1127 12666 #, kde-format 12667 msgid "Chile/Continental" 12668 msgstr "" 12669 12670 #: kdecore/TIMEZONES:1130 12671 #, kde-format 12672 msgid "Chile/EasterIsland" 12673 msgstr "" 12674 12675 #. i18n: comment to the previous timezone 12676 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12677 #, kde-format 12678 msgid "Easter Island & Sala y Gomez" 12679 msgstr "" 12680 12681 #: kdecore/TIMEZONES:1133 12682 #, kde-format 12683 msgid "Cuba" 12684 msgstr "" 12685 12686 #: kdecore/TIMEZONES:1134 12687 #, kde-format 12688 msgid "Egypt" 12689 msgstr "" 12690 12691 #: kdecore/TIMEZONES:1135 12692 #, kde-format 12693 msgid "Eire" 12694 msgstr "" 12695 12696 #: kdecore/TIMEZONES:1136 12697 #, kde-format 12698 msgid "Europe/Amsterdam" 12699 msgstr "Europa/Amsterdam" 12700 12701 #: kdecore/TIMEZONES:1137 12702 #, kde-format 12703 msgid "Europe/Andorra" 12704 msgstr "Europa/Andorra" 12705 12706 #: kdecore/TIMEZONES:1138 12707 #, fuzzy, kde-format 12708 #| msgid "Europe/Athens" 12709 msgid "Europe/Astrakhan" 12710 msgstr "Europa/Athene" 12711 12712 #. i18n: comment to the previous timezone 12713 #: kdecore/TIMEZONES:1140 12714 #, kde-format 12715 msgid "MSK+01 - Astrakhan" 12716 msgstr "" 12717 12718 #: kdecore/TIMEZONES:1141 12719 #, kde-format 12720 msgid "Europe/Athens" 12721 msgstr "Europa/Athene" 12722 12723 #: kdecore/TIMEZONES:1142 12724 #, kde-format 12725 msgid "Europe/Belfast" 12726 msgstr "Europa/Belfast" 12727 12728 #: kdecore/TIMEZONES:1143 12729 #, kde-format 12730 msgid "Europe/Belgrade" 12731 msgstr "Europa/Belgrado" 12732 12733 #: kdecore/TIMEZONES:1144 12734 #, kde-format 12735 msgid "Europe/Berlin" 12736 msgstr "Europa/Berlyn" 12737 12738 #. i18n: comment to the previous timezone 12739 #: kdecore/TIMEZONES:1146 12740 #, kde-format 12741 msgid "Germany (most areas)" 12742 msgstr "" 12743 12744 #: kdecore/TIMEZONES:1147 12745 #, kde-format 12746 msgid "Europe/Bratislava" 12747 msgstr "Europa/Bratislava" 12748 12749 #: kdecore/TIMEZONES:1148 12750 #, kde-format 12751 msgid "Europe/Brussels" 12752 msgstr "Europa/Brussel" 12753 12754 #: kdecore/TIMEZONES:1149 12755 #, kde-format 12756 msgid "Europe/Bucharest" 12757 msgstr "Europa/Boekarest" 12758 12759 #: kdecore/TIMEZONES:1150 12760 #, kde-format 12761 msgid "Europe/Budapest" 12762 msgstr "Europa/Bûdapest" 12763 12764 #: kdecore/TIMEZONES:1151 12765 #, fuzzy, kde-format 12766 #| msgid "Europe/Brussels" 12767 msgid "Europe/Busingen" 12768 msgstr "Europa/Brussel" 12769 12770 #. i18n: comment to the previous timezone 12771 #: kdecore/TIMEZONES:1153 12772 #, kde-format 12773 msgid "Busingen" 12774 msgstr "" 12775 12776 #: kdecore/TIMEZONES:1154 12777 #, kde-format 12778 msgid "Europe/Chisinau" 12779 msgstr "Europa/Chisinau" 12780 12781 #: kdecore/TIMEZONES:1155 12782 #, kde-format 12783 msgid "Europe/Copenhagen" 12784 msgstr "Europa/Kopenhagen" 12785 12786 #: kdecore/TIMEZONES:1156 12787 #, kde-format 12788 msgid "Europe/Dublin" 12789 msgstr "Europa/Dublin" 12790 12791 #: kdecore/TIMEZONES:1157 12792 #, kde-format 12793 msgid "Europe/Gibraltar" 12794 msgstr "Europa/Gibraltar" 12795 12796 #: kdecore/TIMEZONES:1158 12797 #, fuzzy, kde-format 12798 #| msgid "Europe/Athens" 12799 msgid "Europe/Guernsey" 12800 msgstr "Europa/Athene" 12801 12802 #: kdecore/TIMEZONES:1159 12803 #, kde-format 12804 msgid "Europe/Helsinki" 12805 msgstr "Europa/Helsinki" 12806 12807 #: kdecore/TIMEZONES:1160 12808 #, fuzzy, kde-format 12809 #| msgid "Europe/Oslo" 12810 msgid "Europe/Isle_of_Man" 12811 msgstr "Europa/Oslo" 12812 12813 #: kdecore/TIMEZONES:1161 12814 #, kde-format 12815 msgid "Europe/Istanbul" 12816 msgstr "Europa/Istanboel" 12817 12818 #: kdecore/TIMEZONES:1162 12819 #, fuzzy, kde-format 12820 #| msgid "Europe/Paris" 12821 msgid "Europe/Jersey" 12822 msgstr "Europa/Parys" 12823 12824 #: kdecore/TIMEZONES:1163 12825 #, kde-format 12826 msgid "Europe/Kaliningrad" 12827 msgstr "Europa/Kaliningrad" 12828 12829 #. i18n: comment to the previous timezone 12830 #: kdecore/TIMEZONES:1165 12831 #, kde-format 12832 msgid "Moscow-01 - Kaliningrad" 12833 msgstr "" 12834 12835 #. i18n: comment to the previous timezone 12836 #: kdecore/TIMEZONES:1167 12837 #, kde-format 12838 msgid "MSK-01 - Kaliningrad" 12839 msgstr "" 12840 12841 #: kdecore/TIMEZONES:1168 12842 #, kde-format 12843 msgid "Europe/Kiev" 12844 msgstr "Europa/Kiev" 12845 12846 #. i18n: comment to the previous timezone 12847 #: kdecore/TIMEZONES:1172 12848 #, kde-format 12849 msgid "Ukraine (most areas)" 12850 msgstr "" 12851 12852 #: kdecore/TIMEZONES:1173 12853 #, fuzzy, kde-format 12854 #| msgid "Europe/Kiev" 12855 msgid "Europe/Kirov" 12856 msgstr "Europa/Kiev" 12857 12858 #. i18n: comment to the previous timezone 12859 #: kdecore/TIMEZONES:1175 12860 #, kde-format 12861 msgid "MSK+00 - Kirov" 12862 msgstr "" 12863 12864 #: kdecore/TIMEZONES:1176 12865 #, kde-format 12866 msgid "Europe/Lisbon" 12867 msgstr "Europa/Lissabon" 12868 12869 #. i18n: comment to the previous timezone 12870 #: kdecore/TIMEZONES:1180 12871 #, kde-format 12872 msgid "Portugal (mainland)" 12873 msgstr "" 12874 12875 #: kdecore/TIMEZONES:1181 12876 #, kde-format 12877 msgid "Europe/Ljubljana" 12878 msgstr "Europa/Ljubljana" 12879 12880 #: kdecore/TIMEZONES:1182 12881 #, kde-format 12882 msgid "Europe/London" 12883 msgstr "Europa/Londen" 12884 12885 #: kdecore/TIMEZONES:1183 12886 #, kde-format 12887 msgid "Europe/Luxembourg" 12888 msgstr "Europa/Lúksemboarch" 12889 12890 #: kdecore/TIMEZONES:1184 12891 #, kde-format 12892 msgid "Europe/Madrid" 12893 msgstr "Europa/Madrid" 12894 12895 #. i18n: comment to the previous timezone 12896 #: kdecore/TIMEZONES:1188 12897 #, kde-format 12898 msgid "Spain (mainland)" 12899 msgstr "" 12900 12901 #: kdecore/TIMEZONES:1189 12902 #, kde-format 12903 msgid "Europe/Malta" 12904 msgstr "Europa/Malta" 12905 12906 #: kdecore/TIMEZONES:1190 12907 #, kde-format 12908 msgid "Europe/Mariehamn" 12909 msgstr "Europa/Mariehamn" 12910 12911 #: kdecore/TIMEZONES:1191 12912 #, kde-format 12913 msgid "Europe/Minsk" 12914 msgstr "Europa/Minsk" 12915 12916 #: kdecore/TIMEZONES:1192 12917 #, kde-format 12918 msgid "Europe/Monaco" 12919 msgstr "Europa/Monako" 12920 12921 #: kdecore/TIMEZONES:1193 12922 #, kde-format 12923 msgid "Europe/Moscow" 12924 msgstr "Europa/Moskou" 12925 12926 #. i18n: comment to the previous timezone 12927 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12928 #, kde-format 12929 msgid "Moscow+00 - west Russia" 12930 msgstr "" 12931 12932 #. i18n: comment to the previous timezone 12933 #: kdecore/TIMEZONES:1197 12934 #, kde-format 12935 msgid "MSK+00 - Moscow area" 12936 msgstr "" 12937 12938 #: kdecore/TIMEZONES:1198 12939 #, kde-format 12940 msgid "Europe/Oslo" 12941 msgstr "Europa/Oslo" 12942 12943 #: kdecore/TIMEZONES:1199 12944 #, kde-format 12945 msgid "Europe/Paris" 12946 msgstr "Europa/Parys" 12947 12948 #: kdecore/TIMEZONES:1200 12949 #, fuzzy, kde-format 12950 #| msgid "Europe/Andorra" 12951 msgid "Europe/Podgorica" 12952 msgstr "Europa/Andorra" 12953 12954 #: kdecore/TIMEZONES:1201 12955 #, kde-format 12956 msgid "Europe/Prague" 12957 msgstr "Europa/Praach" 12958 12959 #: kdecore/TIMEZONES:1202 12960 #, kde-format 12961 msgid "Europe/Riga" 12962 msgstr "Europa/Riga" 12963 12964 #: kdecore/TIMEZONES:1203 12965 #, kde-format 12966 msgid "Europe/Rome" 12967 msgstr "Europa/Rome" 12968 12969 #: kdecore/TIMEZONES:1204 12970 #, kde-format 12971 msgid "Europe/Samara" 12972 msgstr "Europa/Samara" 12973 12974 #. i18n: comment to the previous timezone 12975 #: kdecore/TIMEZONES:1206 12976 #, kde-format 12977 msgid "Moscow+01 - Samara, Udmurtia" 12978 msgstr "" 12979 12980 #. i18n: comment to the previous timezone 12981 #: kdecore/TIMEZONES:1208 12982 #, kde-format 12983 msgid "Moscow+00 - Samara, Udmurtia" 12984 msgstr "" 12985 12986 #. i18n: comment to the previous timezone 12987 #: kdecore/TIMEZONES:1210 12988 #, kde-format 12989 msgid "MSK+01 - Samara, Udmurtia" 12990 msgstr "" 12991 12992 #: kdecore/TIMEZONES:1211 12993 #, kde-format 12994 msgid "Europe/San_Marino" 12995 msgstr "Europa/San_Marino" 12996 12997 #: kdecore/TIMEZONES:1212 12998 #, kde-format 12999 msgid "Europe/Sarajevo" 13000 msgstr "Europa/Sarajevo" 13001 13002 #: kdecore/TIMEZONES:1213 13003 #, fuzzy, kde-format 13004 #| msgid "Europe/Sarajevo" 13005 msgid "Europe/Saratov" 13006 msgstr "Europa/Sarajevo" 13007 13008 #. i18n: comment to the previous timezone 13009 #: kdecore/TIMEZONES:1215 13010 #, kde-format 13011 msgid "MSK+01 - Saratov" 13012 msgstr "" 13013 13014 #: kdecore/TIMEZONES:1216 13015 #, kde-format 13016 msgid "Europe/Simferopol" 13017 msgstr "Europa/Simferopol" 13018 13019 #. i18n: comment to the previous timezone 13020 #: kdecore/TIMEZONES:1218 13021 #, kde-format 13022 msgid "central Crimea" 13023 msgstr "" 13024 13025 #. i18n: comment to the previous timezone 13026 #: kdecore/TIMEZONES:1220 13027 #, fuzzy, kde-format 13028 #| msgid "Prime: " 13029 msgid "Crimea" 13030 msgstr "Priemgetal: " 13031 13032 #: kdecore/TIMEZONES:1221 13033 #, kde-format 13034 msgid "Europe/Skopje" 13035 msgstr "Europa/Skopje" 13036 13037 #: kdecore/TIMEZONES:1222 13038 #, kde-format 13039 msgid "Europe/Sofia" 13040 msgstr "Europa/Sofia" 13041 13042 #: kdecore/TIMEZONES:1223 13043 #, kde-format 