Warning, /frameworks/kdelibs4support/po/fa/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # translation of kdelibs4.po to Persian 0002 # Nazanin Kazemi <kazemi@itland.ir>, 2006, 2007. 0003 # Mahdi Foladgar <foladgar@itland.ir>, 2006. 0004 # Nasim Daniarzadeh <daniarzadeh@itland.ir>, 2006, 2007. 0005 # Tahereh Dadkhahfar <dadkhahfar@itland.ir>, 2006. 0006 # MaryamSadat Razavi <razavi@itland.ir>, 2007. 0007 # Nooshin Asiaie <asiaie@itland.ir>, 2007. 0008 msgid "" 0009 msgstr "" 0010 "Project-Id-Version: kdelibs4\n" 0011 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0012 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0013 "PO-Revision-Date: 2008-07-11 18:00+0330\n" 0014 "Last-Translator: Saied Taghavi <s.taghavi@gmail.com>\n" 0015 "Language-Team: Persian <kde-i18n-fa@kde.org>\n" 0016 "Language: fa\n" 0017 "MIME-Version: 1.0\n" 0018 "Content-Type: text/plain; charset=UTF-8\n" 0019 "Content-Transfer-Encoding: 8bit\n" 0020 "X-Generator: KBabel 1.11.4\n" 0021 "Plural-Forms: nplurals=2; plural=(n > 1);\n" 0022 0023 #, kde-format 0024 msgctxt "NAME OF TRANSLATORS" 0025 msgid "Your names" 0026 msgstr "محمدرضا میردامادی , نازنین کاظمی" 0027 0028 #, kde-format 0029 msgctxt "EMAIL OF TRANSLATORS" 0030 msgid "Your emails" 0031 msgstr "mohi@linuxshop.ir , kazemi@itland.ir" 0032 0033 #, kde-format 0034 msgctxt "color" 0035 msgid "AliceBlue" 0036 msgstr "آبی باز" 0037 0038 #, kde-format 0039 msgctxt "color" 0040 msgid "AntiqueWhite" 0041 msgstr "نارنجی بسیار روشن" 0042 0043 #, kde-format 0044 msgctxt "color" 0045 msgid "AntiqueWhite1" 0046 msgstr "نارنجی بسیار روشن ۱" 0047 0048 #, kde-format 0049 msgctxt "color" 0050 msgid "AntiqueWhite2" 0051 msgstr "نارنجی بسیار روشن ۲" 0052 0053 #, kde-format 0054 msgctxt "color" 0055 msgid "AntiqueWhite3" 0056 msgstr "نارنجی بسیار روشن ۳" 0057 0058 #, kde-format 0059 msgctxt "color" 0060 msgid "AntiqueWhite4" 0061 msgstr "نارنجی بسیار روشن ۴" 0062 0063 #, kde-format 0064 msgctxt "color" 0065 msgid "BlanchedAlmond" 0066 msgstr "مغز بادامی" 0067 0068 #, kde-format 0069 msgctxt "color" 0070 msgid "BlueViolet" 0071 msgstr "بنفش آبی" 0072 0073 #, kde-format 0074 msgctxt "color" 0075 msgid "CadetBlue" 0076 msgstr "سبز ارتشی" 0077 0078 #, kde-format 0079 msgctxt "color" 0080 msgid "CadetBlue1" 0081 msgstr "سبز ارتشی ۱" 0082 0083 #, kde-format 0084 msgctxt "color" 0085 msgid "CadetBlue2" 0086 msgstr "سبز ارتشی ۲" 0087 0088 #, kde-format 0089 msgctxt "color" 0090 msgid "CadetBlue3" 0091 msgstr "سبز ارتشی ۳" 0092 0093 #, kde-format 0094 msgctxt "color" 0095 msgid "CadetBlue4" 0096 msgstr "سبز ارتشی ۴" 0097 0098 #, kde-format 0099 msgctxt "color" 0100 msgid "CornflowerBlue" 0101 msgstr "آبی آسمانی" 0102 0103 #, kde-format 0104 msgctxt "color" 0105 msgid "DarkBlue" 0106 msgstr "آبی تیره" 0107 0108 #, kde-format 0109 msgctxt "color" 0110 msgid "DarkCyan" 0111 msgstr "سبزآبی تیره" 0112 0113 #, kde-format 0114 msgctxt "color" 0115 msgid "DarkGoldenrod" 0116 msgstr "خردلی تیره" 0117 0118 #, kde-format 0119 msgctxt "color" 0120 msgid "DarkGoldenrod1" 0121 msgstr "خردلی تیره ۱" 0122 0123 #, kde-format 0124 msgctxt "color" 0125 msgid "DarkGoldenrod2" 0126 msgstr "خردلی تیره ۲" 0127 0128 #, kde-format 0129 msgctxt "color" 0130 msgid "DarkGoldenrod3" 0131 msgstr "خردلی تیره ۳" 0132 0133 #, kde-format 0134 msgctxt "color" 0135 msgid "DarkGoldenrod4" 0136 msgstr "خردلی تیره ۴" 0137 0138 #, kde-format 0139 msgctxt "color" 0140 msgid "DarkGray" 0141 msgstr "خاکستری تیره" 0142 0143 #, kde-format 0144 msgctxt "color" 0145 msgid "DarkGreen" 0146 msgstr "سبز تیره" 0147 0148 #, kde-format 0149 msgctxt "color" 0150 msgid "DarkGrey" 0151 msgstr "خاکستری تیره" 0152 0153 #, kde-format 0154 msgctxt "color" 0155 msgid "DarkKhaki" 0156 msgstr "خاکی تیره" 0157 0158 #, kde-format 0159 msgctxt "color" 0160 msgid "DarkMagenta" 0161 msgstr "سرخآبی تیره" 0162 0163 #, kde-format 0164 msgctxt "color" 0165 msgid "DarkOliveGreen" 0166 msgstr "سبز زیتونی تیره" 0167 0168 #, kde-format 0169 msgctxt "color" 0170 msgid "DarkOliveGreen1" 0171 msgstr "سبز زیتونی تیره ۱" 0172 0173 #, kde-format 0174 msgctxt "color" 0175 msgid "DarkOliveGreen2" 0176 msgstr "سبز زیتونی تیره ۲" 0177 0178 #, kde-format 0179 msgctxt "color" 0180 msgid "DarkOliveGreen3" 0181 msgstr "سبز زیتونی تیره ۳" 0182 0183 #, kde-format 0184 msgctxt "color" 0185 msgid "DarkOliveGreen4" 0186 msgstr "سبز زیتونی تیره ۴" 0187 0188 #, kde-format 0189 msgctxt "color" 0190 msgid "DarkOrange" 0191 msgstr "نارنجی تیره" 0192 0193 #, kde-format 0194 msgctxt "color" 0195 msgid "DarkOrange1" 0196 msgstr "نارنجی تیره ۱" 0197 0198 #, kde-format 0199 msgctxt "color" 0200 msgid "DarkOrange2" 0201 msgstr "نارنجی تیره ۲" 0202 0203 #, kde-format 0204 msgctxt "color" 0205 msgid "DarkOrange3" 0206 msgstr "نارنجی تیره ۳" 0207 0208 #, kde-format 0209 msgctxt "color" 0210 msgid "DarkOrange4" 0211 msgstr "نارنجی تیره ۴" 0212 0213 #, kde-format 0214 msgctxt "color" 0215 msgid "DarkOrchid" 0216 msgstr "ارغوانی تیره" 0217 0218 #, kde-format 0219 msgctxt "color" 0220 msgid "DarkOrchid1" 0221 msgstr "ارغوانی تیره ۱" 0222 0223 #, kde-format 0224 msgctxt "color" 0225 msgid "DarkOrchid2" 0226 msgstr "ارغوانی تیره ۲" 0227 0228 #, kde-format 0229 msgctxt "color" 0230 msgid "DarkOrchid3" 0231 msgstr "ارغوانی روشن ۳" 0232 0233 #, kde-format 0234 msgctxt "color" 0235 msgid "DarkOrchid4" 0236 msgstr "ارغوانی تیره ۴" 0237 0238 #, kde-format 0239 msgctxt "color" 0240 msgid "DarkRed" 0241 msgstr "قرمز تیره" 0242 0243 #, kde-format 0244 msgctxt "color" 0245 msgid "DarkSalmon" 0246 msgstr "گلبهی تیره" 0247 0248 #, kde-format 0249 msgctxt "color" 0250 msgid "DarkSeaGreen" 0251 msgstr "سبزآبی تیره" 0252 0253 #, kde-format 0254 msgctxt "color" 0255 msgid "DarkSeaGreen1" 0256 msgstr "سبزآبی تیره ۱" 0257 0258 #, kde-format 0259 msgctxt "color" 0260 msgid "DarkSeaGreen2" 0261 msgstr "سبزآبی تیره ۲" 0262 0263 #, kde-format 0264 msgctxt "color" 0265 msgid "DarkSeaGreen3" 0266 msgstr "سبزآبی تیره ۳" 0267 0268 #, kde-format 0269 msgctxt "color" 0270 msgid "DarkSeaGreen4" 0271 msgstr "سبزآبی تیره ۴" 0272 0273 #, kde-format 0274 msgctxt "color" 0275 msgid "DarkSlateBlue" 0276 msgstr "آبی مایل به خاکستری تیره" 0277 0278 #, kde-format 0279 msgctxt "color" 0280 msgid "DarkSlateGray" 0281 msgstr "خاکستری تیره تیره" 0282 0283 #, kde-format 0284 msgctxt "color" 0285 msgid "DarkSlateGray1" 0286 msgstr "خاکستری تیره تیره ۱" 0287 0288 #, kde-format 0289 msgctxt "color" 0290 msgid "DarkSlateGray2" 0291 msgstr "خاکستری تیره تیره ۲" 0292 0293 #, kde-format 0294 msgctxt "color" 0295 msgid "DarkSlateGray3" 0296 msgstr "خاکستری تیره تیره ۳" 0297 0298 #, kde-format 0299 msgctxt "color" 0300 msgid "DarkSlateGray4" 0301 msgstr "خاکستری تیره تیره" 0302 0303 #, kde-format 0304 msgctxt "color" 0305 msgid "DarkSlateGrey" 0306 msgstr "خاکستری تیره تیره" 0307 0308 #, kde-format 0309 msgctxt "color" 0310 msgid "DarkTurquoise" 0311 msgstr "فیروزهای تیره" 0312 0313 #, kde-format 0314 msgctxt "color" 0315 msgid "DarkViolet" 0316 msgstr "بنفش تیره" 0317 0318 #, kde-format 0319 msgctxt "color" 0320 msgid "DeepPink" 0321 msgstr "صورتی سیر" 0322 0323 #, kde-format 0324 msgctxt "color" 0325 msgid "DeepPink1" 0326 msgstr "صورتی سیر ۱" 0327 0328 #, kde-format 0329 msgctxt "color" 0330 msgid "DeepPink2" 0331 msgstr "صورتی سیر ۲" 0332 0333 #, kde-format 0334 msgctxt "color" 0335 msgid "DeepPink3" 0336 msgstr "صورتی سیر ۳" 0337 0338 #, kde-format 0339 msgctxt "color" 0340 msgid "DeepPink4" 0341 msgstr "صورتی سیر ۴" 0342 0343 #, kde-format 0344 msgctxt "color" 0345 msgid "DeepSkyBlue" 0346 msgstr "آبی آسمانی