13044 msgid "Europe/Stockholm" 13045 msgstr "Europa/Stockholm" 13046 13047 #: kdecore/TIMEZONES:1224 13048 #, kde-format 13049 msgid "Europe/Tallinn" 13050 msgstr "Europa/Tallinn" 13051 13052 #: kdecore/TIMEZONES:1225 13053 #, kde-format 13054 msgid "Europe/Tirane" 13055 msgstr "Europa/Tirana" 13056 13057 #: kdecore/TIMEZONES:1226 13058 #, fuzzy, kde-format 13059 #| msgid "Europe/Tirane" 13060 msgid "Europe/Tiraspol" 13061 msgstr "Europa/Tirana" 13062 13063 #: kdecore/TIMEZONES:1227 13064 #, fuzzy, kde-format 13065 #| msgid "Europe/Minsk" 13066 msgid "Europe/Ulyanovsk" 13067 msgstr "Europa/Minsk" 13068 13069 #. i18n: comment to the previous timezone 13070 #: kdecore/TIMEZONES:1229 13071 #, kde-format 13072 msgid "MSK+01 - Ulyanovsk" 13073 msgstr "" 13074 13075 #: kdecore/TIMEZONES:1230 13076 #, kde-format 13077 msgid "Europe/Uzhgorod" 13078 msgstr "Europa/Oezjgorod" 13079 13080 #. i18n: comment to the previous timezone 13081 #: kdecore/TIMEZONES:1232 13082 #, kde-format 13083 msgid "Ruthenia" 13084 msgstr "" 13085 13086 #. i18n: comment to the previous timezone 13087 #: kdecore/TIMEZONES:1234 13088 #, kde-format 13089 msgid "Transcarpathia" 13090 msgstr "" 13091 13092 #: kdecore/TIMEZONES:1235 13093 #, kde-format 13094 msgid "Europe/Vaduz" 13095 msgstr "Europa/Vaduz" 13096 13097 #: kdecore/TIMEZONES:1236 13098 #, kde-format 13099 msgid "Europe/Vatican" 13100 msgstr "Europa/Vatikaanstêd" 13101 13102 #: kdecore/TIMEZONES:1237 13103 #, kde-format 13104 msgid "Europe/Vienna" 13105 msgstr "Europa/Wenen" 13106 13107 #: kdecore/TIMEZONES:1238 13108 #, kde-format 13109 msgid "Europe/Vilnius" 13110 msgstr "Europa/Vilnius" 13111 13112 #: kdecore/TIMEZONES:1239 13113 #, fuzzy, kde-format 13114 #| msgid "Europe/Belgrade" 13115 msgid "Europe/Volgograd" 13116 msgstr "Europa/Belgrado" 13117 13118 #. i18n: comment to the previous timezone 13119 #: kdecore/TIMEZONES:1241 13120 #, kde-format 13121 msgid "Moscow+00 - Caspian Sea" 13122 msgstr "" 13123 13124 #. i18n: comment to the previous timezone 13125 #: kdecore/TIMEZONES:1243 13126 #, kde-format 13127 msgid "MSK+00 - Volgograd" 13128 msgstr "" 13129 13130 #: kdecore/TIMEZONES:1244 13131 #, kde-format 13132 msgid "Europe/Warsaw" 13133 msgstr "Europa/Warschau" 13134 13135 #: kdecore/TIMEZONES:1245 13136 #, kde-format 13137 msgid "Europe/Zagreb" 13138 msgstr "Europa/Zagreb" 13139 13140 #: kdecore/TIMEZONES:1246 13141 #, kde-format 13142 msgid "Europe/Zaporozhye" 13143 msgstr "Europa/Zaporozhye" 13144 13145 #. i18n: comment to the previous timezone 13146 #: kdecore/TIMEZONES:1248 13147 #, kde-format 13148 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 13149 msgstr "" 13150 13151 #. i18n: comment to the previous timezone 13152 #: kdecore/TIMEZONES:1250 13153 #, kde-format 13154 msgid "Zaporozhye and east Lugansk" 13155 msgstr "" 13156 13157 #: kdecore/TIMEZONES:1251 13158 #, kde-format 13159 msgid "Europe/Zurich" 13160 msgstr "Europa/Surch" 13161 13162 #: kdecore/TIMEZONES:1252 13163 #, kde-format 13164 msgid "GB" 13165 msgstr "" 13166 13167 #: kdecore/TIMEZONES:1253 13168 #, kde-format 13169 msgid "GB-Eire" 13170 msgstr "" 13171 13172 #: kdecore/TIMEZONES:1254 13173 #, fuzzy, kde-format 13174 #| msgid "Asia/Hong_Kong" 13175 msgid "Hongkong" 13176 msgstr "Azië/Hong_Kong" 13177 13178 #: kdecore/TIMEZONES:1255 13179 #, kde-format 13180 msgid "Iceland" 13181 msgstr "" 13182 13183 #: kdecore/TIMEZONES:1256 13184 #, kde-format 13185 msgid "Indian/Antananarivo" 13186 msgstr "Indyske_Oseaan/Antananarivo" 13187 13188 #: kdecore/TIMEZONES:1257 13189 #, kde-format 13190 msgid "Indian/Chagos" 13191 msgstr "Indyske_Oseaan/Chagos" 13192 13193 #: kdecore/TIMEZONES:1258 13194 #, kde-format 13195 msgid "Indian/Christmas" 13196 msgstr "Indyske_Oseaan/Christmas" 13197 13198 #: kdecore/TIMEZONES:1259 13199 #, kde-format 13200 msgid "Indian/Cocos" 13201 msgstr "Indyske_Oseaan/Cocos" 13202 13203 #: kdecore/TIMEZONES:1260 13204 #, kde-format 13205 msgid "Indian/Comoro" 13206 msgstr "Indyske_Oseaan/De_Komoaren" 13207 13208 #: kdecore/TIMEZONES:1261 13209 #, kde-format 13210 msgid "Indian/Kerguelen" 13211 msgstr "Indyske_Oseaan/Kerguelen" 13212 13213 #: kdecore/TIMEZONES:1262 13214 #, kde-format 13215 msgid "Indian/Mahe" 13216 msgstr "Indyske_Oseaan/Mahe" 13217 13218 #: kdecore/TIMEZONES:1263 13219 #, kde-format 13220 msgid "Indian/Maldives" 13221 msgstr "Indyske_Oseaan/Maldiven" 13222 13223 #: kdecore/TIMEZONES:1264 13224 #, kde-format 13225 msgid "Indian/Mauritius" 13226 msgstr "Indyske_Oseaan/Mauritius" 13227 13228 #: kdecore/TIMEZONES:1265 13229 #, kde-format 13230 msgid "Indian/Mayotte" 13231 msgstr "Indyske_Oseaan/Mayotte" 13232 13233 #: kdecore/TIMEZONES:1266 13234 #, kde-format 13235 msgid "Indian/Reunion" 13236 msgstr "Indyske_Oseaan/Reunion" 13237 13238 #: kdecore/TIMEZONES:1267 13239 #, kde-format 13240 msgid "Iran" 13241 msgstr "" 13242 13243 #: kdecore/TIMEZONES:1268 13244 #, fuzzy, kde-format 13245 #| msgid "Pacific/Kosrae" 13246 msgid "Israel" 13247 msgstr "Grutte_Oseaan/Kosrae" 13248 13249 #: kdecore/TIMEZONES:1269 13250 #, fuzzy, kde-format 13251 #| msgid "America/Jamaica" 13252 msgid "Jamaica" 13253 msgstr "Amearika/Jamaica" 13254 13255 #: kdecore/TIMEZONES:1270 13256 #, kde-format 13257 msgid "Japan" 13258 msgstr "" 13259 13260 #. i18n: comment to the previous timezone 13261 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 13262 #, fuzzy, kde-format 13263 #| msgid "Pacific/Kwajalein" 13264 msgid "Kwajalein" 13265 msgstr "Grutte_Oseaan/Kwajalein" 13266 13267 #: kdecore/TIMEZONES:1274 13268 #, kde-format 13269 msgid "Libya" 13270 msgstr "" 13271 13272 #: kdecore/TIMEZONES:1275 13273 #, kde-format 13274 msgid "Mexico/BajaNorte" 13275 msgstr "" 13276 13277 #: kdecore/TIMEZONES:1278 13278 #, kde-format 13279 msgid "Mexico/BajaSur" 13280 msgstr "" 13281 13282 #: kdecore/TIMEZONES:1281 13283 #, kde-format 13284 msgid "Mexico/General" 13285 msgstr "" 13286 13287 #: kdecore/TIMEZONES:1284 13288 #, kde-format 13289 msgid "NZ" 13290 msgstr "" 13291 13292 #: kdecore/TIMEZONES:1287 13293 #, kde-format 13294 msgid "NZ-CHAT" 13295 msgstr "" 13296 13297 #. i18n: comment to the previous timezone 13298 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 13299 #, kde-format 13300 msgid "Chatham Islands" 13301 msgstr "" 13302 13303 #: kdecore/TIMEZONES:1290 13304 #, kde-format 13305 msgid "Navajo" 13306 msgstr "" 13307 13308 #: kdecore/TIMEZONES:1293 13309 #, kde-format 13310 msgid "PRC" 13311 msgstr "" 13312 13313 #: kdecore/TIMEZONES:1296 13314 #, kde-format 13315 msgid "Pacific/Apia" 13316 msgstr "Grutte_Oseaan/Apia" 13317 13318 #: kdecore/TIMEZONES:1297 13319 #, kde-format 13320 msgid "Pacific/Auckland" 13321 msgstr "Grutte_Oseaan/Auckland" 13322 13323 #. i18n: comment to the previous timezone 13324 #: kdecore/TIMEZONES:1301 13325 #, kde-format 13326 msgid "New Zealand (most areas)" 13327 msgstr "" 13328 13329 #: kdecore/TIMEZONES:1302 13330 #, fuzzy, kde-format 13331 #| msgid "Pacific/Honolulu" 13332 msgid "Pacific/Bougainville" 13333 msgstr "Grutte_Oseaan/Honolulu" 13334 13335 #. i18n: comment to the previous timezone 13336 #: kdecore/TIMEZONES:1304 13337 #, kde-format 13338 msgid "Bougainville" 13339 msgstr "" 13340 13341 #: kdecore/TIMEZONES:1305 13342 #, kde-format 13343 msgid "Pacific/Chatham" 13344 msgstr "Grutte_Oseaan/Chatham" 13345 13346 #: kdecore/TIMEZONES:1308 13347 #, fuzzy, kde-format 13348 #| msgid "Pacific/Truk" 13349 msgid "Pacific/Chuuk" 13350 msgstr "Grutte_Oseaan/Truk" 13351 13352 #. i18n: comment to the previous timezone 13353 #: kdecore/TIMEZONES:1310 13354 #, kde-format 13355 msgid "Chuuk (Truk) and Yap" 13356 msgstr "" 13357 13358 #. i18n: comment to the previous timezone 13359 #: kdecore/TIMEZONES:1312 13360 #, kde-format 13361 msgid "Chuuk/Truk, Yap" 13362 msgstr "" 13363 13364 #: kdecore/TIMEZONES:1313 13365 #, kde-format 13366 msgid "Pacific/Easter" 13367 msgstr "Grutte_Oseaan/Peaske-eilân" 13368 13369 #. i18n: comment to the previous timezone 13370 #: kdecore/TIMEZONES:1317 13371 #, fuzzy, kde-format 13372 #| msgctxt "digit set" 13373 #| msgid "Eastern Arabic-Indic" 13374 msgid "Easter Island" 13375 msgstr "Eastlik Arabysk-indysk" 13376 13377 #: kdecore/TIMEZONES:1318 13378 #, kde-format 13379 msgid "Pacific/Efate" 13380 msgstr "Grutte_Oseaan/Efate" 13381 13382 #: kdecore/TIMEZONES:1319 13383 #, kde-format 13384 msgid "Pacific/Enderbury" 13385 msgstr "Grutte_Oseaan/Enderbury" 13386 13387 #. i18n: comment to the previous timezone 13388 #: kdecore/TIMEZONES:1321 13389 #, kde-format 13390 msgid "Phoenix Islands" 13391 msgstr "" 13392 13393 #: kdecore/TIMEZONES:1322 13394 #, kde-format 13395 msgid "Pacific/Fakaofo" 13396 msgstr "Grutte_Oseaan/Fakaofo" 13397 13398 #: kdecore/TIMEZONES:1323 13399 #, kde-format 13400 msgid "Pacific/Fiji" 13401 msgstr "Grutte_Oseaan/Fiji" 13402 13403 #: kdecore/TIMEZONES:1324 13404 #, kde-format 13405 msgid "Pacific/Funafuti" 13406 msgstr "Grutte_Oseaan/Funafuti" 13407 13408 #: kdecore/TIMEZONES:1325 13409 #, kde-format 13410 msgid "Pacific/Galapagos" 13411 msgstr "Grutte_Oseaan/Galapagos" 13412 13413 #. i18n: comment to the previous timezone 13414 #: kdecore/TIMEZONES:1327 13415 #, kde-format 13416 msgid "Galapagos Islands" 13417 msgstr "" 13418 13419 #: kdecore/TIMEZONES:1328 13420 #, kde-format 13421 msgid "Pacific/Gambier" 13422 msgstr "Grutte_Oseaan/Gambier" 13423 13424 #. i18n: comment to the previous timezone 13425 #: kdecore/TIMEZONES:1330 13426 #, kde-format 13427 msgid "Gambier Islands" 13428 msgstr "" 13429 13430 #: kdecore/TIMEZONES:1331 13431 #, kde-format 13432 msgid "Pacific/Guadalcanal" 13433 msgstr "Grutte_Oseaan/Guadalcanal" 13434 13435 #: kdecore/TIMEZONES:1332 13436 #, kde-format 13437 msgid "Pacific/Guam" 13438 msgstr "Grutte_Oseaan/Guam" 13439 13440 #: kdecore/TIMEZONES:1333 13441 #, kde-format 13442 msgid "Pacific/Honolulu" 13443 msgstr "Grutte_Oseaan/Honolulu" 13444 13445 #. i18n: comment to the previous timezone 13446 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13447 #, kde-format 13448 msgid "Hawaii" 13449 msgstr "" 13450 13451 #: kdecore/TIMEZONES:1336 13452 #, kde-format 13453 msgid "Pacific/Johnston" 13454 msgstr "Grutte_Oseaan/Johnston" 13455 13456 #. i18n: comment to the previous timezone 13457 #: kdecore/TIMEZONES:1338 13458 #, kde-format 13459 msgid "Johnston Atoll" 13460 msgstr "" 13461 13462 #: kdecore/TIMEZONES:1339 13463 #, kde-format 13464 msgid "Pacific/Kiritimati" 13465 msgstr "Grutte_Oseaan/Kiritimati" 13466 13467 #. i18n: comment to the previous timezone 13468 #: kdecore/TIMEZONES:1341 13469 #, kde-format 13470 msgid "Line Islands" 13471 msgstr "" 13472 13473 #: kdecore/TIMEZONES:1342 13474 #, kde-format 13475 msgid "Pacific/Kosrae" 13476 msgstr "Grutte_Oseaan/Kosrae" 13477 13478 #. i18n: comment to the previous timezone 13479 #: kdecore/TIMEZONES:1344 13480 #, fuzzy, kde-format 13481 #| msgid "Pacific/Kosrae" 13482 msgid "Kosrae" 13483 msgstr "Grutte_Oseaan/Kosrae" 13484 13485 #: kdecore/TIMEZONES:1345 13486 #, kde-format 13487 msgid "Pacific/Kwajalein" 13488 msgstr "Grutte_Oseaan/Kwajalein" 13489 13490 #: kdecore/TIMEZONES:1348 13491 #, kde-format 13492 msgid "Pacific/Majuro" 13493 msgstr "Grutte_Oseaan/Majuro" 13494 13495 #. i18n: comment to the previous timezone 13496 #: kdecore/TIMEZONES:1352 13497 #, kde-format 13498 msgid "Marshall Islands (most areas)" 13499 msgstr "" 13500 13501 #: kdecore/TIMEZONES:1353 13502 #, kde-format 13503 msgid "Pacific/Marquesas" 13504 msgstr "Grutte_Oseaan/Marquesas" 13505 13506 #. i18n: comment to the previous timezone 13507 #: kdecore/TIMEZONES:1355 13508 #, kde-format 13509 msgid "Marquesas Islands" 13510 msgstr "" 13511 13512 #: kdecore/TIMEZONES:1356 13513 #, kde-format 13514 msgid "Pacific/Midway" 13515 msgstr "Grutte_Oseaan/Midway" 13516 13517 #. i18n: comment to the previous timezone 13518 #: kdecore/TIMEZONES:1358 13519 #, kde-format 13520 msgid "Midway Islands" 13521 msgstr "" 13522 13523 #: kdecore/TIMEZONES:1359 13524 #, kde-format 13525 msgid "Pacific/Nauru" 13526 msgstr "Grutte_Oseaan/Nauru" 13527 13528 #: kdecore/TIMEZONES:1360 13529 #, kde-format 13530 msgid "Pacific/Niue" 13531 msgstr "Grutte_Oseaan/Niue" 13532 13533 #: kdecore/TIMEZONES:1361 13534 #, kde-format 13535 msgid "Pacific/Norfolk" 13536 msgstr "Grutte_Oseaan/Norfolk" 13537 13538 #: kdecore/TIMEZONES:1362 13539 #, kde-format 13540 msgid "Pacific/Noumea" 13541 msgstr "Grutte_Oseaan/Noumea" 13542 13543 #: kdecore/TIMEZONES:1363 13544 #, kde-format 13545 msgid "Pacific/Pago_Pago" 13546 msgstr "Grutte_Oseaan/Pago_Pago" 13547 13548 #: kdecore/TIMEZONES:1364 13549 #, kde-format 13550 msgid "Pacific/Palau" 13551 msgstr "Grutte_Oseaan/Palau" 13552 13553 #: kdecore/TIMEZONES:1365 13554 #, kde-format 13555 msgid "Pacific/Pitcairn" 13556 msgstr "Grutte_Oseaan/Pitcairn" 13557 13558 #: kdecore/TIMEZONES:1366 13559 #, fuzzy, kde-format 13560 #| msgid "Pacific/Ponape" 13561 msgid "Pacific/Pohnpei" 13562 msgstr "Grutte_Oseaan/Ponape" 13563 13564 #. i18n: comment to the previous timezone 13565 #: kdecore/TIMEZONES:1368 13566 #, kde-format 13567 msgid "Pohnpei (Ponape)" 13568 msgstr "" 13569 13570 #. i18n: comment to the previous timezone 13571 #: kdecore/TIMEZONES:1370 13572 #, fuzzy, kde-format 13573 #| msgid "Pacific/Ponape" 13574 msgid "Pohnpei/Ponape" 13575 msgstr "Grutte_Oseaan/Ponape" 13576 13577 #: kdecore/TIMEZONES:1371 13578 #, kde-format 13579 msgid "Pacific/Ponape" 13580 msgstr "Grutte_Oseaan/Ponape" 13581 13582 #. i18n: comment to the previous timezone 13583 #: kdecore/TIMEZONES:1373 13584 #, kde-format 13585 msgid "Ponape (Pohnpei)" 13586 msgstr "" 13587 13588 #: kdecore/TIMEZONES:1374 13589 #, kde-format 13590 msgid "Pacific/Port_Moresby" 13591 msgstr "Grutte_Oseaan/Port_Moresby" 13592 13593 #. i18n: comment to the previous timezone 13594 #: kdecore/TIMEZONES:1376 13595 #, kde-format 13596 msgid "Papua New Guinea (most areas)" 13597 msgstr "" 13598 13599 #: kdecore/TIMEZONES:1377 13600 #, kde-format 13601 msgid "Pacific/Rarotonga" 13602 msgstr "Grutte_Oseaan/Rarotonga" 13603 13604 #: kdecore/TIMEZONES:1378 13605 #, kde-format 13606 msgid "Pacific/Saipan" 13607 msgstr "Grutte_Oseaan/Saipan" 13608 13609 #: kdecore/TIMEZONES:1379 13610 #, fuzzy, kde-format 13611 #| msgid "Pacific/Saipan" 13612 msgid "Pacific/Samoa" 13613 msgstr "Grutte_Oseaan/Saipan" 13614 13615 #: kdecore/TIMEZONES:1380 13616 #, kde-format 13617 msgid "Pacific/Tahiti" 13618 msgstr "Grutte_Oseaan/Tahiti" 13619 13620 #. i18n: comment to the previous timezone 13621 #: kdecore/TIMEZONES:1382 13622 #, kde-format 13623 msgid "Society Islands" 13624 msgstr "" 13625 13626 #: kdecore/TIMEZONES:1383 13627 #, kde-format 13628 msgid "Pacific/Tarawa" 13629 msgstr "Grutte_Oseaan/Tarawa" 13630 13631 #. i18n: comment to the previous timezone 13632 #: kdecore/TIMEZONES:1385 13633 #, kde-format 13634 msgid "Gilbert Islands" 13635 msgstr "" 13636 13637 #: kdecore/TIMEZONES:1386 13638 #, kde-format 13639 msgid "Pacific/Tongatapu" 13640 msgstr "Grutte_Oseaan/Tongatapu" 13641 13642 #: kdecore/TIMEZONES:1387 13643 #, kde-format 13644 msgid "Pacific/Truk" 13645 msgstr "Grutte_Oseaan/Truk" 13646 13647 #. i18n: comment to the previous timezone 13648 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13649 #, kde-format 13650 msgid "Truk (Chuuk) and Yap" 13651 msgstr "" 13652 13653 #: kdecore/TIMEZONES:1390 13654 #, kde-format 13655 msgid "Pacific/Wake" 13656 msgstr "Grutte_Oseaan/Wake" 13657 13658 #. i18n: comment to the previous timezone 13659 #: kdecore/TIMEZONES:1392 13660 #, kde-format 13661 msgid "Wake Island" 13662 msgstr "" 13663 13664 #: kdecore/TIMEZONES:1393 13665 #, kde-format 13666 msgid "Pacific/Wallis" 13667 msgstr "Grutte_Oseaan/Wallis" 13668 13669 #: kdecore/TIMEZONES:1394 13670 #, kde-format 13671 msgid "Pacific/Yap" 13672 msgstr "Grutte_Oseaan/Yap" 13673 13674 #: kdecore/TIMEZONES:1397 13675 #, kde-format 13676 msgid "Poland" 13677 msgstr "" 13678 13679 #: kdecore/TIMEZONES:1398 13680 #, kde-format 13681 msgid "Portugal" 13682 msgstr "" 13683 13684 #: kdecore/TIMEZONES:1401 13685 #, kde-format 13686 msgid "ROC" 13687 msgstr "" 13688 13689 #: kdecore/TIMEZONES:1402 13690 #, kde-format 13691 msgid "ROK" 13692 msgstr "" 13693 13694 #: kdecore/TIMEZONES:1403 13695 #, fuzzy, kde-format 13696 #| msgid "Asia/Singapore" 13697 msgid "Singapore" 13698 msgstr "Azië/Singapore" 13699 13700 #: kdecore/TIMEZONES:1404 13701 #, kde-format 13702 msgid "Turkey" 13703 msgstr "" 13704 13705 #: kdecore/TIMEZONES:1405 13706 #, kde-format 13707 msgid "US/Alaska" 13708 msgstr "" 13709 13710 #: kdecore/TIMEZONES:1408 13711 #, kde-format 13712 msgid "US/Aleutian" 13713 msgstr "" 13714 13715 #: kdecore/TIMEZONES:1411 13716 #, kde-format 13717 msgid "US/Arizona" 13718 msgstr "" 13719 13720 #: kdecore/TIMEZONES:1414 13721 #, kde-format 13722 msgid "US/Central" 13723 msgstr "" 13724 13725 #: kdecore/TIMEZONES:1417 13726 #, kde-format 13727 msgid "US/East-Indiana" 13728 msgstr "" 13729 13730 #: kdecore/TIMEZONES:1420 13731 #, kde-format 13732 msgid "US/Eastern" 13733 msgstr "" 13734 13735 #: kdecore/TIMEZONES:1423 13736 #, kde-format 13737 msgid "US/Hawaii" 13738 msgstr "" 13739 13740 #: kdecore/TIMEZONES:1426 13741 #, kde-format 13742 msgid "US/Indiana-Starke" 13743 msgstr "" 13744 13745 #: kdecore/TIMEZONES:1429 13746 #, kde-format 13747 msgid "US/Michigan" 13748 msgstr "" 13749 13750 #: kdecore/TIMEZONES:1432 13751 #, kde-format 13752 msgid "US/Mountain" 13753 msgstr "" 13754 13755 #: kdecore/TIMEZONES:1435 13756 #, fuzzy, kde-format 13757 #| msgid "Pacific/Yap" 13758 msgid "US/Pacific" 13759 msgstr "Grutte_Oseaan/Yap" 13760 13761 #: kdecore/TIMEZONES:1438 13762 #, kde-format 13763 msgid "US/Samoa" 13764 msgstr "" 13765 13766 #: kdecore/TIMEZONES:1439 13767 #, kde-format 13768 msgid "W-SU" 13769 msgstr "" 13770 13771 #. i18n: Generic sans serif font presented in font choosers. When selected, 13772 #. the system will choose a real font, mandated by distro settings. 13773 #: kdeui/fonthelpers.cpp:29 13774 #, kde-format 13775 msgctxt "@item Font name" 13776 msgid "Sans Serif" 13777 msgstr "Sans Serif" 13778 13779 #. i18n: Generic serif font presented in font choosers. When selected, 13780 #. the system will choose a real font, mandated by distro settings. 13781 #: kdeui/fonthelpers.cpp:32 13782 #, kde-format 13783 msgctxt "@item Font name" 13784 msgid "Serif" 13785 msgstr "Serif" 13786 13787 #. i18n: Generic monospace font presented in font choosers. When selected, 13788 #. the system will choose a real font, mandated by distro settings. 