سیر" 0347 0348 #, kde-format 0349 msgctxt "color" 0350 msgid "DeepSkyBlue1" 0351 msgstr "آبی آسمانی سیر ۱" 0352 0353 #, kde-format 0354 msgctxt "color" 0355 msgid "DeepSkyBlue2" 0356 msgstr "آبی آسمانی سیر ۲" 0357 0358 #, kde-format 0359 msgctxt "color" 0360 msgid "DeepSkyBlue3" 0361 msgstr "آبی آسمانی سیر ۳" 0362 0363 #, kde-format 0364 msgctxt "color" 0365 msgid "DeepSkyBlue4" 0366 msgstr "آبی آسمانی سیر ۴" 0367 0368 #, kde-format 0369 msgctxt "color" 0370 msgid "DimGray" 0371 msgstr "خاکستری مات" 0372 0373 #, kde-format 0374 msgctxt "color" 0375 msgid "DimGrey" 0376 msgstr "خاکستری مات" 0377 0378 #, kde-format 0379 msgctxt "color" 0380 msgid "DodgerBlue" 0381 msgstr "آبی کمرنگ" 0382 0383 #, kde-format 0384 msgctxt "color" 0385 msgid "DodgerBlue1" 0386 msgstr "آبی کمرنگ ۱" 0387 0388 #, kde-format 0389 msgctxt "color" 0390 msgid "DodgerBlue2" 0391 msgstr "آبی کمرنگ ۲" 0392 0393 #, kde-format 0394 msgctxt "color" 0395 msgid "DodgerBlue3" 0396 msgstr "آبی کمرنگ ۳" 0397 0398 #, kde-format 0399 msgctxt "color" 0400 msgid "DodgerBlue4" 0401 msgstr "آبی کمرنگ ۴" 0402 0403 #, kde-format 0404 msgctxt "color" 0405 msgid "FloralWhite" 0406 msgstr "سفید گلی" 0407 0408 #, kde-format 0409 msgctxt "color" 0410 msgid "ForestGreen" 0411 msgstr "سبز جنگلی" 0412 0413 #, kde-format 0414 msgctxt "color" 0415 msgid "GhostWhite" 0416 msgstr "سفید یخچالی" 0417 0418 #, kde-format 0419 msgctxt "color" 0420 msgid "GreenYellow" 0421 msgstr "زرد سبز" 0422 0423 #, kde-format 0424 msgctxt "color" 0425 msgid "HotPink" 0426 msgstr "صورتی گرم" 0427 0428 #, kde-format 0429 msgctxt "color" 0430 msgid "HotPink1" 0431 msgstr "صورتی گرم ۱" 0432 0433 #, kde-format 0434 msgctxt "color" 0435 msgid "HotPink2" 0436 msgstr "صورتی گرم ۲" 0437 0438 #, kde-format 0439 msgctxt "color" 0440 msgid "HotPink3" 0441 msgstr "صورتی گرم ۳" 0442 0443 #, kde-format 0444 msgctxt "color" 0445 msgid "HotPink4" 0446 msgstr "صورتی گرم ۴" 0447 0448 #, kde-format 0449 msgctxt "color" 0450 msgid "IndianRed" 0451 msgstr "اُخرایی" 0452 0453 #, kde-format 0454 msgctxt "color" 0455 msgid "IndianRed1" 0456 msgstr "اُخرایی ۱" 0457 0458 #, kde-format 0459 msgctxt "color" 0460 msgid "IndianRed2" 0461 msgstr "اُخرایی ۲" 0462 0463 #, kde-format 0464 msgctxt "color" 0465 msgid "IndianRed3" 0466 msgstr "اُخرایی ۳" 0467 0468 #, kde-format 0469 msgctxt "color" 0470 msgid "IndianRed4" 0471 msgstr "اُخرایی ۴" 0472 0473 #, kde-format 0474 msgctxt "color" 0475 msgid "LavenderBlush" 0476 msgstr "بنفش روشن" 0477 0478 #, kde-format 0479 msgctxt "color" 0480 msgid "LavenderBlush1" 0481 msgstr "بنفش روشن ۱" 0482 0483 #, kde-format 0484 msgctxt "color" 0485 msgid "LavenderBlush2" 0486 msgstr "بنفش روشن ۲" 0487 0488 #, kde-format 0489 msgctxt "color" 0490 msgid "LavenderBlush3" 0491 msgstr "بنفش روشن ۳" 0492 0493 #, kde-format 0494 msgctxt "color" 0495 msgid "LavenderBlush4" 0496 msgstr "بنفش روشن ۴" 0497 0498 #, kde-format 0499 msgctxt "color" 0500 msgid "LawnGreen" 0501 msgstr "سبز چمنی" 0502 0503 #, kde-format 0504 msgctxt "color" 0505 msgid "LemonChiffon" 0506 msgstr "زرد روشن" 0507 0508 #, kde-format 0509 msgctxt "color" 0510 msgid "LemonChiffon1" 0511 msgstr "زرد روشن ۱" 0512 0513 #, kde-format 0514 msgctxt "color" 0515 msgid "LemonChiffon2" 0516 msgstr "زرد روشن ۲" 0517 0518 #, kde-format 0519 msgctxt "color" 0520 msgid "LemonChiffon3" 0521 msgstr "زرد روشن ۳" 0522 0523 #, kde-format 0524 msgctxt "color" 0525 msgid "LemonChiffon4" 0526 msgstr "زرد روشن ۴" 0527 0528 #, kde-format 0529 msgctxt "color" 0530 msgid "LightBlue" 0531 msgstr "آبی روشن" 0532 0533 #, kde-format 0534 msgctxt "color" 0535 msgid "LightBlue1" 0536 msgstr "آبی روشن ۱" 0537 0538 #, kde-format 0539 msgctxt "color" 0540 msgid "LightBlue2" 0541 msgstr "آبی روشن ۲" 0542 0543 #, kde-format 0544 msgctxt "color" 0545 msgid "LightBlue3" 0546 msgstr "آبی روشن ۳" 0547 0548 #, kde-format 0549 msgctxt "color" 0550 msgid "LightBlue4" 0551 msgstr "آبی روشن ۴" 0552 0553 #, kde-format 0554 msgctxt "color" 0555 msgid "LightCoral" 0556 msgstr "مرجانی روشن" 0557 0558 #, kde-format 0559 msgctxt "color" 0560 msgid "LightCyan" 0561 msgstr "سبزآبی روشن" 0562 0563 #, kde-format 0564 msgctxt "color" 0565 msgid "LightCyan1" 0566 msgstr "سبزآبی روشن ۱" 0567 0568 #, kde-format 0569 msgctxt "color" 0570 msgid "LightCyan2" 0571 msgstr "سبزآبی روشن ۲" 0572 0573 #, kde-format 0574 msgctxt "color" 0575 msgid "LightCyan3" 0576 msgstr "سبزآبی روشن ۳" 0577 0578 #, kde-format 0579 msgctxt "color" 0580 msgid "LightCyan4" 0581 msgstr "سبزآبی روشن ۴" 0582 0583 #, kde-format 0584 msgctxt "color" 0585 msgid "LightGoldenrod" 0586 msgstr "خردلی روشن" 0587 0588 #, kde-format 0589 msgctxt "color" 0590 msgid "LightGoldenrod1" 0591 msgstr "خردلی روشن ۱" 0592 0593 #, kde-format 0594 msgctxt "color" 0595 msgid "LightGoldenrod2" 0596 msgstr "خردلی روشن ۲" 0597 0598 #, kde-format 0599 msgctxt "color" 0600 msgid "LightGoldenrod3" 0601 msgstr "خردلی روشن ۳" 0602 0603 #, kde-format 0604 msgctxt "color" 0605 msgid "LightGoldenrod4" 0606 msgstr "خردلی روشن ۴" 0607 0608 #, kde-format 0609 msgctxt "color" 0610 msgid "LightGoldenrodYellow" 0611 msgstr "زرد خردلی روشن" 0612 0613 #, kde-format 0614 msgctxt "color" 0615 msgid "LightGray" 0616 msgstr "خاکستری روشن" 0617 0618 #, kde-format 0619 msgctxt "color" 0620 msgid "LightGreen" 0621 msgstr "سبز روشن" 0622 0623 #, kde-format 0624 msgctxt "color" 0625 msgid "LightGrey" 0626 msgstr "خاکستری روشن" 0627 0628 #, kde-format 0629 msgctxt "color" 0630 msgid "LightPink" 0631 msgstr "صورتی روشن" 0632 0633 #, kde-format 0634 msgctxt "color" 0635 msgid "LightPink1" 0636 msgstr "صورتی روشن ۱" 0637 0638 #, kde-format 0639 msgctxt "color" 0640 msgid "LightPink2" 0641 msgstr "صورتی روشن ۲" 0642 0643 #, kde-format 0644 msgctxt "color" 0645 msgid "LightPink3" 0646 msgstr "صورتی روشن ۳" 0647 0648 #, kde-format 0649 msgctxt "color" 0650 msgid "LightPink4" 0651 msgstr "صورتی روشن ۴" 0652 0653 #, kde-format 0654 msgctxt "color" 0655 msgid "LightSalmon" 0656 msgstr "گلبهی روشن" 0657 0658 #, kde-format 0659 msgctxt "color" 0660 msgid "LightSalmon1" 0661 msgstr "گلبهی روشن ۱" 0662 0663 #, kde-format 0664 msgctxt "color" 0665 msgid "LightSalmon2" 0666 msgstr "گلبهی روشن ۲" 0667 0668 #, kde-format 0669 msgctxt "color" 0670 msgid "LightSalmon3" 0671 msgstr "گلبهی روشن ۳" 0672 0673 #, kde-format 0674 msgctxt "color" 0675 msgid "LightSalmon4" 0676 msgstr "گلبهی روشن ۴" 0677 0678 #, kde-format 0679 msgctxt "color" 0680 msgid "LightSeaGreen" 0681 msgstr "سبزآبی روشن" 0682 0683 #, kde-format 0684 msgctxt "color" 0685 msgid "LightSkyBlue" 0686 msgstr "آبی آسمانی روشن" 0687 0688 #, kde-format 0689 msgctxt "color" 0690 msgid "LightSkyBlue1" 0691 msgstr "آبی آسمانی روشن ۱" 0692 0693 #, kde-format 0694 msgctxt "color" 0695 msgid "LightSkyBlue2" 0696 msgstr "آبی آسمانی روشن ۲" 0697 0698 #, kde-format 0699 msgctxt "color" 0700 msgid "LightSkyBlue3" 0701 msgstr "آبی آسمانی روشن ۳" 0702 0703 #, kde-format 0704 msgctxt "color" 0705 msgid "LightSkyBlue4" 0706 msgstr "آبی آسمانی روشن ۴" 0707 0708 #, kde-format 0709 msgctxt "color" 0710 msgid "LightSlateBlue" 0711 msgstr "آبی مایل به خاکستری روشن" 0712 0713 #, kde-format 0714 msgctxt "color" 0715 msgid "LightSlateGray" 0716 msgstr "خاکستری تیره باز" 0717 0718 #, kde-format 0719 msgctxt "color" 0720 msgid "LightSlateGrey" 0721 msgstr "خاکستری تیره باز" 0722 0723 #, kde-format 0724 msgctxt "color" 0725 msgid "LightSteelBlue" 0726 msgstr "آبی نفتی روشن" 0727 0728 #, kde-format 0729 msgctxt "color" 0730 msgid "LightSteelBlue1" 0731 msgstr "آبی نفتی روشن ۱" 0732 0733 #, kde-format 0734 msgctxt "color" 0735 msgid "LightSteelBlue2" 0736 msgstr "آبی نفتی روشن ۲" 0737 0738 #, kde-format 0739 msgctxt "color" 0740 msgid "LightSteelBlue3" 0741 msgstr "آبی نفتی روشن ۳" 0742 0743 #, kde-format 0744 msgctxt "color" 0745 msgid "LightSteelBlue4" 0746 msgstr "آبی نفتی روشن ۴" 0747 0748 #, kde-format 0749 msgctxt "color" 0750 msgid "LightYellow" 0751 msgstr "زرد روشن" 0752 0753 #, kde-format 0754 msgctxt "color" 0755 msgid "LightYellow1" 0756 msgstr "زرد روشن ۱" 0757 0758 #, kde-format 0759 msgctxt "color" 0760 msgid "LightYellow2" 0761 msgstr "زرد روشن ۲" 0762 0763 #, kde-format 0764 msgctxt "color" 0765 msgid "LightYellow3" 0766 msgstr "زد روشن ۳" 0767 0768 #, kde-format 0769 msgctxt "color" 0770 msgid "LightYellow4" 0771 msgstr "زرد روشن ۴" 0772 0773 #, kde-format 0774 msgctxt "color" 0775 msgid "LimeGreen" 0776 msgstr "سبز لیمویی" 0777 0778 #, kde-format 0779 msgctxt "color" 0780 msgid "MediumAquamarine" 0781 msgstr "کبود متوسط" 0782 0783 #, kde-format 0784 msgctxt "color" 0785 msgid "MediumBlue" 0786 msgstr "آبی متوسط" 0787 0788 #, kde-format 0789 msgctxt "color" 0790 msgid "MediumOrchid" 0791 msgstr "ارغوانی متوسط" 0792 0793 #, kde-format 0794 msgctxt "color" 0795 msgid "MediumOrchid1" 0796 msgstr "ارغوانی متوسط ۱" 0797 0798 #, kde-format 0799 msgctxt "color" 0800 msgid "MediumOrchid2" 0801 msgstr "ارغوانی متوسط ۲" 0802 0803 #, kde-format 0804 msgctxt "color" 0805 msgid "MediumOrchid3" 0806 msgstr "ارغوانی متوسط ۳" 0807 0808 #, kde-format 0809 msgctxt "color" 0810 msgid "MediumOrchid4" 0811 msgstr "ارغوانی متوسط ۴" 0812 0813 #, kde-format 0814 msgctxt "color" 0815 msgid "MediumPurple" 0816 msgstr "بنفش متوسط" 0817 0818 #, kde-format 0819 msgctxt "color" 0820 msgid "MediumPurple1" 0821 msgstr "بنفش متوسط ۱" 0822 0823 #, kde-format 0824 msgctxt "color" 0825 msgid "MediumPurple2" 0826 msgstr "بنفش متوسط ۲" 0827 0828 #, kde-format 0829 msgctxt "color" 0830 msgid "MediumPurple3" 0831 msgstr "بنفش متوسط ۳" 0832 0833 #, kde-format 0834 msgctxt "color" 0835 msgid "MediumPurple4" 0836 msgstr "بنفش متوسط ۴" 0837 0838 #, kde-format 0839 msgctxt "color" 0840 msgid "MediumSeaGreen" 0841 msgstr "سبزآبی متوسط" 0842 0843 #, kde-format 0844 msgctxt "color" 0845 msgid "MediumSlateBlue" 0846 msgstr "آبی مایل به خاکستری متوسط" 0847 0848 #, kde-format 0849 msgctxt "color" 0850 msgid "MediumSpringGreen" 0851 msgstr "سبز بهاری متوسط" 0852 0853 #, kde-format 0854 msgctxt "color" 0855 msgid "MediumTurquoise" 0856 msgstr "فیروزهای متوسط" 0857 0858 #, kde-format 0859 msgctxt "color" 0860 msgid "MediumVioletRed" 0861 msgstr "قرمز بنفش متوسط" 0862 0863 #, kde-format 0864 msgctxt "color" 0865 msgid "MidnightBlue" 0866 msgstr "آبی سیر" 0867 0868 #, kde-format 0869 msgctxt "color" 0870 msgid "MintCream" 0871 msgstr "سبز خیلی روشن" 0872 0873 #, kde-format 0874 msgctxt "color" 0875 msgid "MistyRose" 0876 msgstr "صورتی روشن" 0877 0878 #, kde-format 0879 msgctxt "color" 0880 msgid "MistyRose1" 0881 msgstr "صورتی روشن ۱" 0882 0883 #, kde-format 0884 msgctxt "color" 0885 msgid "MistyRose2" 0886 msgstr "صورتی روشن ۲" 0887 0888 #, kde-format 0889 msgctxt "color" 0890 msgid "MistyRose3" 0891 msgstr "صورتی روشن ۳" 0892 0893 #, kde-format 0894 msgctxt "color" 0895 msgid "MistyRose4" 0896 msgstr "صورتی روشن ۴" 0897 0898 #, kde-format 0899 msgctxt "color" 0900 msgid "NavajoWhite" 0901 msgstr "نارنجی روشن" 0902 0903 #, kde-format 0904 msgctxt "color" 0905 msgid "NavajoWhite1" 0906 msgstr "نارنجی روشن ۱" 0907 0908 #, kde-format 0909 msgctxt "color" 0910 msgid "NavajoWhite2" 0911 msgstr "نارنجی روشن ۲" 0912 0913 #, kde-format 0914 msgctxt "color" 0915 msgid "NavajoWhite3" 0916 msgstr "نارنجی روشن ۳" 0917 0918 #, kde-format 0919 msgctxt "color" 0920 msgid "NavajoWhite4" 0921 msgstr "نارنجی روشن ۴" 0922 0923 #, kde-format 0924 msgctxt "color" 0925 msgid "NavyBlue" 0926 msgstr "آبی سیر" 0927 0928 #, kde-format 0929 msgctxt "color" 0930 msgid "OldLace" 0931 msgstr "کرمی روشن" 0932 0933 #, kde-format 0934 msgctxt "color" 0935 msgid "OliveDrab" 0936 msgstr "خاکی زیتونی" 0937 0938 #, kde-format 0939 msgctxt "color" 0940 msgid "OliveDrab1" 0941 msgstr "خاکی زیتونی ۱" 0942 0943 #, kde-format 0944 msgctxt "color" 0945 msgid "OliveDrab2" 0946 msgstr "خاکی زیتونی ۲" 0947 0948 #, kde-format 0949 msgctxt "color" 0950 msgid "OliveDrab3" 0951 msgstr "خاکی زیتونی ۳" 0952 0953 #, kde-format 0954 msgctxt "color" 0955 msgid "OliveDrab4" 0956 msgstr "خاکی زیتونی ۴" 0957 0958 #, kde-format 0959 msgctxt "color" 0960 msgid "OrangeRed" 0961 msgstr "قرمز نارنجی" 0962 0963 #, kde-format 0964 msgctxt "color" 0965 msgid "OrangeRed1" 0966 msgstr "قرمز نارنجی ۱۱" 0967 0968 #, kde-format 0969 msgctxt "color" 0970 msgid "OrangeRed2" 0971 msgstr "قرمز نارنجی ۲" 0972 0973 #, kde-format 0974 msgctxt "color" 0975 msgid "OrangeRed3" 0976 msgstr "قرمز نارنجی ۳" 0977 0978 #, kde-format 0979 msgctxt "color" 0980 msgid "OrangeRed4" 0981 msgstr "قرمز نارنجی ۴" 0982 0983 #, kde-format 0984 msgctxt "color" 0985 msgid "PaleGoldenrod" 0986 msgstr "خردلی تیره" 0987 0988 #, kde-format 0989 msgctxt "color" 0990 msgid "PaleGreen" 0991 msgstr "سبز کمرنگ" 0992 0993 #, kde-format 0994 msgctxt "color" 0995 msgid "PaleGreen1" 0996 msgstr "سبز کمرنگ ۱" 0997 0998 #, kde-format 0999 msgctxt "color" 1000 msgid "PaleGreen2" 1001 msgstr "سبز کمرنگ ۲" 1002 1003 #, kde-format 1004 msgctxt "color" 1005 msgid "PaleGreen3" 1006 msgstr "سبز کمرنگ ۳" 1007 1008 #, kde-format 1009 msgctxt "color" 1010 msgid "PaleGreen4" 1011 msgstr "سبز کمرنگ ۴" 1012 1013 #, kde-format 1014 msgctxt "color" 1015 msgid "PaleTurquoise" 1016 msgstr "فیروزهای کمرنگ" 1017 1018 #, kde-format 1019 msgctxt "color" 1020 msgid "PaleTurquoise1" 1021 msgstr "فیروزهای کمرنگ ۱" 1022 1023 #, kde-format 1024 msgctxt "color" 1025 msgid "PaleTurquoise2" 1026 msgstr "فیروزهای کمرنگ ۲" 1027 1028 #, kde-format 1029 msgctxt "color" 1030 msgid "PaleTurquoise3" 1031 msgstr "فیروزهای کمرنگ ۳" 1032 1033 #, kde-format 1034 msgctxt "color" 1035 msgid "PaleTurquoise4" 1036 msgstr "فیروزهای کمرنگ ۴" 1037 1038 #, kde-format 1039 msgctxt "color" 1040 msgid "PaleVioletRed" 1041 msgstr "قرمز بنفش کمرنگ" 1042 1043 #, kde-format 1044 msgctxt "color" 1045 msgid "PaleVioletRed1" 1046 msgstr "قرمز بنفش کمرنگ ۱" 1047 1048 #, kde-format 1049 msgctxt "color" 1050 msgid "PaleVioletRed2" 1051 msgstr "قرمز بنفش کمرنگ ۲" 1052 1053 #, kde-format 1054 msgctxt "color" 1055 msgid "PaleVioletRed3" 1056 msgstr "قرمز بنفش کمرنگ ۳" 1057 1058 #, kde-format 1059 msgctxt "color" 1060 msgid "PaleVioletRed4" 1061 msgstr "قرمز بنفش کمرنگ ۴" 1062 1063 #, kde-format 1064 msgctxt "color" 1065 msgid "PapayaWhip" 1066 msgstr "کرمی" 1067 1068 #, kde-format 1069 msgctxt "color" 1070 msgid "PeachPuff" 1071 msgstr "کرمی تیره" 1072 1073 #, kde-format 1074 msgctxt "color" 1075 msgid "PeachPuff1" 1076 msgstr "کرمی تیره ۱" 1077 1078 #, kde-format 1079 msgctxt "color" 1080 msgid "PeachPuff2" 1081 msgstr "کرمی تیره ۲" 1082 1083 #, kde-format 1084 msgctxt "color" 1085 msgid "PeachPuff3" 1086 msgstr "کرمی تیره ۳" 1087 1088 #, kde-format 1089 msgctxt "color" 1090 msgid "PeachPuff4" 1091 msgstr "کرمی تیره ۴" 1092 1093 #, kde-format 1094 msgctxt "color" 1095 msgid "PowderBlue" 1096 msgstr "آبی کمرنگ" 1097 1098 #, kde-format 1099 msgctxt "color" 1100 msgid "RosyBrown" 1101 msgstr "قهوهای گلی" 1102 1103 #, kde-format 1104 msgctxt "color" 1105 msgid "RosyBrown1" 1106 msgstr "قهوهای گلی ۱" 1107 1108 #, kde-format 1109 msgctxt "color" 1110 msgid "RosyBrown2" 1111 msgstr "قهوهای گلی ۲" 1112 1113 #, kde-format 1114 msgctxt "color" 1115 msgid "RosyBrown3" 1116 msgstr "قهوهای