13789 #: kdeui/fonthelpers.cpp:35 13790 #, kde-format 13791 msgctxt "@item Font name" 13792 msgid "Monospace" 13793 msgstr "Monospace" 13794 13795 #: kdeui/k4timezonewidget.cpp:62 13796 #, kde-format 13797 msgctxt "Define an area in the time zone, like a town area" 13798 msgid "Area" 13799 msgstr "Gebiet" 13800 13801 #: kdeui/k4timezonewidget.cpp:62 13802 #, kde-format 13803 msgctxt "Time zone" 13804 msgid "Region" 13805 msgstr "Regio" 13806 13807 #: kdeui/k4timezonewidget.cpp:62 13808 #, fuzzy, kde-format 13809 msgid "Comment" 13810 msgstr "Taljochting" 13811 13812 #: kdeui/kapplication.cpp:741 13813 #, kde-format 13814 msgid "The style '%1' was not found" 13815 msgstr "De styl '%1' waard net fûn" 13816 13817 #: kdeui/kcolordialog.cpp:102 13818 #, kde-format 13819 msgctxt "palette name" 13820 msgid "* Recent Colors *" 13821 msgstr "* Nijste kleuren *" 13822 13823 #: kdeui/kcolordialog.cpp:103 13824 #, kde-format 13825 msgctxt "palette name" 13826 msgid "* Custom Colors *" 13827 msgstr "* Oanpaste kleuren *" 13828 13829 #: kdeui/kcolordialog.cpp:104 13830 #, kde-format 13831 msgctxt "palette name" 13832 msgid "Forty Colors" 13833 msgstr "Forty-kleuren" 13834 13835 #: kdeui/kcolordialog.cpp:105 13836 #, kde-format 13837 msgctxt "palette name" 13838 msgid "Oxygen Colors" 13839 msgstr "Oxygen kleuren" 13840 13841 #: kdeui/kcolordialog.cpp:106 13842 #, kde-format 13843 msgctxt "palette name" 13844 msgid "Rainbow Colors" 13845 msgstr "reinbôgekleuren" 13846 13847 #: kdeui/kcolordialog.cpp:107 13848 #, kde-format 13849 msgctxt "palette name" 13850 msgid "Royal Colors" 13851 msgstr "Keninklike kleuren" 13852 13853 #: kdeui/kcolordialog.cpp:108 13854 #, kde-format 13855 msgctxt "palette name" 13856 msgid "Web Colors" 13857 msgstr "Webkleuren" 13858 13859 #: kdeui/kcolordialog.cpp:572 13860 #, kde-format 13861 msgid "Named Colors" 13862 msgstr "Beneamde kleuren" 13863 13864 #: kdeui/kcolordialog.cpp:746 13865 #, kde-format 13866 msgctxt "" 13867 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13868 "them)" 13869 msgid "" 13870 "Unable to read X11 RGB color strings. The following file location was " 13871 "examined:\n" 13872 "%2" 13873 msgid_plural "" 13874 "Unable to read X11 RGB color strings. The following file locations were " 13875 "examined:\n" 13876 "%2" 13877 msgstr[0] "" 13878 msgstr[1] "" 13879 13880 #: kdeui/kcolordialog.cpp:997 13881 #, kde-format 13882 msgid "Select Color" 13883 msgstr "Kleur selektearje" 13884 13885 #: kdeui/kcolordialog.cpp:1077 13886 #, kde-format 13887 msgid "Hue:" 13888 msgstr "Tint:" 13889 13890 #: kdeui/kcolordialog.cpp:1083 13891 #, kde-format 13892 msgctxt "The angular degree unit (for hue)" 13893 msgid "°" 13894 msgstr "°" 13895 13896 #: kdeui/kcolordialog.cpp:1088 13897 #, fuzzy, kde-format 13898 #| msgid "Saturday" 13899 msgid "Saturation:" 13900 msgstr "sneon" 13901 13902 #: kdeui/kcolordialog.cpp:1098 13903 #, kde-format 13904 msgctxt "This is the V of HSV" 13905 msgid "Value:" 13906 msgstr "Wearde:" 13907 13908 #: kdeui/kcolordialog.cpp:1111 13909 #, kde-format 13910 msgid "Red:" 13911 msgstr "Read:" 13912 13913 #: kdeui/kcolordialog.cpp:1121 13914 #, kde-format 13915 msgid "Green:" 13916 msgstr "Grien:" 13917 13918 #: kdeui/kcolordialog.cpp:1131 13919 #, kde-format 13920 msgid "Blue:" 13921 msgstr "Blau:" 13922 13923 #: kdeui/kcolordialog.cpp:1152 13924 #, kde-format 13925 msgid "Alpha:" 13926 msgstr "Alfa:" 13927 13928 #: kdeui/kcolordialog.cpp:1206 13929 #, kde-format 13930 msgid "&Add to Custom Colors" 13931 msgstr "Oan &eigen kleuren taheakje" 13932 13933 #: kdeui/kcolordialog.cpp:1234 13934 #, kde-format 13935 msgid "Name:" 13936 msgstr "Namme:" 13937 13938 #: kdeui/kcolordialog.cpp:1241 13939 #, kde-format 13940 msgid "HTML:" 13941 msgstr "HTML:" 13942 13943 #: kdeui/kcolordialog.cpp:1328 13944 #, kde-format 13945 msgid "Default color" 13946 msgstr "Standertkleur" 13947 13948 #: kdeui/kcolordialog.cpp:1393 13949 #, kde-format 13950 msgid "-default-" 13951 msgstr "-standert-" 13952 13953 #: kdeui/kcolordialog.cpp:1668 13954 #, kde-format 13955 msgid "-unnamed-" 13956 msgstr "-nammeleas-" 13957 13958 #: kdeui/kdeprintdialog.cpp:40 13959 #, kde-format 13960 msgctxt "@title:window" 13961 msgid "Print" 13962 msgstr "Printsje" 13963 13964 #: kdeui/kdialog.cpp:271 13965 #, kde-format 13966 msgid "&Try" 13967 msgstr "&Besykje" 13968 13969 #: kdeui/kdialog.cpp:484 13970 #, kde-format 13971 msgid "modified" 13972 msgstr "feroare" 13973 13974 #: kdeui/kdialog.cpp:495 13975 #, kde-format 13976 msgctxt "Document/application separator in titlebar" 13977 msgid " – " 13978 msgstr " – " 13979 13980 #: kdeui/kdialog.cpp:896 13981 #, kde-format 13982 msgid "&Details" 13983 msgstr "&Details" 13984 13985 #: kdeui/kdialog.cpp:1054 13986 #, kde-format 13987 msgid "Get help..." 13988 msgstr "Help sykje" 13989 13990 #: kdeui/keditlistbox.cpp:324 13991 #, kde-format 13992 msgid "&Add" 13993 msgstr "&Taheakje" 13994 13995 #: kdeui/keditlistbox.cpp:336 13996 #, kde-format 13997 msgid "&Remove" 13998 msgstr "&Fuortsmite" 13999 14000 #: kdeui/keditlistbox.cpp:348 14001 #, kde-format 14002 msgid "Move &Up" 14003 msgstr "Omheech &ferpleatse" 14004 14005 #: kdeui/keditlistbox.cpp:353 14006 #, kde-format 14007 msgid "Move &Down" 14008 msgstr "Omleech fe&rpleatse" 14009 14010 #. i18n: A shorter version of the alphabet test phrase translated in 14011 #. another message. It is displayed in the dropdown list of font previews 14012 #. (the font selection combo box), so keep it under the length equivalent 14013 #. to 60 or so proportional Latin characters. 14014 #: kdeui/kfontcombobox.cpp:48 14015 #, kde-format 14016 msgctxt "short" 14017 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 14018 msgstr "Alve Bazige Froulju Wachtsje Op Dyn Komst" 14019 14020 #. i18n: Integer which indicates the script you used in the sample text 14021 #. for font previews in your language. For the possible values, see 14022 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 14023 #. If the sample text contains several scripts, their IDs can be given 14024 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 14025 #: kdeui/kfontcombobox.cpp:119 14026 #, kde-format 14027 msgctxt "Numeric IDs of scripts for font previews" 14028 msgid "1" 14029 msgstr "1" 14030 14031 #: kdeui/kfontdialog.cpp:51 14032 #, kde-format 14033 msgid "Select Font" 14034 msgstr "Lettertype selektearje" 14035 14036 #: kdeui/kprintpreview.cpp:118 14037 #, kde-format 14038 msgid "Could not load print preview part" 14039 msgstr "Koe printalyk part net lade" 14040 14041 #: kdeui/kprintpreview.cpp:135 14042 #, kde-format 14043 msgid "Print Preview" 14044 msgstr "Printalyk" 14045 14046 #: kdeui/ksystemtrayicon.cpp:153 14047 #, kde-format 14048 msgid "Minimize" 14049 msgstr "Minimalisearje" 14050 14051 #: kdeui/ksystemtrayicon.cpp:205 14052 #, kde-format 14053 msgid "&Minimize" 14054 msgstr "&Minimalisearje" 14055 14056 #: kdeui/ksystemtrayicon.cpp:207 14057 #, kde-format 14058 msgid "&Restore" 14059 msgstr "He&rstelle" 14060 14061 #: kdeui/ksystemtrayicon.cpp:226 14062 #, kde-format 14063 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 14064 msgstr "<qt>Wolle jo grif <b>%1</b> beëinigje?</qt>" 14065 14066 #: kdeui/ksystemtrayicon.cpp:229 14067 #, kde-format 14068 msgid "Confirm Quit From System Tray" 14069 msgstr "Ofslúte fanút systeemfak befêstigje" 14070 14071 #: kdeui/kundostack.cpp:47 14072 #, kde-format 14073 msgid "Redo" 14074 msgstr "Op 'e nij dwaan" 14075 14076 #: kdeui/kundostack.cpp:66 14077 #, kde-format 14078 msgid "Undo" 14079 msgstr "Ungedien meitsje" 14080 14081 #: kdeui/kuniqueapplication.cpp:79 14082 #, kde-format 14083 msgid "Do not run in the background." 14084 msgstr "Net yn de eftergrûn rinne." 14085 14086 #: kdeui/kuniqueapplication.cpp:81 14087 #, kde-format 14088 msgid "Internally added if launched from Finder" 14089 msgstr "Yntern taheake as úteinsetten mei Finder" 14090 14091 #: kio/kcommentwidget.cpp:68 14092 #, fuzzy, kde-format 14093 #| msgid "Add Entry..." 14094 msgctxt "@label" 14095 msgid "Add Comment..." 14096 msgstr "Item taheakje..." 14097 14098 #: kio/kcommentwidget.cpp:74 14099 #, kde-format 14100 msgctxt "@label" 14101 msgid "Change..." 14102 msgstr "Feroarje..." 14103 14104 #: kio/kcommentwidget.cpp:128 14105 #, fuzzy, kde-format 14106 #| msgid "Comment" 14107 msgctxt "@title:window" 14108 msgid "Change Comment" 14109 msgstr "Taljochting" 14110 14111 #: kio/kcommentwidget.cpp:129 14112 #, fuzzy, kde-format 14113 #| msgid "Comment" 14114 msgctxt "@title:window" 14115 msgid "Add Comment" 14116 msgstr "Taljochting" 14117 14118 #: kio/kdevicelistmodel.cpp:115 14119 #, fuzzy, kde-format 14120 #| msgid "Devices" 14121 msgid "Device name" 14122 msgstr "Algemiene namme" 14123 14124 #: kio/kdirselectdialog.cpp:136 14125 #, fuzzy, kde-format 14126 #| msgid "New Folder" 14127 msgctxt "folder name" 14128 msgid "New Folder" 14129 msgstr "Nije map" 14130 14131 #: kio/kdirselectdialog.cpp:141 14132 #, fuzzy, kde-format 14133 #| msgid "New Folder" 14134 msgctxt "@title:window" 14135 msgid "New Folder" 14136 msgstr "Nije map" 14137 14138 #: kio/kdirselectdialog.cpp:142 14139 #, fuzzy, kde-format 14140 #| msgid "" 14141 #| "Create new folder in:\n" 14142 #| "%1" 14143 msgctxt "@label:textbox" 14144 msgid "" 14145 "Create new folder in:\n" 14146 "%1" 14147 msgstr "" 14148 "Nije map meitsje yn:\n" 14149 "%1" 14150 14151 #: kio/kdirselectdialog.cpp:172 14152 #, kde-format 14153 msgid "A file or folder named %1 already exists." 14154 msgstr "In triem of map mei de namme %1 bestiet al." 14155 14156 #: kio/kdirselectdialog.cpp:175 14157 #, kde-format 14158 msgid "You do not have permission to create that folder." 14159 msgstr "Jo hawwe net de nedige rjochten om dy map oan te meitsjen." 14160 14161 #: kio/kdirselectdialog.cpp:290 14162 #, fuzzy, kde-format 14163 #| msgid "Select Folder" 14164 msgctxt "@title:window" 14165 msgid "Select Folder" 14166 msgstr "Map foar skenplugin selektearje" 14167 14168 #: kio/kdirselectdialog.cpp:299 14169 #, fuzzy, kde-format 14170 #| msgid "New Folder..." 14171 msgctxt "@action:button" 14172 msgid "New Folder..." 14173 msgstr "Nije map..." 14174 14175 #: kio/kdirselectdialog.cpp:345 14176 #, fuzzy, kde-format 14177 #| msgid "New Folder..." 14178 msgctxt "@action:inmenu" 14179 msgid "New Folder..." 14180 msgstr "Nije map..." 14181 14182 #: kio/kdirselectdialog.cpp:352 14183 #, fuzzy, kde-format 14184 #| msgid "Move to Trash" 14185 msgctxt "@action:inmenu" 14186 msgid "Move to Trash" 14187 msgstr "Nei it Jiskefet" 14188 14189 #: kio/kdirselectdialog.cpp:359 14190 #, fuzzy, kde-format 14191 #| msgid "Deleting" 14192 msgctxt "@action:inmenu" 14193 msgid "Delete" 14194 msgstr "Delete" 14195 14196 #: kio/kdirselectdialog.cpp:368 14197 #, fuzzy, kde-format 14198 #| msgid "Show Hidden Folders" 14199 msgctxt "@option:check" 14200 msgid "Show Hidden Folders" 14201 msgstr "Lit ferside mappen sjen" 14202 14203 #: kio/kdirselectdialog.cpp:375 14204 #, fuzzy, kde-format 14205 #| msgid "Properties for %1" 14206 msgctxt "@action:inmenu" 14207 msgid "Properties" 14208 msgstr "Eigenskippen" 14209 14210 #: kio/kfiledialog.cpp:132 14211 #, kde-format 14212 msgid "*|All files" 14213 msgstr "*|Alle triemen" 14214 14215 #: kio/kfiledialog.cpp:332 14216 #, kde-format 14217 msgid "All Supported Files" 14218 msgstr "Alle stipe triemen" 14219 14220 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 14221 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 14222 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 14223 #, kde-format 14224 msgid "Open" 14225 msgstr "Iepenje" 14226 14227 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 14228 #: kio/kfiledialog.cpp:838 14229 #, kde-format 14230 msgid "Save As" 14231 msgstr "Bewarje as" 14232 14233 #: kio/kfilemetadataprovider.cpp:245 14234 #, kde-format 14235 msgctxt "@item:intable" 14236 msgid "%1 item" 14237 msgid_plural "%1 items" 14238 msgstr[0] "" 14239 msgstr[1] "" 14240 14241 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 14242 #, fuzzy, kde-format 14243 msgctxt "@label" 14244 msgid "Comment" 14245 msgstr "Taljochting" 14246 14247 #: kio/kfilemetadataprovider.cpp:447 14248 #, fuzzy, kde-format 14249 #| msgid "Modified:" 14250 msgctxt "@label" 14251 msgid "Modified" 14252 msgstr "Wizige:" 14253 14254 #: kio/kfilemetadataprovider.cpp:448 14255 #, fuzzy, kde-format 14256 #| msgid "Owner" 14257 msgctxt "@label" 14258 msgid "Owner" 14259 msgstr "Eigner" 14260 14261 #: kio/kfilemetadataprovider.cpp:449 14262 #, fuzzy, kde-format 14263 #| msgctxt "@title:column" 14264 #| msgid "Permissions" 14265 msgctxt "@label" 14266 msgid "Permissions" 14267 msgstr "Tagongsrjochten" 14268 14269 #: kio/kfilemetadataprovider.cpp:450 14270 #, fuzzy, kde-format 14271 #| msgid "Sorting" 14272 msgctxt "@label" 14273 msgid "Rating" 14274 msgstr "Sortearje " 14275 14276 #: kio/kfilemetadataprovider.cpp:451 14277 #, fuzzy, kde-format 14278 #| msgctxt "@title:column" 14279 #| msgid "Size" 14280 msgctxt "@label" 14281 msgid "Size" 14282 msgstr "Grutte" 14283 14284 #: kio/kfilemetadataprovider.cpp:452 14285 #, fuzzy, kde-format 14286 #| msgctxt "to trash" 14287 #| msgid "&Trash" 14288 msgctxt "@label" 14289 msgid "Tags" 14290 msgstr "Jiskefet" 14291 14292 #: kio/kfilemetadataprovider.cpp:453 14293 #, fuzzy, kde-format 14294 #| msgid "Size:" 14295 msgctxt "@label" 14296 msgid "Total Size" 14297 msgstr "Grutte:" 14298 14299 #: kio/kfilemetadataprovider.cpp:454 14300 #, fuzzy, kde-format 14301 #| msgid "Type" 14302 msgctxt "@label" 14303 msgid "Type" 14304 msgstr "Type" 14305 14306 #: kio/kfilemetadatareaderprocess.cpp:234 14307 #, kde-format 14308 msgid "KFileMetaDataReader" 14309 msgstr "" 14310 14311 #: kio/kfilemetadatareaderprocess.cpp:236 14312 #, kde-format 14313 msgid "KFileMetaDataReader can be used to read metadata from a file" 14314 msgstr "" 14315 14316 #: kio/kfilemetadatareaderprocess.cpp:238 14317 #, kde-format 14318 msgid "(C) 2011, Peter Penz" 14319 msgstr "" 14320 14321 #: kio/kfilemetadatareaderprocess.cpp:239 14322 #, kde-format 14323 msgid "Peter Penz" 14324 msgstr "" 14325 14326 #: kio/kfilemetadatareaderprocess.cpp:239 14327 #, kde-format 14328 msgid "Current maintainer" 14329 msgstr "" 14330 14331 #: kio/kfilemetadatareaderprocess.cpp:244 14332 #, kde-format 14333 msgid "Only the meta data that is part of the file is read" 14334 msgstr "" 14335 14336 #: kio/kfilemetadatareaderprocess.cpp:245 14337 #, kde-format 14338 msgid "List of URLs where the meta-data should be read from" 14339 msgstr "" 14340 14341 #: kio/kfilemetainfowidget.cpp:161 14342 #, kde-format 14343 msgid "<Error>" 14344 msgstr "<Flater>" 14345 14346 #: kio/kfiletreeview.cpp:192 14347 #, fuzzy, kde-format 14348 #| msgid "Show Hidden Folders" 14349 msgid "Show Hidden Folders" 14350 msgstr "Lit ferside mappen sjen" 14351 14352 #: kio/kimageio.cpp:46 14353 #, kde-format 14354 msgid "All Pictures" 14355 msgstr "Alle ôfbyldings" 14356 14357 #: kio/kmetaprops.cpp:57 14358 #, kde-format 14359 msgctxt "@title:window" 14360 msgid "Configure Shown Data" 14361 msgstr "" 14362 14363 #: kio/kmetaprops.cpp:60 14364 #, kde-format 14365 msgctxt "@label::textbox" 14366 msgid "Select which data should be shown:" 14367 msgstr "" 14368 14369 #: kio/kmetaprops.cpp:123 14370 #, fuzzy, kde-format 14371 #| msgid "Calculating..." 14372 msgctxt "@action:button" 14373 msgid "Configure..." 14374 msgstr "Dwaande mei berekkenjen..." 14375 14376 #: kio/kmetaprops.cpp:133 14377 #, fuzzy, kde-format 14378 #| msgid "KDE SSL Information" 14379 msgctxt "@title:tab" 14380 msgid "Information" 14381 msgstr "Ynformaasje" 14382 14383 #: kio/knfotranslator.cpp:40 14384 #, fuzzy, kde-format 14385 #| msgid "Created:" 14386 msgctxt "@label creation date" 14387 msgid "Created" 14388 msgstr "Oanmakke:" 14389 14390 #: kio/knfotranslator.cpp:41 14391 #, fuzzy, kde-format 14392 #| msgctxt "@title:column" 14393 #| msgid "Size" 14394 msgctxt "@label file content size" 14395 msgid "Size" 14396 msgstr "Grutte" 14397 14398 #: kio/knfotranslator.cpp:42 14399 #, kde-format 14400 msgctxt "@label file depends from" 14401 msgid "Depends" 14402 msgstr "" 14403 14404 # i18n: file ./kfile/kpropertiesmimetypebase.ui line 47 14405 #: kio/knfotranslator.cpp:43 14406 #, fuzzy, kde-format 14407 #| msgid "Description" 14408 msgctxt "@label" 14409 msgid "Description" 14410 msgstr "Beskriuwing" 14411 14412 #: kio/knfotranslator.cpp:44 14413 #, fuzzy, kde-format 14414 #| msgctxt "@title:tab File properties" 14415 #| msgid "&General" 14416 msgctxt "@label Software used to generate content" 14417 msgid "Generator" 14418 msgstr "&Algemien" 14419 14420 #: kio/knfotranslator.cpp:45 14421 #, kde-format 14422 msgctxt "" 14423 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14424 msgid "Has Part" 14425 msgstr "" 14426 14427 #: kio/knfotranslator.cpp:46 14428 #, kde-format 14429 msgctxt "" 14430 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14431 "nie#hasLogicalPart" 14432 msgid "Has Logical Part" 14433 msgstr "" 14434 14435 #: kio/knfotranslator.cpp:47 14436 #, fuzzy, kde-format 14437 #| msgid "Parent Folder" 14438 msgctxt "@label parent directory" 14439 msgid "Part of" 14440 msgstr "Haadmap" 14441 14442 #: kio/knfotranslator.cpp:48 14443 #, kde-format 14444 msgctxt "@label" 14445 msgid "Keyword" 14446 msgstr "" 14447 14448 #: kio/knfotranslator.cpp:49 14449 #, fuzzy, kde-format 14450 #| msgid "Modified:" 14451 msgctxt "@label modified date of file" 14452 msgid "Modified" 14453 msgstr "Wizige:" 14454 14455 #: kio/knfotranslator.cpp:50 14456 #, fuzzy, kde-format 14457 #| msgid "Mime Type" 14458 msgctxt "@label" 14459 msgid "MIME Type" 14460 msgstr "Mime triemtype" 14461 14462 #: kio/knfotranslator.cpp:51 14463 #, fuzzy, kde-format 14464 #| msgid "Contents:" 14465 msgctxt "@label" 14466 msgid "Content" 14467 msgstr "Ynhâld:" 14468 14469 #: kio/knfotranslator.cpp:52 14470 #, fuzzy, kde-format 14471 #| msgid "created on %1" 14472 msgctxt "@label" 14473 msgid "Related To" 14474 msgstr "oanmakke op %1" 14475 14476 #: kio/knfotranslator.cpp:53 14477 #, fuzzy, kde-format 14478 #| msgctxt "The receiver of the SSL certificate" 14479 #| msgid "Subject" 14480 msgctxt "@label" 14481 msgid "Subject" 14482 msgstr "Underwerp" 14483 14484 #: kio/knfotranslator.cpp:54 14485 #, fuzzy, kde-format 14486 #| msgid "File" 14487 msgctxt "@label music title" 14488 msgid "Title" 14489 msgstr "Triem" 14490 14491 #: kio/knfotranslator.cpp:55 14492 #, kde-format 14493 msgctxt "@label file URL" 14494 msgid "File Location" 14495 msgstr "" 14496 14497 #: kio/knfotranslator.cpp:56 14498 #, fuzzy, kde-format 14499 #| msgid "Created:" 14500 msgctxt "@label" 14501 msgid "Creator" 14502 msgstr "Oanmakke:" 14503 14504 #: kio/knfotranslator.cpp:57 14505 #, kde-format 14506 msgctxt "@label" 14507 msgid "Average Bitrate" 14508 msgstr "" 14509 14510 #: kio/knfotranslator.cpp:58 14511 #, kde-format 14512 msgctxt "@label" 14513 msgid "Channels" 14514 msgstr "" 14515 14516 #: kio/knfotranslator.cpp:59 14517 #, fuzzy, kde-format 14518 #| msgid "Categories" 14519 msgctxt "@label number of characters" 14520 msgid "Characters" 14521 msgstr "Kategoriën" 14522 14523 #: kio/knfotranslator.cpp:60 14524 #, fuzzy, kde-format 14525 #| msgid "C&onnect" 14526 msgctxt "@label" 14527 msgid "Codec" 14528 msgstr "F&erbine" 14529 14530 #: kio/knfotranslator.cpp:61 14531 #, kde-format 14532 msgctxt "@label" 14533 msgid "Color Depth" 14534 msgstr "" 14535 14536 #: kio/knfotranslator.cpp:62 14537 #, fuzzy, kde-format 14538 #| msgctxt "The destination of a file operation" 14539 #| msgid "Destination" 14540 msgctxt "@label" 14541 msgid "Duration" 14542 msgstr "Bestimming" 14543 14544 #: kio/knfotranslator.cpp:63 14545 #, fuzzy, kde-format 14546 #| msgid "Devices" 14547 msgctxt "@label" 14548 msgid "Filename" 14549 msgstr "Algemiene namme" 14550 14551 #: kio/knfotranslator.cpp:64 14552 #, kde-format 14553 msgctxt "@label" 14554 msgid "Hash" 14555 msgstr "" 14556 14557 #: kio/knfotranslator.cpp:65 14558 #, kde-format 14559 msgctxt "@label" 14560 msgid "Height" 14561 msgstr "" 14562 14563 #: kio/knfotranslator.cpp:66 14564 #, kde-format 14565 msgctxt "@label" 14566 msgid "Interlace Mode" 14567 msgstr "" 14568 14569 #: kio/knfotranslator.cpp:67 14570 #, fuzzy, kde-format 14571 #| msgid "Link" 14572 msgctxt "@label number of lines" 14573 msgid "Lines" 14574 msgstr "Keppeling" 14575 14576 #: kio/knfotranslator.cpp:68 14577 #, kde-format 14578 msgctxt "@label" 14579 msgid "Programming Language" 14580 msgstr "" 14581 14582 #: kio/knfotranslator.cpp:69 14583 #, kde-format 14584 msgctxt "@label" 14585 msgid "Sample Rate" 14586 msgstr "" 14587 14588 #: kio/knfotranslator.cpp:70 14589 #, fuzzy, kde-format 14590 #| msgid "Write" 14591 msgctxt "@label" 14592 msgid "Width" 14593 msgstr "Skriuw" 14594 14595 #: kio/knfotranslator.cpp:71 14596 #, kde-format 14597 msgctxt "@label number of words" 14598 msgid "Words" 14599 msgstr "" 14600 14601 #: kio/knfotranslator.cpp:72 14602 #, kde-format 14603 msgctxt "@label EXIF aperture value" 14604 msgid "Aperture" 14605 msgstr "" 14606 14607 #: kio/knfotranslator.cpp:73 14608 #, kde-format 14609 msgctxt "@label EXIF" 14610 msgid "Exposure Bias Value" 14611 msgstr "" 14612 14613 #: kio/knfotranslator.cpp:74 14614 #, fuzzy, kde-format 14615 #| msgid "Exposure:" 14616 msgctxt "@label EXIF" 14617 msgid "Exposure Time" 14618 msgstr "Bleatstelling:" 14619 14620 #: kio/knfotranslator.cpp:75 14621 #, fuzzy, kde-format 14622 #| msgid "Class" 14623 msgctxt "@label EXIF" 14624 msgid "Flash" 14625 msgstr "Klasse" 14626 14627 #: kio/knfotranslator.cpp:76 14628 #, kde-format 14629 msgctxt "@label EXIF" 14630 msgid "Focal Length" 14631 msgstr "" 14632 14633 #: kio/knfotranslator.cpp:77 14634 #, kde-format 14635 msgctxt "@label EXIF" 14636 msgid "Focal Length 35 mm" 14637 msgstr "" 14638 14639 #: kio/knfotranslator.cpp:78 14640 #, kde-format 14641 msgctxt "@label EXIF" 14642 msgid "ISO Speed Ratings" 14643 msgstr "" 14644 14645 #: kio/knfotranslator.cpp:79 14646 #, fuzzy, kde-format 14647 #| msgid "Mask" 14648 msgctxt "@label EXIF" 14649 msgid "Make" 14650 msgstr "Masker" 14651 14652 #: kio/knfotranslator.cpp:80 14653 #, kde-format 14654 msgctxt "@label EXIF" 14655 msgid "Metering Mode" 14656 msgstr "" 14657 14658 #: kio/knfotranslator.cpp:81 14659 #, kde-format 14660 msgctxt "@label EXIF" 14661 msgid "Model" 14662 msgstr "" 14663 14664 #: kio/knfotranslator.cpp:82 14665 #, fuzzy, kde-format 14666 #| msgid "Organization:" 14667 msgctxt "@label EXIF" 14668 msgid "Orientation" 14669 msgstr "Organisaasje:" 14670 14671 #: kio/knfotranslator.cpp:83 14672 #, kde-format 14673 msgctxt "@label EXIF" 14674 msgid "White Balance" 14675 msgstr "" 14676 14677 #: kio/knfotranslator.cpp:84 14678 #, fuzzy, kde-format 14679 #| msgid "Directory" 14680 msgctxt "@label video director" 14681 msgid "Director" 14682 msgstr "Triemtafel" 14683 14684 #: kio/knfotranslator.cpp:85 14685 #, fuzzy, kde-format 14686 #| msgctxt "@title:tab File properties" 14687 #| msgid "&General" 14688 msgctxt "@label music genre" 14689 msgid "Genre" 14690 msgstr "&Algemien" 14691 14692 #: kio/knfotranslator.cpp:86 14693 #, kde-format 14694 msgctxt "@label music album" 14695 msgid "Album" 14696 msgstr "" 14697 14698 #: kio/knfotranslator.cpp:87 14699 #, kde-format 14700 msgctxt "@label" 14701 msgid "Performer" 14702 msgstr "" 14703 14704 #: kio/knfotranslator.cpp:88 14705 #, fuzzy, kde-format 14706 #| msgid "&Remove Entry" 14707 msgctxt "@label" 14708 msgid "Release Date" 14709 msgstr "Utjefte:" 14710 14711 #: kio/knfotranslator.cpp:89 14712 #, kde-format 14713 msgctxt "@label music track number" 14714 msgid "Track" 14715 msgstr "" 14716 14717 #: kio/knfotranslator.cpp:90 14718 #, fuzzy, kde-format 14719 #| msgid "URL Resource Invalid" 14720 msgctxt "@label resource created time" 14721 msgid "Resource Created" 14722 msgstr "URL-adres fan boarne is net jildich" 14723 14724 #: kio/knfotranslator.cpp:91 14725 #, fuzzy, kde-format 14726 #| msgctxt "The source of a file operation" 14727 #| msgid "Source" 14728 msgctxt "@label" 14729 msgid "Sub Resource" 14730 msgstr "Boarne" 14731 14732 #: kio/knfotranslator.cpp:92 14733 #, fuzzy, kde-format 14734 #| msgid "Modified:" 14735 msgctxt "@label resource last modified" 14736 msgid "Resource Modified" 14737 msgstr "Wizige:" 14738 14739 #: kio/knfotranslator.cpp:93 14740 #, fuzzy, kde-format 14741 #| msgid "Sorting" 14742 msgctxt "@label" 14743 msgid "Numeric Rating" 14744 msgstr "Sortearje " 14745 14746 #: kio/knfotranslator.cpp:94 14747 #, kde-format 14748 msgctxt "@label" 14749 msgid "Copied From" 14750 msgstr "" 14751 14752 #: kio/knfotranslator.cpp:95 14753 #, kde-format 14754 msgctxt "@label" 14755 msgid "First Usage" 14756 msgstr "" 14757 14758 #: kio/knfotranslator.cpp:96 14759 #, kde-format 14760 msgctxt "@label" 14761 msgid "Last Usage" 14762 msgstr "" 14763 14764 #: kio/knfotranslator.cpp:97 14765 #, fuzzy, kde-format 14766 #| msgid "Comment" 14767 msgctxt "@label" 14768 msgid "Usage Count" 14769 msgstr "Taljochting" 14770 14771 #: kio/knfotranslator.cpp:98 14772 #, kde-format 14773 msgctxt "@label" 14774 msgid "Unix File Group" 14775 msgstr "" 14776 14777 #: kio/knfotranslator.cpp:99 14778 #, kde-format 14779 msgctxt "@label" 14780 msgid "Unix File Mode" 14781 msgstr "" 14782 14783 #: kio/knfotranslator.cpp:100 14784 #, fuzzy, kde-format 14785 #| msgid "Open file dialog" 14786 msgctxt "@label" 14787 msgid "Unix File Owner" 14788 msgstr "Triem-iepenje-dialooch" 14789 14790 #: kio/knfotranslator.cpp:101 14791 #, fuzzy, kde-format 14792 #| msgid "Type" 14793 msgctxt "@label file type" 14794 msgid "Type" 14795 msgstr "Type" 14796 14797 #: kio/knfotranslator.cpp:102 14798 #, kde-format 14799 msgctxt "@label Number of fuzzy translations" 14800 msgid "Fuzzy Translations" 14801 msgstr "" 14802 14803 #: kio/knfotranslator.cpp:103 14804 #, kde-format 14805 msgctxt "@label Name of last translator" 14806 msgid "Last Translator" 14807 msgstr "" 14808 14809 #: kio/knfotranslator.cpp:104 14810 #, kde-format 14811 msgctxt "@label Number of obsolete translations" 14812 msgid "Obsolete Translations" 14813 msgstr "" 14814 14815 #: kio/knfotranslator.cpp:105 14816 #, kde-format 14817 msgctxt "@label" 14818 msgid "Translation Source Date" 14819 msgstr "" 14820 14821 #: kio/knfotranslator.cpp:106 14822 #, kde-format 14823 msgctxt "@label Number of total translations" 14824 msgid "Total Translations" 14825 msgstr "" 14826 14827 #: kio/knfotranslator.cpp:107 14828 #, fuzzy, kde-format 14829 #| msgid "Created:" 14830 msgctxt "@label Number of translated strings" 14831 msgid "Translated" 14832 msgstr "Oanmakke:" 14833 14834 #: kio/knfotranslator.cpp:108 14835 #, kde-format 14836 msgctxt "@label" 14837 msgid "Translation Date" 14838 msgstr "" 14839 14840 #: kio/knfotranslator.cpp:109 14841 #, kde-format 14842 msgctxt "@label Number of untranslated strings" 14843 msgid "Untranslated" 14844 msgstr "" 14845 14846 #: kio/kpreviewprops.cpp:51 14847 #, kde-format 14848 msgid "P&review" 14849 msgstr "Foa&rbyld" 14850 14851 #: kio/kscan.cpp:49 14852 #, kde-format 14853 msgid "Acquire Image" 14854 msgstr "Ofbylding oernimme" 14855 14856 #: kio/kscan.cpp:97 14857 #, kde-format 14858 msgid "OCR Image" 14859 msgstr "OCR-ôfbylding" 14860 14861 #: kio/netaccess.cpp:102 14862 #, kde-format 14863 msgid "File '%1' is not readable" 14864 msgstr "Triem '%1' is net te lêzen" 14865 14866 #: kio/netaccess.cpp:435 14867 #, kde-format 14868 msgid "ERROR: Unknown protocol '%1'" 14869 msgstr "FLATER: Unbekend protokol '%1'" 14870 14871 #: kio/passworddialog.cpp:56 14872 #, kde-format 14873 msgid "Authorization Dialog" 14874 msgstr "Autorisaasje" 14875 14876 #: kioslave/metainfo/metainfo.cpp:98 14877 #, kde-format 14878 msgid "No metainfo for %1" 14879 msgstr "Gjin meta-ynfo foar %1" 14880 14881 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14882 #: kssl/kcm/cacertificates.ui:24 14883 #, fuzzy, kde-format 14884 #| msgid "Organization:" 14885 msgid "Organization / Common Name" 14886 msgstr "Organisaasje:" 14887 14888 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14889 #: kssl/kcm/cacertificates.ui:29 14890 #, fuzzy, kde-format 14891 #| msgid "Organizational unit:" 14892 msgid "Organizational Unit" 14893 msgstr "Organisaasjeûnderdiel:" 14894 14895 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14896 #: kssl/kcm/cacertificates.ui:42 14897 #, kde-format 14898 msgid "Display..." 