گلی ۳" 1117 1118 #, kde-format 1119 msgctxt "color" 1120 msgid "RosyBrown4" 1121 msgstr "قهوهای گلی ۴" 1122 1123 #, kde-format 1124 msgctxt "color" 1125 msgid "RoyalBlue" 1126 msgstr "آبی تند" 1127 1128 #, kde-format 1129 msgctxt "color" 1130 msgid "RoyalBlue1" 1131 msgstr "آبی تند ۱" 1132 1133 #, kde-format 1134 msgctxt "color" 1135 msgid "RoyalBlue2" 1136 msgstr "آبی تند ۲" 1137 1138 #, kde-format 1139 msgctxt "color" 1140 msgid "RoyalBlue3" 1141 msgstr "آبی تند ۳" 1142 1143 #, kde-format 1144 msgctxt "color" 1145 msgid "RoyalBlue4" 1146 msgstr "آبی تند ۴" 1147 1148 #, kde-format 1149 msgctxt "color" 1150 msgid "SaddleBrown" 1151 msgstr "قهوهای زینی" 1152 1153 #, kde-format 1154 msgctxt "color" 1155 msgid "SandyBrown" 1156 msgstr "قهوهای حنایی" 1157 1158 #, kde-format 1159 msgctxt "color" 1160 msgid "SeaGreen" 1161 msgstr "سبزآبی" 1162 1163 #, kde-format 1164 msgctxt "color" 1165 msgid "SeaGreen1" 1166 msgstr "سبزآبی ۱" 1167 1168 #, kde-format 1169 msgctxt "color" 1170 msgid "SeaGreen2" 1171 msgstr "سبزآبی ۲" 1172 1173 #, kde-format 1174 msgctxt "color" 1175 msgid "SeaGreen3" 1176 msgstr "سبزآبی ۳" 1177 1178 #, kde-format 1179 msgctxt "color" 1180 msgid "SeaGreen4" 1181 msgstr "سبزآبی ۴" 1182 1183 #, kde-format 1184 msgctxt "color" 1185 msgid "SkyBlue" 1186 msgstr "آبی آسمانی" 1187 1188 #, kde-format 1189 msgctxt "color" 1190 msgid "SkyBlue1" 1191 msgstr "آبی آسمانی ۱" 1192 1193 #, kde-format 1194 msgctxt "color" 1195 msgid "SkyBlue2" 1196 msgstr "آبی آسمانی ۲" 1197 1198 #, kde-format 1199 msgctxt "color" 1200 msgid "SkyBlue3" 1201 msgstr "آبی آسمانی۳" 1202 1203 #, kde-format 1204 msgctxt "color" 1205 msgid "SkyBlue4" 1206 msgstr "آبی آسمانی ۴" 1207 1208 #, kde-format 1209 msgctxt "color" 1210 msgid "SlateBlue" 1211 msgstr "آبی مایل به خاکستری" 1212 1213 #, kde-format 1214 msgctxt "color" 1215 msgid "SlateBlue1" 1216 msgstr "آبی مایل به خاکستری ۱" 1217 1218 #, kde-format 1219 msgctxt "color" 1220 msgid "SlateBlue2" 1221 msgstr "آبی مایل به خاکستری ۲" 1222 1223 #, kde-format 1224 msgctxt "color" 1225 msgid "SlateBlue3" 1226 msgstr "آبی مایل به خاکستری ۳" 1227 1228 #, kde-format 1229 msgctxt "color" 1230 msgid "SlateBlue4" 1231 msgstr "آبی مایل به خاکستری ۴" 1232 1233 #, kde-format 1234 msgctxt "color" 1235 msgid "SlateGray" 1236 msgstr "خاکستری تیره" 1237 1238 #, kde-format 1239 msgctxt "color" 1240 msgid "SlateGray1" 1241 msgstr "خاکستری تیره ۱" 1242 1243 #, kde-format 1244 msgctxt "color" 1245 msgid "SlateGray2" 1246 msgstr "خاکستری تیره ۲" 1247 1248 #, kde-format 1249 msgctxt "color" 1250 msgid "SlateGray3" 1251 msgstr "خاکستری تیره ۳" 1252 1253 #, kde-format 1254 msgctxt "color" 1255 msgid "SlateGray4" 1256 msgstr "خاکستری تیره ۳" 1257 1258 #, kde-format 1259 msgctxt "color" 1260 msgid "SlateGrey" 1261 msgstr "خاکستری تیره" 1262 1263 #, kde-format 1264 msgctxt "color" 1265 msgid "SpringGreen" 1266 msgstr "سبز بهاری" 1267 1268 #, kde-format 1269 msgctxt "color" 1270 msgid "SpringGreen1" 1271 msgstr "سبز بهاری ۲" 1272 1273 #, kde-format 1274 msgctxt "color" 1275 msgid "SpringGreen2" 1276 msgstr "سبز بهاری ۲" 1277 1278 #, kde-format 1279 msgctxt "color" 1280 msgid "SpringGreen3" 1281 msgstr "سبز بهاری ۴" 1282 1283 #, kde-format 1284 msgctxt "color" 1285 msgid "SpringGreen4" 1286 msgstr "سبز بهاری ۴" 1287 1288 #, kde-format 1289 msgctxt "color" 1290 msgid "SteelBlue" 1291 msgstr "آبی نفتی" 1292 1293 #, kde-format 1294 msgctxt "color" 1295 msgid "SteelBlue1" 1296 msgstr "آبی نفتی ۱" 1297 1298 #, kde-format 1299 msgctxt "color" 1300 msgid "SteelBlue2" 1301 msgstr "آبی نفتی ۲" 1302 1303 #, kde-format 1304 msgctxt "color" 1305 msgid "SteelBlue3" 1306 msgstr "آبی نفتی ۳" 1307 1308 #, kde-format 1309 msgctxt "color" 1310 msgid "SteelBlue4" 1311 msgstr "آبی نفتی ۴" 1312 1313 #, kde-format 1314 msgctxt "color" 1315 msgid "VioletRed" 1316 msgstr "قرمز بنفش" 1317 1318 #, kde-format 1319 msgctxt "color" 1320 msgid "VioletRed1" 1321 msgstr "قرمز بنفش ۱" 1322 1323 #, kde-format 1324 msgctxt "color" 1325 msgid "VioletRed2" 1326 msgstr "قرمز بنفش ۲" 1327 1328 #, kde-format 1329 msgctxt "color" 1330 msgid "VioletRed3" 1331 msgstr "قرمز بنفش ۳" 1332 1333 #, kde-format 1334 msgctxt "color" 1335 msgid "VioletRed4" 1336 msgstr "قرمز بنفش ۴" 1337 1338 #, kde-format 1339 msgctxt "color" 1340 msgid "WhiteSmoke" 1341 msgstr "دودی سفید" 1342 1343 #, kde-format 1344 msgctxt "color" 1345 msgid "YellowGreen" 1346 msgstr "سبز زرد" 1347 1348 #, kde-format 1349 msgctxt "color" 1350 msgid "aquamarine" 1351 msgstr "کبود" 1352 1353 #, kde-format 1354 msgctxt "color" 1355 msgid "aquamarine1" 1356 msgstr "کبود ۱" 1357 1358 #, kde-format 1359 msgctxt "color" 1360 msgid "aquamarine2" 1361 msgstr "کبود ۲" 1362 1363 #, kde-format 1364 msgctxt "color" 1365 msgid "aquamarine3" 1366 msgstr "کبود ۳" 1367 1368 #, kde-format 1369 msgctxt "color" 1370 msgid "aquamarine4" 1371 msgstr "کبود ۴" 1372 1373 #, kde-format 1374 msgctxt "color" 1375 msgid "azure" 1376 msgstr "لاجوردی" 1377 1378 #, kde-format 1379 msgctxt "color" 1380 msgid "azure1" 1381 msgstr "لاجوردی ۱" 1382 1383 #, kde-format 1384 msgctxt "color" 1385 msgid "azure2" 1386 msgstr "لاجوردی ۲" 1387 1388 #, kde-format 1389 msgctxt "color" 1390 msgid "azure3" 1391 msgstr "لاجوردی ۳" 1392 1393 #, kde-format 1394 msgctxt "color" 1395 msgid "azure4" 1396 msgstr "لاجوردی ۴" 1397 1398 #, kde-format 1399 msgctxt "color" 1400 msgid "beige" 1401 msgstr "بژ" 1402 1403 #, kde-format 1404 msgctxt "color" 1405 msgid "bisque" 1406 msgstr "خردلی روشن" 1407 1408 #, kde-format 1409 msgctxt "color" 1410 msgid "bisque1" 1411 msgstr "خردلی روشن ۱" 1412 1413 #, kde-format 1414 msgctxt "color" 1415 msgid "bisque2" 1416 msgstr "خردلی روشن ۲" 1417 1418 #, kde-format 1419 msgctxt "color" 1420 msgid "bisque3" 1421 msgstr "خردلی روشن ۳" 1422 1423 #, kde-format 1424 msgctxt "color" 1425 msgid "bisque4" 1426 msgstr "خردلی روشن ۴" 1427 1428 #, kde-format 1429 msgctxt "color" 1430 msgid "black" 1431 msgstr "سیاه" 1432 1433 #, kde-format 1434 msgctxt "color" 1435 msgid "blue" 1436 msgstr "آبی" 1437 1438 #, kde-format 1439 msgctxt "color" 1440 msgid "blue1" 1441 msgstr "آبی ۱" 1442 1443 #, kde-format 1444 msgctxt "color" 1445 msgid "blue2" 1446 msgstr "آبی ۲" 1447 1448 #, kde-format 1449 msgctxt "color" 1450 msgid "blue3" 1451 msgstr "آبی ۳" 1452 1453 #, kde-format 1454 msgctxt "color" 1455 msgid "blue4" 1456 msgstr "آبی ۴" 1457 1458 #, kde-format 1459 msgctxt "color" 1460 msgid "brown" 1461 msgstr "قهوهای" 1462 1463 #, kde-format 1464 msgctxt "color" 1465 msgid "brown1" 1466 msgstr "قهوهای ۱" 1467 1468 #, kde-format 1469 msgctxt "color" 1470 msgid "brown2" 1471 msgstr "قهوهای ۲" 1472 1473 #, kde-format 1474 msgctxt "color" 1475 msgid "brown3" 1476 msgstr "قهوهای ۳" 1477 1478 #, kde-format 1479 msgctxt "color" 1480 msgid "brown4" 1481 msgstr "قهوهای ۴" 1482 1483 #, kde-format 1484 msgctxt "color" 1485 msgid "burlywood" 1486 msgstr "قهوهای" 1487 1488 #, kde-format 1489 msgctxt "color" 1490 msgid "burlywood1" 1491 msgstr "قهوهای ۱" 1492 1493 #, kde-format 1494 msgctxt "color" 1495 msgid "burlywood2" 1496 msgstr "قهوهای ۲" 1497 1498 #, kde-format 1499 msgctxt "color" 1500 msgid "burlywood3" 1501 msgstr "قهوهای ۳" 1502 1503 #, kde-format 1504 msgctxt "color" 1505 msgid "burlywood4" 1506 msgstr "قهوهای ۴" 1507 1508 #, kde-format 1509 msgctxt "color" 1510 msgid "chartreuse" 1511 msgstr "مغز پستهای" 1512 1513 #, kde-format 1514 msgctxt "color" 1515 msgid "chartreuse1" 1516 msgstr "مغز پستهای ۱" 1517 1518 #, kde-format 1519 msgctxt "color" 1520 msgid "chartreuse2" 1521 msgstr "مغز پستهای ۲" 1522 1523 #, kde-format 1524 msgctxt "color" 1525 msgid "chartreuse3" 1526 msgstr "مغز پستهای ۳" 1527 1528 #, kde-format 1529 msgctxt "color" 1530 msgid "chartreuse4" 1531 msgstr "مغز پستهای ۴" 1532 1533 #, kde-format 1534 msgctxt "color" 1535 msgid "chocolate" 1536 msgstr "شکلاتی" 1537 1538 #, kde-format 1539 msgctxt "color" 1540 msgid "chocolate1" 1541 msgstr "شکلاتی ۱" 1542 1543 #, kde-format 1544 msgctxt "color" 1545 msgid "chocolate2" 1546 msgstr "شکلاتی ۲" 1547 1548 #, kde-format 1549 msgctxt "color" 1550 msgid "chocolate3" 1551 msgstr "شکلاتی ۳" 1552 1553 #, kde-format 1554 msgctxt "color" 1555 msgid "chocolate4" 1556 msgstr "شکلاتی ۴" 1557 1558 #, kde-format 1559 msgctxt "color" 1560 msgid "coral" 1561 msgstr "مرجانی" 1562 1563 #, kde-format 1564 msgctxt "color" 1565 msgid "coral1" 1566 msgstr "مرجانی ۱" 1567 1568 #, kde-format 1569 msgctxt "color" 1570 msgid "coral2" 1571 msgstr "مرجانی ۲" 1572 1573 #, kde-format 1574 msgctxt "color" 1575 msgid "coral3" 1576 msgstr "مرجانی ۳" 1577 1578 #, kde-format 1579 msgctxt "color" 1580 msgid "coral4" 1581 msgstr "مرجانی ۴" 1582 1583 #, kde-format 1584 msgctxt "color" 1585 msgid "cornsilk" 1586 msgstr "زرد بسیار روشن" 1587 1588 #, kde-format 1589 msgctxt "color" 1590 msgid "cornsilk1" 1591 msgstr "زرد بسیار روشن ۱" 1592 1593 #, kde-format 1594 msgctxt "color" 1595 msgid "cornsilk2" 1596 msgstr "زرد بسیار روشن ۲" 1597 1598 #, kde-format 1599 msgctxt "color" 1600 msgid "cornsilk3" 1601 msgstr "زرد بسیار روشن ۳" 1602 1603 #, kde-format 1604 msgctxt "color" 1605 msgid "cornsilk4" 1606 msgstr "زرد بسیار روشن ۴" 1607 1608 #, kde-format 1609 msgctxt "color" 1610 msgid "cyan" 1611 msgstr "سبزآبی" 1612 1613 #, kde-format 1614 msgctxt "color" 1615 msgid "cyan1" 1616 msgstr "سبزآبی ۱" 1617 1618 #, kde-format 1619 msgctxt "color" 1620 msgid "cyan2" 1621 msgstr "سبزآبی ۲" 1622 1623 #, kde-format 1624 msgctxt "color" 1625 msgid "cyan3" 1626 msgstr "سبزآبی ۳" 1627 1628 #, kde-format 1629 msgctxt "color" 1630 msgid "cyan4" 1631 msgstr "سبزآبی ۴" 1632 1633 #, kde-format 1634 msgctxt "color" 1635 msgid "firebrick" 1636 msgstr "قرمز آجری" 1637 1638 #, kde-format 1639 msgctxt "color" 1640 msgid "firebrick1" 1641 msgstr "قرمز آجری ۱" 1642 1643 #, kde-format 1644 msgctxt "color" 1645 msgid "firebrick2" 1646 msgstr "قرمز آجری ۲" 1647 1648 #, kde-format 1649 msgctxt "color" 1650 msgid "firebrick3" 1651 msgstr "قرمز آجری ۳" 1652 1653 #, kde-format 1654 msgctxt "color" 1655 msgid "firebrick4" 1656 msgstr "قرمز آجری ۴" 1657 1658 #, kde-format 1659 msgctxt "color" 1660 msgid "gainsboro" 1661 msgstr "طوسی" 1662 1663 #, kde-format 1664 msgctxt "color" 1665 msgid "gold" 1666 msgstr "طلایی" 1667 1668 #, kde-format 1669 msgctxt "color" 1670 msgid "gold1" 1671 msgstr "طلایی ۱" 1672 1673 #, kde-format 1674 msgctxt "color" 1675 msgid "gold2" 1676 msgstr "طلایی ۲" 1677 1678 #, kde-format 1679 msgctxt "color" 1680 msgid "gold3" 1681 msgstr "طلایی ۳" 1682 1683 #, kde-format 1684 msgctxt "color" 1685 msgid "gold4" 1686 msgstr "طلایی ۴" 1687 1688 #, kde-format 1689 msgctxt "color" 1690 msgid "goldenrod" 1691 msgstr "خردلی" 1692 1693 #, kde-format 1694 msgctxt "color" 1695 msgid "goldenrod1" 1696 msgstr "خردلی ۱" 1697 1698 #, kde-format 1699 msgctxt "color" 1700 msgid "goldenrod2" 1701 msgstr "خردلی ۲" 1702 1703 #, kde-format 1704 msgctxt "color" 1705 msgid "goldenrod3" 1706 msgstr "خردلی ۳" 1707 1708 #, kde-format 1709 msgctxt "color" 1710 msgid "goldenrod4" 1711 msgstr "خردلی ۴" 1712 1713 #, kde-format 1714 msgctxt "color" 1715 msgid "green" 1716 msgstr "سبز" 1717 1718 #, kde-format 1719 msgctxt "color" 1720 msgid "green1" 1721 msgstr "سبز ۱" 1722 1723 #, kde-format 1724 msgctxt "color" 1725 msgid "green2" 1726 msgstr "سبز ۲" 1727 1728 #, kde-format 1729 msgctxt "color" 1730 msgid "green3" 1731 msgstr "سبز ۳" 1732 1733 #, kde-format 1734 msgctxt "color" 1735 msgid "green4" 1736 msgstr "سبز ۴" 1737 1738 #, kde-format 1739 msgctxt "color" 1740 msgid "honeydew" 1741 msgstr "عسلی" 1742 1743 #, kde-format 1744 msgctxt "color" 1745 msgid "honeydew1" 1746 msgstr "عسلی ۱" 1747 1748 #, kde-format 1749 msgctxt "color" 1750 msgid "honeydew2" 1751 msgstr "عسلی ۲" 1752 1753 #, kde-format 1754 msgctxt "color" 1755 msgid "honeydew3" 1756 msgstr "عسلی ۳" 1757 1758 #, kde-format 1759 msgctxt "color" 1760 msgid "honeydew4" 1761 msgstr "عسلی ۴" 1762 1763 #, kde-format 1764 msgctxt "color" 1765 msgid "ivory" 1766 msgstr "عاجی" 1767 1768 #, kde-format 1769 msgctxt "color" 1770 msgid "ivory1" 1771 msgstr "عاجی ۱" 1772 1773 #, kde-format 1774 msgctxt "color" 1775 msgid "ivory2" 1776 msgstr "عاجی ۲" 1777 1778 #, kde-format 1779 msgctxt "color" 1780 msgid "ivory3" 1781 msgstr "عاجی ۳" 1782 1783 #, kde-format 1784 msgctxt "color" 1785 msgid "ivory4" 1786 msgstr "عاجی ۴" 1787 1788 #, kde-format 1789 msgctxt "color" 1790 msgid "khaki" 1791 msgstr "خاکی" 1792 1793 #, kde-format 1794 msgctxt "color" 1795 msgid "khaki1" 1796 msgstr "خاکی ۱" 1797 1798 #, kde-format 1799 msgctxt "color" 1800 msgid "khaki2" 1801 msgstr "خاکی ۲" 1802 1803 #, kde-format 1804 msgctxt "color" 1805 msgid "khaki3" 1806 msgstr "خاکی ۳" 1807 1808 #, kde-format 1809 msgctxt "color" 1810 msgid "khaki4" 1811 msgstr "خاکی ۴" 1812 1813 #, kde-format 1814 msgctxt "color" 1815 msgid "lavender" 1816 msgstr "بنفش کمرنگ" 1817 1818 #, kde-format 1819 msgctxt "color" 1820 msgid "linen" 1821 msgstr "کتانی" 1822 1823 #, kde-format 1824 msgctxt "color" 1825 msgid "magenta" 1826 msgstr "سرخآبی" 1827 1828 #, kde-format 1829 msgctxt "color" 1830 msgid "magenta1" 1831 msgstr "سرخآبی ۱" 1832 1833 #, kde-format 1834 msgctxt "color" 1835 msgid "magenta2" 1836 msgstr "سرخآبی ۲" 1837 1838 #, kde-format 1839 msgctxt "color" 1840 msgid "magenta3" 1841 msgstr "سرخآبی ۳" 1842 1843 #, kde-format 1844 msgctxt "color" 1845 msgid "magenta4" 1846 msgstr "سرخآبی ۴" 1847 1848 #, kde-format 1849 msgctxt "color" 1850 msgid "maroon" 1851 msgstr "خرمایی" 1852 1853 #, kde-format 1854 msgctxt "color" 1855 msgid "maroon1" 1856 msgstr "خرمایی ۱" 1857 1858 #, kde-format 1859 msgctxt "color" 1860 msgid "maroon2" 1861 msgstr "خرمایی ۲" 1862 1863 #, kde-format 1864 msgctxt "color" 1865 msgid "maroon3" 1866 msgstr "خرمایی ۳" 1867 1868 #, kde-format 1869 msgctxt "color" 1870 msgid "maroon4" 1871 msgstr "خرمایی ۴" 1872 1873 #, kde-format 1874 msgctxt "color" 1875 msgid "moccasin" 1876 msgstr "زرد نارنجی" 1877 1878 #, kde-format 1879 msgctxt "color" 1880 msgid "navy" 1881 msgstr "سرمهای" 1882 1883 #, kde-format 1884 msgctxt "color" 1885 msgid "orange" 1886 msgstr "نارنجی" 1887 1888 #, kde-format 1889 msgctxt "color" 1890 msgid "orange1" 1891 msgstr "نارنجی ۱" 1892 1893 #, kde-format 1894 msgctxt "color" 1895 msgid "orange2" 1896 msgstr "نارنجی ۲" 1897 1898 #, kde-format 1899 msgctxt "color" 1900 msgid "orange3" 1901 msgstr "نارنجی ۳" 1902 1903 #, kde-format 1904 msgctxt "color" 1905 msgid "orange4" 1906 msgstr "نارنجی ۴" 1907 1908 #, kde-format 1909 msgctxt "color" 1910 msgid "orchid" 1911 msgstr "ارغوانی روشن" 1912 1913 #, kde-format 1914 msgctxt "color" 1915 msgid "orchid1" 1916 msgstr "ارغوانی روشن ۱" 1917 1918 #, kde-format 1919 msgctxt "color" 1920 msgid "orchid2" 1921 msgstr "ارغوانی روشن ۲" 1922 1923 #, kde-format 1924 msgctxt "color" 1925 msgid "orchid3" 1926 msgstr "ارغوانی روشن ۳" 1927 1928 #, kde-format 1929 msgctxt "color" 1930 msgid "orchid4" 1931 msgstr "ارغوانی ۴" 1932 1933 #, kde-format 1934 msgctxt "color" 1935 msgid "peru" 1936 msgstr "پِرو" 1937 1938 #, kde-format 1939 msgctxt "color" 1940 msgid "pink" 1941 msgstr "صورتی" 1942 1943 #, kde-format 1944 