14899 msgstr "" 14900 14901 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14902 #: kssl/kcm/cacertificates.ui:68 14903 #, fuzzy, kde-format 14904 #| msgid "disable XIM" 14905 msgid "Disable" 14906 msgstr "XIM útskeakelje" 14907 14908 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14909 #: kssl/kcm/cacertificates.ui:78 14910 #, fuzzy, kde-format 14911 #| msgid "Emblems" 14912 msgid "Enable" 14913 msgstr "Emblems" 14914 14915 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14916 #: kssl/kcm/cacertificates.ui:104 14917 #, kde-format 14918 msgid "Remove" 14919 msgstr "Fuortsmite" 14920 14921 #. i18n: ectx: property (text), widget (QPushButton, add) 14922 #: kssl/kcm/cacertificates.ui:111 14923 #, kde-format 14924 msgid "Add..." 14925 msgstr "Taheakje..." 14926 14927 #: kssl/kcm/cacertificatespage.cpp:140 14928 #, fuzzy, kde-format 14929 #| msgid "Send certificate" 14930 msgid "System certificates" 14931 msgstr "Sertifikaat ferstjoere" 14932 14933 #: kssl/kcm/cacertificatespage.cpp:147 14934 #, fuzzy, kde-format 14935 #| msgid "Send certificate" 14936 msgid "User-added certificates" 14937 msgstr "Sertifikaat ferstjoere" 14938 14939 #: kssl/kcm/cacertificatespage.cpp:302 14940 #, fuzzy, kde-format 14941 #| msgid "Certificate" 14942 msgid "Pick Certificates" 14943 msgstr "Sertifikaat" 14944 14945 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14946 #: kssl/kcm/displaycert.ui:23 14947 #, fuzzy, kde-format 14948 #| msgid "Security Information" 14949 msgid "<b>Subject Information</b>" 14950 msgstr "Befeiligingsynformaasje" 14951 14952 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14953 #: kssl/kcm/displaycert.ui:39 14954 #, fuzzy, kde-format 14955 #| msgid " <b>[Cross Domain!]</b>" 14956 msgid "<b>Issuer Information</b>" 14957 msgstr "Domein [Groep]" 14958 14959 #. i18n: ectx: property (text), widget (QLabel, label) 14960 #: kssl/kcm/displaycert.ui:55 14961 #, fuzzy, kde-format 14962 #| msgid "<b>%1</b>" 14963 msgid "<b>Other</b>" 14964 msgstr "<b>%1</b>" 14965 14966 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14967 #: kssl/kcm/displaycert.ui:64 14968 #, fuzzy, kde-format 14969 #| msgid "Valid from:" 14970 msgid "Validity period" 14971 msgstr "Kontrolearje it dokumint foar jildichheid" 14972 14973 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14974 #: kssl/kcm/displaycert.ui:78 14975 #, fuzzy, kde-format 14976 #| msgid "Serial number:" 14977 msgid "Serial number" 14978 msgstr "Sifersymboalen" 14979 14980 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14981 #: kssl/kcm/displaycert.ui:92 14982 #, fuzzy, kde-format 14983 #| msgid "MD5 digest:" 14984 msgid "MD5 digest" 14985 msgstr "MD5 oersjoch:" 14986 14987 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14988 #: kssl/kcm/displaycert.ui:106 14989 #, fuzzy, kde-format 14990 #| msgid "MD5 digest:" 14991 msgid "SHA1 digest" 14992 msgstr "MD5 oersjoch:" 14993 14994 #: kssl/kcm/displaycertdialog.cpp:73 14995 #, fuzzy, kde-format 14996 #| msgctxt "folders, files" 14997 #| msgid "%1, %2" 14998 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14999 msgid "%1 to %2" 15000 msgstr "%1, %2" 15001 15002 #: kssl/kcm/kcmssl.cpp:37 15003 #, fuzzy, kde-format 15004 #| msgid "Reload configuration file" 15005 msgid "SSL Configuration Module" 15006 msgstr "Konfiguraasjetriem op 'e nij lade" 15007 15008 #: kssl/kcm/kcmssl.cpp:39 15009 #, kde-format 15010 msgid "Copyright 2010 Andreas Hartmetz" 15011 msgstr "" 15012 15013 #: kssl/kcm/kcmssl.cpp:40 15014 #, kde-format 15015 msgid "Andreas Hartmetz" 15016 msgstr "" 15017 15018 #: kssl/kcm/kcmssl.cpp:52 15019 #, fuzzy, kde-format 15020 #| msgid "Link" 15021 msgid "SSL Signers" 15022 msgstr "Keppeling" 15023 15024 #: kssl/ksslcertificate.cpp:202 15025 #, kde-format 15026 msgid "Signature Algorithm: " 15027 msgstr "Hantekeningalgoritme: " 15028 15029 #: kssl/ksslcertificate.cpp:203 15030 #, kde-format 15031 msgid "Unknown" 15032 msgstr "Unbekend" 15033 15034 #: kssl/ksslcertificate.cpp:206 15035 #, kde-format 15036 msgid "Signature Contents:" 15037 msgstr "Hantekeningynhâld:" 15038 15039 #: kssl/ksslcertificate.cpp:341 15040 #, kde-format 15041 msgctxt "Unknown" 15042 msgid "Unknown key algorithm" 15043 msgstr "Unbekend kaaialgoritme" 15044 15045 #: kssl/ksslcertificate.cpp:347 15046 #, kde-format 15047 msgid "Key type: RSA (%1 bit)" 15048 msgstr "Kaaitype: RSA (%1 bit)" 15049 15050 #: kssl/ksslcertificate.cpp:349 15051 #, kde-format 15052 msgid "Modulus: " 15053 msgstr "Modulus: " 15054 15055 #: kssl/ksslcertificate.cpp:362 15056 #, kde-format 15057 msgid "Exponent: 0x" 15058 msgstr "Eksponint: 0x" 15059 15060 #: kssl/ksslcertificate.cpp:374 15061 #, kde-format 15062 msgid "Key type: DSA (%1 bit)" 15063 msgstr "Kaaitype: DSA (%1 bit)" 15064 15065 #: kssl/ksslcertificate.cpp:376 15066 #, kde-format 15067 msgid "Prime: " 15068 msgstr "Priemgetal: " 15069 15070 #: kssl/ksslcertificate.cpp:389 15071 #, kde-format 15072 msgid "160 bit prime factor: " 15073 msgstr "160 bits prymfaktor: " 15074 15075 #: kssl/ksslcertificate.cpp:417 15076 #, kde-format 15077 msgid "Public key: " 15078 msgstr "Publike kaai:" 15079 15080 #: kssl/ksslcertificate.cpp:1065 15081 #, kde-format 15082 msgid "The certificate is valid." 15083 msgstr "It sertifikaat is jildich." 15084 15085 #: kssl/ksslcertificate.cpp:1067 15086 #, kde-format 15087 msgid "" 15088 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 15089 "Authority) certificate can not be found." 15090 msgstr "" 15091 15092 #: kssl/ksslcertificate.cpp:1069 15093 #, fuzzy, kde-format 15094 #| msgid "" 15095 #| "Certificate signing authority root files could not be found so the " 15096 #| "certificate is not verified." 15097 msgid "" 15098 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 15099 "CA's (Certificate Authority) CRL can not be found." 15100 msgstr "" 15101 "It sertifikaat is net ferifieare om't de roottriems fan de sertifikaat-" 15102 "útjouwende autoriteit net fûn wurde koenen." 15103 15104 #: kssl/ksslcertificate.cpp:1071 15105 #, kde-format 15106 msgid "" 15107 "The decryption of the certificate's signature failed. This means it could " 15108 "not even be calculated as opposed to just not matching the expected result." 15109 msgstr "" 15110 15111 #: kssl/ksslcertificate.cpp:1073 15112 #, kde-format 15113 msgid "" 15114 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 15115 "This means it could not even be calculated as opposed to just not matching " 15116 "the expected result." 15117 msgstr "" 15118 15119 #: kssl/ksslcertificate.cpp:1075 15120 #, kde-format 15121 msgid "" 15122 "The decoding of the public key of the issuer failed. This means that the " 15123 "CA's (Certificate Authority) certificate can not be used to verify the " 15124 "certificate you wanted to use." 15125 msgstr "" 15126 15127 #: kssl/ksslcertificate.cpp:1077 15128 #, fuzzy, kde-format 15129 #| msgid "" 15130 #| "Certificate signing authority root files could not be found so the " 15131 #| "certificate is not verified." 15132 msgid "" 15133 "The certificate's signature is invalid. This means that the certificate can " 15134 "not be verified." 15135 msgstr "" 15136 "It sertifikaat is net ferifieare om't de roottriems fan de sertifikaat-" 15137 "útjouwende autoriteit net fûn wurde koenen." 15138 15139 #: kssl/ksslcertificate.cpp:1079 15140 #, fuzzy, kde-format 15141 #| msgid "" 15142 #| "Certificate signing authority root files could not be found so the " 15143 #| "certificate is not verified." 15144 msgid "" 15145 "The CRL's (Certificate Revocation List) signature is invalid. This means " 15146 "that the CRL can not be verified." 15147 msgstr "" 15148 "It sertifikaat is net ferifieare om't de roottriems fan de sertifikaat-" 15149 "útjouwende autoriteit net fûn wurde koenen." 15150 15151 #: kssl/ksslcertificate.cpp:1081 15152 #, fuzzy, kde-format 15153 #| msgid "The certificate is invalid." 15154 msgid "The certificate is not valid, yet." 15155 msgstr "De module %1 is gjin jildige ynstellingsmodule." 15156 15157 #: kssl/ksslcertificate.cpp:1083 15158 #, fuzzy, kde-format 15159 #| msgid "The certificate is invalid." 15160 msgid "The certificate is not valid, any more." 15161 msgstr "It sertifikaat is net jildich." 15162 15163 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 15164 #, fuzzy, kde-format 15165 #| msgid "The certificate is invalid." 15166 msgid "The CRL (Certificate Revocation List) is not valid, yet." 15167 msgstr "It sertifikaat is net jildich." 15168 15169 #: kssl/ksslcertificate.cpp:1089 15170 #, kde-format 15171 msgid "The time format of the certificate's 'notBefore' field is invalid." 