msgctxt "color" 1945 msgid "pink1" 1946 msgstr "صورتی ۱" 1947 1948 #, kde-format 1949 msgctxt "color" 1950 msgid "pink2" 1951 msgstr "صورتی ۲" 1952 1953 #, kde-format 1954 msgctxt "color" 1955 msgid "pink3" 1956 msgstr "صورتی ۳" 1957 1958 #, kde-format 1959 msgctxt "color" 1960 msgid "pink4" 1961 msgstr "صورتی ۴" 1962 1963 #, kde-format 1964 msgctxt "color" 1965 msgid "plum" 1966 msgstr "آلبالویی" 1967 1968 #, kde-format 1969 msgctxt "color" 1970 msgid "plum1" 1971 msgstr "آلبالویی ۱" 1972 1973 #, kde-format 1974 msgctxt "color" 1975 msgid "plum2" 1976 msgstr "آلبالویی ۲" 1977 1978 #, kde-format 1979 msgctxt "color" 1980 msgid "plum3" 1981 msgstr "آلبالویی ۳" 1982 1983 #, kde-format 1984 msgctxt "color" 1985 msgid "plum4" 1986 msgstr "آلبالویی ۴" 1987 1988 #, kde-format 1989 msgctxt "color" 1990 msgid "purple" 1991 msgstr "بنفش" 1992 1993 #, kde-format 1994 msgctxt "color" 1995 msgid "purple1" 1996 msgstr "بنفش ۱" 1997 1998 #, kde-format 1999 msgctxt "color" 2000 msgid "purple2" 2001 msgstr "بنفش ۲" 2002 2003 #, kde-format 2004 msgctxt "color" 2005 msgid "purple3" 2006 msgstr "بنفش ۳" 2007 2008 #, kde-format 2009 msgctxt "color" 2010 msgid "purple4" 2011 msgstr "بنفش ۴" 2012 2013 #, fuzzy, kde-format 2014 msgctxt "color" 2015 msgid "red" 2016 msgstr "چهارشنبه" 2017 2018 #, kde-format 2019 msgctxt "color" 2020 msgid "red1" 2021 msgstr "قرمز ۱" 2022 2023 #, kde-format 2024 msgctxt "color" 2025 msgid "red2" 2026 msgstr "قرمز ۲" 2027 2028 #, kde-format 2029 msgctxt "color" 2030 msgid "red3" 2031 msgstr "قرمز ۳" 2032 2033 #, kde-format 2034 msgctxt "color" 2035 msgid "red4" 2036 msgstr "قرمز ۴" 2037 2038 #, kde-format 2039 msgctxt "color" 2040 msgid "salmon" 2041 msgstr "گلبهی" 2042 2043 #, kde-format 2044 msgctxt "color" 2045 msgid "salmon1" 2046 msgstr "گلبهی ۱" 2047 2048 #, kde-format 2049 msgctxt "color" 2050 msgid "salmon2" 2051 msgstr "گلبهی ۲" 2052 2053 #, kde-format 2054 msgctxt "color" 2055 msgid "salmon3" 2056 msgstr "گلبهی ۳" 2057 2058 #, kde-format 2059 msgctxt "color" 2060 msgid "salmon4" 2061 msgstr "گلبهی ۴" 2062 2063 #, kde-format 2064 msgctxt "color" 2065 msgid "seashell" 2066 msgstr "صدفی" 2067 2068 #, kde-format 2069 msgctxt "color" 2070 msgid "seashell1" 2071 msgstr "صدفی ۱" 2072 2073 #, kde-format 2074 msgctxt "color" 2075 msgid "seashell2" 2076 msgstr "صدفی ۲" 2077 2078 #, kde-format 2079 msgctxt "color" 2080 msgid "seashell3" 2081 msgstr "صدفی ۳" 2082 2083 #, kde-format 2084 msgctxt "color" 2085 msgid "seashell4" 2086 msgstr "صدفی ۴" 2087 2088 #, kde-format 2089 msgctxt "color" 2090 msgid "sienna" 2091 msgstr "قهوهاي مايل به زرد" 2092 2093 #, kde-format 2094 msgctxt "color" 2095 msgid "sienna1" 2096 msgstr "قهوهاي مايل به زرد ۱" 2097 2098 #, kde-format 2099 msgctxt "color" 2100 msgid "sienna2" 2101 msgstr "قهوهاي مايل به زرد ۲" 2102 2103 #, kde-format 2104 msgctxt "color" 2105 msgid "sienna3" 2106 msgstr "قهوهاي مايل به زرد ۳" 2107 2108 #, kde-format 2109 msgctxt "color" 2110 msgid "sienna4" 2111 msgstr "قهوهاي مايل به زرد ۴" 2112 2113 #, kde-format 2114 msgctxt "color" 2115 msgid "snow" 2116 msgstr "برفی" 2117 2118 #, kde-format 2119 msgctxt "color" 2120 msgid "snow1" 2121 msgstr "برفی ۱" 2122 2123 #, kde-format 2124 msgctxt "color" 2125 msgid "snow2" 2126 msgstr "برفی ۲" 2127 2128 #, kde-format 2129 msgctxt "color" 2130 msgid "snow3" 2131 msgstr "برفی ۳" 2132 2133 #, kde-format 2134 msgctxt "color" 2135 msgid "snow4" 2136 msgstr "برفی ۴" 2137 2138 #, fuzzy, kde-format 2139 msgctxt "color" 2140 msgid "tan" 2141 msgstr "ژانویه" 2142 2143 #, kde-format 2144 msgctxt "color" 2145 msgid "tan1" 2146 msgstr "برنزه ۱" 2147 2148 #, kde-format 2149 msgctxt "color" 2150 msgid "tan2" 2151 msgstr "برنزه ۲" 2152 2153 #, kde-format 2154 msgctxt "color" 2155 msgid "tan3" 2156 msgstr "برنزه ۳" 2157 2158 #, kde-format 2159 msgctxt "color" 2160 msgid "tan4" 2161 msgstr "برنزه ۴" 2162 2163 #, kde-format 2164 msgctxt "color" 2165 msgid "thistle" 2166 msgstr "یاسی" 2167 2168 #, kde-format 2169 msgctxt "color" 2170 msgid "thistle1" 2171 msgstr "یاسی ۱" 2172 2173 #, kde-format 2174 msgctxt "color" 2175 msgid "thistle2" 2176 msgstr "یاسی ۲" 2177 2178 #, kde-format 2179 msgctxt "color" 2180 msgid "thistle3" 2181 msgstr "یاسی ۳" 2182 2183 #, kde-format 2184 msgctxt "color" 2185 msgid "thistle4" 2186 msgstr "یاسی ۴" 2187 2188 #, kde-format 2189 msgctxt "color" 2190 msgid "tomato" 2191 msgstr "گوجهای" 2192 2193 #, kde-format 2194 msgctxt "color" 2195 msgid "tomato1" 2196 msgstr "گوجهای ۱" 2197 2198 #, kde-format 2199 msgctxt "color" 2200 msgid "tomato2" 2201 msgstr "گوجهای ۲" 2202 2203 #, kde-format 2204 msgctxt "color" 2205 msgid "tomato3" 2206 msgstr "گوجهای ۳" 2207 2208 #, kde-format 2209 msgctxt "color" 2210 msgid "tomato4" 2211 msgstr "گوجهای ۴" 2212 2213 #, kde-format 2214 msgctxt "color" 2215 msgid "turquoise" 2216 msgstr "فیروزهای" 2217 2218 #, kde-format 2219 msgctxt "color" 2220 msgid "turquoise1" 2221 msgstr "فیروزهای ۱" 2222 2223 #, kde-format 2224 msgctxt "color" 2225 msgid "turquoise2" 2226 msgstr "فیروزهای ۲" 2227 2228 #, kde-format 2229 msgctxt "color" 2230 msgid "turquoise3" 2231 msgstr "فیروزهای ۳" 2232 2233 #, kde-format 2234 msgctxt "color" 2235 msgid "turquoise4" 2236 msgstr "فیروزهای ۴" 2237 2238 #, kde-format 2239 msgctxt "color" 2240 msgid "violet" 2241 msgstr "بنفش" 2242 2243 #, kde-format 2244 msgctxt "color" 2245 msgid "wheat" 2246 msgstr "گندمی" 2247 2248 #, kde-format 2249 msgctxt "color" 2250 msgid "wheat1" 2251 msgstr "گندمی ۱" 2252 2253 #, kde-format 2254 msgctxt "color" 2255 msgid "wheat2" 2256 msgstr "گندمی ۲" 2257 2258 #, kde-format 2259 msgctxt "color" 2260 msgid "wheat3" 2261 msgstr "گندمی ۳" 2262 2263 #, kde-format 2264 msgctxt "color" 2265 msgid "wheat4" 2266 msgstr "گندمی ۴" 2267 2268 #, kde-format 2269 msgctxt "color" 2270 msgid "white" 2271 msgstr "سفید" 2272 2273 #, kde-format 2274 msgctxt "color" 2275 msgid "yellow" 2276 msgstr "زرد" 2277 2278 #, kde-format 2279 msgctxt "color" 2280 msgid "yellow1" 2281 msgstr "زرد ۱" 2282 2283 #, kde-format 2284 msgctxt "color" 2285 msgid "yellow2" 2286 msgstr "زرد ۲" 2287 2288 #, kde-format 2289 msgctxt "color" 2290 msgid "yellow3" 2291 msgstr "زرد ۳" 2292 2293 #, kde-format 2294 msgctxt "color" 2295 msgid "yellow4" 2296 msgstr "زرد ۴" 2297 2298 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2299 #, kde-format 2300 msgid "Debug Settings" 2301 msgstr "تنظیمات اشکالزدا" 2302 2303 #: kdebugdialog/kdebugdialog.cpp:59 2304 #, kde-format 2305 msgid "File" 2306 msgstr "پرونده" 2307 2308 #: kdebugdialog/kdebugdialog.cpp:60 2309 #, kde-format 2310 msgid "Message Box" 2311 msgstr "جعبه پیام" 2312 2313 #: kdebugdialog/kdebugdialog.cpp:61 2314 #, kde-format 2315 msgid "Shell" 2316 msgstr "پوسته" 2317 2318 #: kdebugdialog/kdebugdialog.cpp:62 2319 #, kde-format 2320 msgid "Syslog" 2321 msgstr "Syslog" 2322 2323 #: kdebugdialog/kdebugdialog.cpp:63 2324 #, kde-format 2325 msgid "None" 2326 msgstr "هیچکدام" 2327 2328 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2329 #: kdebugdialog/kdebugdialog.ui:48 2330 #, kde-format 2331 msgid "Information" 2332 msgstr "اطلاعات" 2333 2334 #. i18n: ectx: property (text), widget (QLabel, label_2) 2335 #. i18n: ectx: property (text), widget (QLabel, label_8) 2336 #. i18n: ectx: property (text), widget (QLabel, label_4) 2337 #. i18n: ectx: property (text), widget (QLabel, label_6) 2338 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2339 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2340 #, kde-format 2341 msgid "Output to:" 2342 msgstr "خروجی به:" 2343 2344 #. i18n: ectx: property (text), widget (QLabel, label_3) 2345 #. i18n: ectx: property (text), widget (QLabel, label_9) 2346 #. i18n: ectx: property (text), widget (QLabel, label_5) 2347 #. i18n: ectx: property (text), widget (QLabel, label_7) 2348 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2349 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2350 #, kde-format 2351 msgid "Filename:" 2352 msgstr "نام پرونده:" 2353 2354 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2355 #: kdebugdialog/kdebugdialog.ui:83 2356 #, kde-format 2357 msgid "Error" 2358 msgstr "خطا" 2359 2360 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2361 #: kdebugdialog/kdebugdialog.ui:118 2362 #, kde-format 2363 msgid "Abort on fatal errors" 2364 msgstr "ساقط شدن هنگام خطاهای مهلک" 2365 2366 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2367 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2368 #, kde-format 2369 msgid "Disable all debug output" 2370 msgstr "غیرفعال سازی همه خروجیهای اشکال زدایی" 2371 2372 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2373 #: kdebugdialog/kdebugdialog.ui:145 2374 #, kde-format 2375 msgid "Warning" 2376 msgstr "اخطار" 2377 2378 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2379 #: kdebugdialog/kdebugdialog.ui:180 2380 #, kde-format 2381 msgid "Fatal Error" 2382 msgstr "خطای مهلک" 2383 2384 #: kdebugdialog/klistdebugdialog.cpp:69 2385 #, kde-format 2386 msgid "&Select All" 2387 msgstr "&برگزیدن همه" 2388 2389 #: kdebugdialog/klistdebugdialog.cpp:70 2390 #, kde-format 2391 msgid "&Deselect All" 2392 msgstr "&از گزینش خارج کردن همه" 2393 2394 #: kdebugdialog/main.cpp:100 2395 #, kde-format 2396 msgid "KDebugDialog" 2397 msgstr "KDebugDialog" 2398 2399 #: kdebugdialog/main.cpp:101 2400 #, kde-format 2401 msgid "A dialog box for setting preferences for debug output" 2402 msgstr "یک جعبه محاوره برای تنظیم تنظیمات برای خروجی اشکالزدا" 2403 2404 #: kdebugdialog/main.cpp:102 2405 #, fuzzy, kde-format 2406 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2407 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2408 msgstr "حق نشر ۲۰۰۰-۱۹۹۹، David Faure<email>faure@kde.org</email>" 2409 2410 #: kdebugdialog/main.cpp:103 2411 #, kde-format 2412 msgid "David Faure" 2413 msgstr "David Faure" 2414 2415 #: kdebugdialog/main.cpp:103 2416 #, kde-format 2417 msgid "Maintainer" 2418 msgstr "نگهدارنده" 2419 2420 #: kdebugdialog/main.cpp:108 2421 #, kde-format 2422 msgid "Show the fully-fledged dialog instead of the default list dialog" 2423 msgstr "نمایش محاوره کاملاً محوشده، به جای محاوره فهرست پیشفرض" 2424 2425 #: kdebugdialog/main.cpp:109 2426 #, kde-format 2427 msgid "Turn area on" 2428 msgstr "ناحیه روشن" 2429 2430 #: kdebugdialog/main.cpp:110 2431 #, kde-format 2432 msgid "Turn area off" 2433 msgstr "ناحیه خاموش" 2434 2435 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2436 #, kde-format 2437 msgid "no error" 2438 msgstr "بدون خطا" 2439 2440 #: kdecore/k3resolver.cpp:534 2441 #, kde-format 2442 msgid "requested family not supported for this host name" 2443 msgstr "خانواده درخواستشده برای این نام میزبان پشتیبانی نمیشود" 2444 2445 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2446 #, kde-format 2447 msgid "temporary failure in name resolution" 2448 msgstr "خرابی موقت در دقت نام" 2449 2450 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2451 #, kde-format 2452 msgid "non-recoverable failure in name resolution" 2453 msgstr "خرابی غیرقابل بازیافت در دقت نام" 2454 2455 #: kdecore/k3resolver.cpp:537 2456 #, kde-format 2457 msgid "invalid flags" 2458 msgstr "پرچمهای نامعتبر" 2459 2460 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2461 #, kde-format 2462 msgid "memory allocation failure" 2463 msgstr "خرابی تخصیص حافظه" 2464 2465 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2466 #, kde-format 2467 msgid "name or service not known" 2468 msgstr "نام یا خدمت ناشناخته است" 2469 2470 #: kdecore/k3resolver.cpp:540 2471 #, kde-format 2472 msgid "requested family not supported" 2473 msgstr "خانواده درخواستشده پشتیبانی نمیشود" 2474 2475 #: kdecore/k3resolver.cpp:541 2476 #, kde-format 2477 msgid "requested service not supported for this socket type" 2478 msgstr "خدمت درخواستشده برای این نوع سوکت پشتیبانی نمیشود" 2479 2480 #: kdecore/k3resolver.cpp:542 2481 #, kde-format 2482 msgid "requested socket type not supported" 2483 msgstr "نوع سوکت درخواستشده پشتیبانی نمیشود" 2484 2485 #: kdecore/k3resolver.cpp:543 2486 #, kde-format 2487 msgid "unknown error" 2488 msgstr "خطای ناشناخته" 2489 2490 #: kdecore/k3resolver.cpp:545 2491 #, kde-format 2492 msgctxt "1: the i18n'ed system error code, from errno" 2493 msgid "system error: %1" 2494 msgstr "خطای سیستم: %1" 2495 2496 #: kdecore/k3resolver.cpp:556 2497 #, kde-format 2498 msgid "request was canceled" 2499 msgstr "درخواست لغو شد" 2500 2501 #: kdecore/k3socketaddress.cpp:631 2502 #, kde-format 2503 msgctxt "1: the unknown socket address family number" 2504 msgid "Unknown family %1" 2505 msgstr "خانواده ناشناخته %1" 2506 2507 #: kdecore/k3socketbase.cpp:215 2508 #, kde-format 2509 msgctxt "Socket error code NoError" 2510 msgid "no error" 2511 msgstr "بدون خطا" 2512 2513 #: kdecore/k3socketbase.cpp:220 2514 #, kde-format 2515 msgctxt "Socket error code LookupFailure" 2516 msgid "name lookup has failed" 2517 msgstr "مراجعه به نام خراب شده است" 2518 2519 #: kdecore/k3socketbase.cpp:225 2520 #, kde-format 2521 msgctxt "Socket error code AddressInUse" 2522 msgid "address already in use" 2523 msgstr "نشانی از قبل در حال استفاده است" 2524 2525 #: kdecore/k3socketbase.cpp:230 2526 #, kde-format 2527 msgctxt "Socket error code AlreadyBound" 2528 msgid "socket is already bound" 2529 msgstr "در حال حاضر، سوکت مقید است" 2530 2531 #: kdecore/k3socketbase.cpp:235 2532 #, kde-format 2533 msgctxt "Socket error code AlreadyCreated" 2534 msgid "socket is already created" 2535 msgstr "در حال حاضر، سوکت ایجاد میشود" 2536 2537 #: kdecore/k3socketbase.cpp:240 2538 #, kde-format 2539 msgctxt "Socket error code NotBound" 2540 msgid "socket is not bound" 2541 msgstr "سوکت مقید نیست" 2542 2543 #: kdecore/k3socketbase.cpp:245 2544 #, kde-format 2545 msgctxt "Socket error code NotCreated" 2546 msgid "socket has not been created" 2547 msgstr "سوکت ایجاد نشده است" 2548 2549 #: kdecore/k3socketbase.cpp:250 2550 #, kde-format 2551 msgctxt "Socket error code WouldBlock" 2552 msgid "operation would block" 2553 msgstr "عملیات بلوک میشود" 2554 2555 #: kdecore/k3socketbase.cpp:255 2556 #, kde-format 2557 msgctxt "Socket error code ConnectionRefused" 2558 msgid "connection actively refused" 2559 msgstr "اتصال به طور فعال رد شد" 2560 2561 #: kdecore/k3socketbase.cpp:260 2562 #, kde-format 2563 msgctxt "Socket error code ConnectionTimedOut" 2564 msgid "connection timed out" 2565 msgstr "اتمام وقت اتصال" 2566 2567 #: kdecore/k3socketbase.cpp:265 2568 #, kde-format 2569 msgctxt "Socket error code InProgress" 2570 msgid "operation is already in progress" 2571 msgstr "عملیات هنوز در حال اجرا است" 2572 2573 #: kdecore/k3socketbase.cpp:270 2574 #, kde-format 2575 msgctxt "Socket error code NetFailure" 2576 msgid "network failure occurred" 2577 msgstr "خرابی در شبکه رخ داد" 2578 2579 #: kdecore/k3socketbase.cpp:275 2580 #, kde-format 2581 msgctxt "Socket error code NotSupported" 2582 msgid "operation is not supported" 2583 msgstr "عملیات پشتیبانی نمیشود" 2584 2585 #: kdecore/k3socketbase.cpp:280 2586 #, kde-format 2587 msgctxt "Socket error code Timeout" 2588 msgid "timed operation timed out" 2589 msgstr "اتمام عملیات زمانبندی شد" 2590 2591 #: kdecore/k3socketbase.cpp:285 2592 #, kde-format 2593 msgctxt "Socket error code UnknownError" 2594 msgid "an unknown/unexpected error has happened" 2595 msgstr "یک خطای ناشناخته/غیرمنتظره رخ داده است" 2596 2597 #: kdecore/k3socketbase.cpp:290 2598 #, kde-format 2599 msgctxt "Socket error code RemotelyDisconnected" 2600 msgid "remote host closed connection" 2601 msgstr "میزبان راه دور اتصال را بست" 2602 2603 #: kdecore/k4aboutdata.cpp:267 2604 #, kde-format 2605 msgid "" 2606 "No licensing terms for this program have been specified.