15172 msgstr "" 15173 15174 #: kssl/ksslcertificate.cpp:1091 15175 #, kde-format 15176 msgid "The time format of the certificate's 'notAfter' field is invalid." 15177 msgstr "" 15178 15179 #: kssl/ksslcertificate.cpp:1093 15180 #, fuzzy, kde-format 15181 #| msgid "The certificate is invalid." 15182 msgid "" 15183 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 15184 "field is invalid." 15185 msgstr "It sertifikaat is net jildich." 15186 15187 #: kssl/ksslcertificate.cpp:1095 15188 #, fuzzy, kde-format 15189 #| msgid "The certificate is invalid." 15190 msgid "" 15191 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 15192 "field is invalid." 15193 msgstr "It sertifikaat is net jildich." 15194 15195 #: kssl/ksslcertificate.cpp:1097 15196 #, kde-format 15197 msgid "The OpenSSL process ran out of memory." 15198 msgstr "" 15199 15200 #: kssl/ksslcertificate.cpp:1099 15201 #, kde-format 15202 msgid "" 15203 "The certificate is self-signed and not in the list of trusted certificates. " 15204 "If you want to accept this certificate, import it into the list of trusted " 15205 "certificates." 15206 msgstr "" 15207 15208 #: kssl/ksslcertificate.cpp:1102 15209 #, kde-format 15210 msgid "" 15211 "The certificate is self-signed. While the trust chain could be built up, the " 15212 "root CA's (Certificate Authority) certificate can not be found." 15213 msgstr "" 15214 15215 #: kssl/ksslcertificate.cpp:1104 15216 #, kde-format 15217 msgid "" 15218 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 15219 "your trust chain is broken." 15220 msgstr "" 15221 15222 #: kssl/ksslcertificate.cpp:1106 15223 #, kde-format 15224 msgid "" 15225 "The certificate can not be verified as it is the only certificate in the " 15226 "trust chain and not self-signed. If you self-sign the certificate, make sure " 15227 "to import it into the list of trusted certificates." 15228 msgstr "" 15229 15230 #: kssl/ksslcertificate.cpp:1108 15231 #, kde-format 15232 msgid "The certificate chain is longer than the maximum depth specified." 15233 msgstr "" 15234 15235 #: kssl/ksslcertificate.cpp:1111 15236 #, fuzzy, kde-format 15237 #| msgid "Certificate has been revoked." 15238 msgid "The certificate has been revoked." 15239 msgstr "It jiskefet is leech makke" 15240 15241 #: kssl/ksslcertificate.cpp:1113 15242 #, fuzzy, kde-format 15243 #| msgid "The certificate is invalid." 15244 msgid "The certificate's CA (Certificate Authority) is invalid." 15245 msgstr "It sertifikaat is net jildich." 15246 15247 #: kssl/ksslcertificate.cpp:1115 15248 #, kde-format 15249 msgid "" 15250 "The length of the trust chain exceeded one of the CA's (Certificate " 15251 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 15252 msgstr "" 15253 15254 #: kssl/ksslcertificate.cpp:1117 15255 #, kde-format 15256 msgid "" 15257 "The certificate has not been signed for the purpose you tried to use it for. " 15258 "This means the CA (Certificate Authority) does not allow this usage." 15259 msgstr "" 15260 15261 #: kssl/ksslcertificate.cpp:1120 15262 #, kde-format 15263 msgid "" 15264 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 15265 "to use this certificate for." 15266 msgstr "" 15267 15268 #: kssl/ksslcertificate.cpp:1123 15269 #, kde-format 15270 msgid "" 15271 "The root CA (Certificate Authority) has been marked to be rejected for the " 15272 "purpose you tried to use it for." 15273 msgstr "" 15274 15275 #: kssl/ksslcertificate.cpp:1125 15276 #, fuzzy, kde-format 15277 #| msgid "" 15278 #| "The IP address of the host %1 does not match the one the certificate was " 15279 #| "issued to." 15280 msgid "" 15281 "The certificate's CA (Certificate Authority) does not match the CA name of " 15282 "the certificate." 15283 msgstr "" 15284 "It IP-adres fan de hostkompjûter %1 is net gelyk oan dyjinge wêroan it " 15285 "sertifikaat útjûn is." 15286 15287 #: kssl/ksslcertificate.cpp:1127 15288 #, fuzzy, kde-format 15289 #| msgid "" 15290 #| "The IP address of the host %1 does not match the one the certificate was " 15291 #| "issued to." 15292 msgid "" 15293 "The CA (Certificate Authority) certificate's key ID does not match the key " 15294 "ID in the 'Issuer' section of the certificate you are trying to use." 15295 msgstr "" 15296 "It IP-adres fan de hostkompjûter %1 is net gelyk oan dyjinge wêroan it " 15297 "sertifikaat útjûn is." 15298 15299 #: kssl/ksslcertificate.cpp:1129 15300 #, kde-format 15301 msgid "" 15302 "The CA (Certificate Authority) certificate's key ID and name do not match " 15303 "the key ID and name in the 'Issuer' section of the certificate you are " 15304 "trying to use." 15305 msgstr "" 15306 15307 #: kssl/ksslcertificate.cpp:1131 15308 #, kde-format 15309 msgid "" 15310 "The certificate's CA (Certificate Authority) is not allowed to sign " 15311 "certificates." 15312 msgstr "" 15313 15314 #: kssl/ksslcertificate.cpp:1133 15315 #, fuzzy, kde-format 15316 msgid "OpenSSL could not be verified." 15317 msgstr "De wurdearring koe net ynstjoerd wurde." 15318 15319 #: kssl/ksslcertificate.cpp:1137 15320 #, kde-format 15321 msgid "" 15322 "The signature test for this certificate failed. This could mean that the " 15323 "signature of this certificate or any in its trust path are invalid, could " 15324 "not be decoded or that the CRL (Certificate Revocation List) could not be " 15325 "verified. If you see this message, please let the author of the software you " 15326 "are using know that he or she should use the new, more specific error " 15327 "messages." 15328 msgstr "" 15329 15330 #: kssl/ksslcertificate.cpp:1139 15331 #, kde-format 15332 msgid "" 15333 "This certificate, any in its trust path or its CA's (Certificate Authority) " 15334 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 15335 "valid yet or not valid any more. If you see this message, please let the " 15336 "author of the software you are using know that he or she should use the new, " 15337 "more specific error messages." 15338 msgstr "" 15339 15340 #: kssl/ksslcertificate.cpp:1145 15341 #, kde-format 15342 msgid "" 15343 "Certificate signing authority root files could not be found so the " 15344 "certificate is not verified." 15345 msgstr "" 15346 "It sertifikaat is net ferifieare om't de roottriems fan de sertifikaat-" 15347 "útjouwende autoriteit net fûn wurde koenen." 15348 15349 #: kssl/ksslcertificate.cpp:1147 15350 #, kde-format 15351 msgid "SSL support was not found." 15352 msgstr "SSL-stipe waard net fûn." 15353 15354 #: kssl/ksslcertificate.cpp:1149 15355 #, kde-format 15356 msgid "Private key test failed." 15357 msgstr "Private kaaitest mislearre." 15358 15359 #: kssl/ksslcertificate.cpp:1151 15360 #, kde-format 15361 msgid "The certificate has not been issued for this host." 15362 msgstr "It sertifikaat is net jûn foar dizze kompjûter." 15363 15364 #: kssl/ksslcertificate.cpp:1153 15365 #, kde-format 15366 msgid "This certificate is not relevant." 15367 msgstr "Dit sertifikaat docht net ta de saak." 15368 15369 #: kssl/ksslcertificate.cpp:1158 15370 #, kde-format 15371 msgid "The certificate is invalid." 15372 msgstr "It sertifikaat is net jildich." 15373 15374 #: kssl/ksslutils.cpp:90 15375 #, kde-format 15376 msgid "GMT" 15377 msgstr "GMT" 15378 15379 #, fuzzy 15380 #~ msgctxt "color" 15381 #~ msgid "hot" 15382 #~ msgstr "Thl" 15383 15384 #, fuzzy 15385 #~ msgctxt "color" 15386 #~ msgid "sea" 15387 #~ msgstr "Skoftsje" 15388 15389 #, fuzzy 15390 #~ msgctxt "@item Calendar system" 15391 #~ msgid "Gregorian (Proleptic)" 15392 #~ msgstr "Gregoriaansk" 15393 15394 #, fuzzy 15395 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15396 #~ msgid "of Mes" 15397 #~ msgstr "fan Meh" 15398 15399 #, fuzzy 15400 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15401 #~ msgid "of Ter" 15402 #~ msgstr "fan Tir" 15403 15404 #, fuzzy 15405 #~ msgctxt "Ethiopian month 1 - ShortName" 15406 #~ msgid "Mes" 15407 #~ msgstr "Ja" 15408 15409 #, fuzzy 15410 #~ msgctxt "Ethiopian month 5 - LongName" 15411 #~ msgid "Ter" 15412 #~ msgstr "ti" 15413 15414 #, fuzzy 15415 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15416 #~ msgid "Ham" 15417 #~ msgstr "am" 15418 15419 #, fuzzy 15420 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15421 #~ msgid "Arb" 15422 #~ msgstr "Arb" 15423 15424 #, fuzzy 15425 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15426 #~ msgid "Rob" 15427 #~ msgstr "Taak" 15428 15429 #, fuzzy 15430 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15431 #~ msgid "Arb" 15432 #~ msgstr "Arb" 15433 15434 #~ msgctxt "of May long" 15435 #~ msgid "of May" 15436 #~ msgstr "fan maaie" 15437 15438 #~ msgctxt "May long" 15439 #~ msgid "May" 15440 #~ msgstr "Maaie" 15441 15442 #~ msgid "R. Thaani" 15443 #~ msgstr "R. Thaani" 15444 15445 #~ msgid "J. Thaani" 15446 #~ msgstr "J. Thaani" 15447 15448 #~ msgid "Hijjah" 15449 #~ msgstr "Hijjah" 15450 15451 #~ msgctxt "of Tir long" 15452 #~ msgid "of Tir" 15453 #~ msgstr "fan Tir" 15454 15455 #~ msgctxt "of Dei long" 15456 #~ msgid "of Dei" 15457 #~ msgstr "fan Dei" 15458 15459 #~ msgctxt "Tir long" 15460 #~ msgid "Tir" 15461 #~ msgstr "Tir" 15462 15463 #~ msgctxt "Dei long" 15464 #~ msgid "Dei" 15465 #~ msgstr "Dei" 15466 15467 #~ msgctxt "Shanbe short" 15468 #~ msgid "shn" 15469 #~ msgstr "shn"