\n" 2607 "Please check the documentation or the source for any\n" 2608 "licensing terms.\n" 2609 msgstr "" 2610 2611 #: kdecore/k4aboutdata.cpp:273 2612 #, kde-format 2613 msgid "This program is distributed under the terms of the %1." 2614 msgstr "" 2615 2616 # GPL 2617 #: kdecore/k4aboutdata.cpp:297 2618 #, kde-format 2619 msgctxt "@item license (short name)" 2620 msgid "GPL v2" 2621 msgstr "GPL v2" 2622 2623 # GNU General Public License Version 2 2624 #: kdecore/k4aboutdata.cpp:298 2625 #, kde-format 2626 msgctxt "@item license" 2627 msgid "GNU General Public License Version 2" 2628 msgstr "مجوز عمومی GNU نسخهٔ ۲" 2629 2630 # LGPL 2631 #: kdecore/k4aboutdata.cpp:301 2632 #, kde-format 2633 msgctxt "@item license (short name)" 2634 msgid "LGPL v2" 2635 msgstr "LGPL v2" 2636 2637 #: kdecore/k4aboutdata.cpp:302 2638 #, kde-format 2639 msgctxt "@item license" 2640 msgid "GNU Lesser General Public License Version 2" 2641 msgstr "GNU مجوز کمتر عمومی گنو نسخه ۲" 2642 2643 # BSD License 2644 #: kdecore/k4aboutdata.cpp:305 2645 #, kde-format 2646 msgctxt "@item license (short name)" 2647 msgid "BSD License" 2648 msgstr "مجوز BSD" 2649 2650 # BSD License 2651 #: kdecore/k4aboutdata.cpp:306 2652 #, kde-format 2653 msgctxt "@item license" 2654 msgid "BSD License" 2655 msgstr "مجوز BSD" 2656 2657 # Artistic License 2658 #: kdecore/k4aboutdata.cpp:309 2659 #, kde-format 2660 msgctxt "@item license (short name)" 2661 msgid "Artistic License" 2662 msgstr "مجوز هنری" 2663 2664 # Artistic License 2665 #: kdecore/k4aboutdata.cpp:310 2666 #, kde-format 2667 msgctxt "@item license" 2668 msgid "Artistic License" 2669 msgstr "مجوز Artistic" 2670 2671 #: kdecore/k4aboutdata.cpp:313 2672 #, kde-format 2673 msgctxt "@item license (short name)" 2674 msgid "QPL v1.0" 2675 msgstr "QPL نسخه۱.۰" 2676 2677 # Q Public License 2678 #: kdecore/k4aboutdata.cpp:314 2679 #, kde-format 2680 msgctxt "@item license" 2681 msgid "Q Public License" 2682 msgstr "مجوز عمومی Q" 2683 2684 # GPL 2685 #: kdecore/k4aboutdata.cpp:317 2686 #, kde-format 2687 msgctxt "@item license (short name)" 2688 msgid "GPL v3" 2689 msgstr "GPL v3" 2690 2691 #: kdecore/k4aboutdata.cpp:318 2692 #, kde-format 2693 msgctxt "@item license" 2694 msgid "GNU General Public License Version 3" 2695 msgstr "GNU مجوز عمومی گنو نسخه ۳" 2696 2697 # LGPL 2698 #: kdecore/k4aboutdata.cpp:321 2699 #, kde-format 2700 msgctxt "@item license (short name)" 2701 msgid "LGPL v3" 2702 msgstr "LGPL v3" 2703 2704 #: kdecore/k4aboutdata.cpp:322 2705 #, kde-format 2706 msgctxt "@item license" 2707 msgid "GNU Lesser General Public License Version 3" 2708 msgstr "GNU مجوز کمتر عمومی گنو نسخه ۳" 2709 2710 # Custom 2711 #: kdecore/k4aboutdata.cpp:326 2712 #, kde-format 2713 msgctxt "@item license" 2714 msgid "Custom" 2715 msgstr "سفارشی" 2716 2717 # Not specified 2718 #: kdecore/k4aboutdata.cpp:329 2719 #, kde-format 2720 msgctxt "@item license" 2721 msgid "Not specified" 2722 msgstr "نامعین" 2723 2724 #: kdecore/k4aboutdata.cpp:891 2725 #, kde-format 2726 msgctxt "replace this with information about your translation team" 2727 msgid "" 2728 "<p>KDE is translated into many languages thanks to the work of the " 2729 "translation teams all over the world.</p><p>For more information on KDE " 2730 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2731 "org</a></p>" 2732 msgstr "" 2733 "<p>کیدیای به لطف همکاری تیمهای بومیسازی در تمام دنیا ترجمه و بومیسازی میشود." 2734 "</p><p>برای اطلاعات بیشتر در مورد بینالمللی سازی <a href=\"http://l10n.kde." 2735 "org\">http://l10n.kde.org</a> راببینید.</p><p> تیم فارسیسازی کیدیای هم همگام " 2736 "با دیگر تیمها و به صورت کاملا داوطلبانه به بومیسازی و ترجمه این محیط " 2737 "میپردازد. شما هم میتوانید به این تیم بپیوندید. صفحه رسمی تیم را ببینید: <a " 2738 "href=\"http://l10n.kde.org/team-infos.php?teamcode=fa\">http://l10n.kde.org/" 2739 "teaminfos.php?teamcode=fa</a></p><p> با وجود دقت زیاد در بررسی ترجمهها، آنها " 2740 "ممکن است با کمبودهایی همراه باشند. در صورت وجود اشکال در ترجمهها یا برای " 2741 "پیشنهادات و یا اطلاعات بیشتر با آدرس mohi@linuxshop.ir<email>mohi@linuxshop." 2742 "ir</email> تماس بگیرید.</p>" 2743 2744 #: kdecore/kcalendarsystem.cpp:108 2745 #, kde-format 2746 msgctxt "@item Calendar system" 2747 msgid "Gregorian" 2748 msgstr "گریگوری" 2749 2750 #: kdecore/kcalendarsystem.cpp:110 2751 #, fuzzy, kde-format 2752 msgctxt "@item Calendar system" 2753 msgid "Coptic" 2754 msgstr "قبطی" 2755 2756 #: kdecore/kcalendarsystem.cpp:112 2757 #, fuzzy, kde-format 2758 msgctxt "@item Calendar system" 2759 msgid "Ethiopian" 2760 msgstr "اتیوپیایی" 2761 2762 #: kdecore/kcalendarsystem.cpp:114 2763 #, kde-format 2764 msgctxt "@item Calendar system" 2765 msgid "Hebrew" 2766 msgstr "عبری" 2767 2768 #: kdecore/kcalendarsystem.cpp:116 2769 #, kde-format 2770 msgctxt "@item Calendar system" 2771 msgid "Islamic / Hijri (Civil)" 2772 msgstr "" 2773 2774 #: kdecore/kcalendarsystem.cpp:118 2775 #, kde-format 2776 msgctxt "@item Calendar system" 2777 msgid "Indian National" 2778 msgstr "" 2779 2780 #: kdecore/kcalendarsystem.cpp:120 2781 #, kde-format 2782 msgctxt "@item Calendar system" 2783 msgid "Jalali" 2784 msgstr "جلالی" 2785 2786 #: kdecore/kcalendarsystem.cpp:122 2787 #, kde-format 2788 msgctxt "@item Calendar system" 2789 msgid "Japanese" 2790 msgstr "" 2791 2792 #: kdecore/kcalendarsystem.cpp:124 2793 #, fuzzy, kde-format 2794 msgctxt "@item Calendar system" 2795 msgid "Julian" 2796 msgstr "ژانویه" 2797 2798 #: kdecore/kcalendarsystem.cpp:126 2799 #, kde-format 2800 msgctxt "@item Calendar system" 2801 msgid "Taiwanese" 2802 msgstr "" 2803 2804 #: kdecore/kcalendarsystem.cpp:128 2805 #, fuzzy, kde-format 2806 #| msgid "R. Thaani" 2807 msgctxt "@item Calendar system" 2808 msgid "Thai" 2809 msgstr "ربیعالثانی" 2810 2811 #: kdecore/kcalendarsystem.cpp:131 2812 #, kde-format 2813 msgctxt "@item Calendar system" 2814 msgid "Invalid Calendar Type" 2815 msgstr "نوع تقویم نامعتبر" 2816 2817 #: kdecore/kcalendarsystem.cpp:1495 2818 #, kde-format 2819 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2820 msgid "-" 2821 msgstr "" 2822 2823 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2824 #: kio/kfilemetadataprovider.cpp:199 2825 #, kde-format 2826 msgid "Today" 2827 msgstr "امروز" 2828 2829 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2830 #: kio/kfilemetadataprovider.cpp:202 2831 #, kde-format 2832 msgid "Yesterday" 2833 msgstr "دیروز" 2834 2835 #: kdecore/kcalendarsystemcoptic.cpp:45 2836 #, kde-format 2837 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2838 msgid "Anno Martyrum" 2839 msgstr "" 2840 2841 #: kdecore/kcalendarsystemcoptic.cpp:46 2842 #, kde-format 2843 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2844 msgid "AM" 2845 msgstr "" 2846 2847 #: kdecore/kcalendarsystemcoptic.cpp:47 2848 #, kde-format 2849 msgctxt "" 2850 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2851 msgid "%Ey %EC" 2852 msgstr "" 2853 2854 #: kdecore/kcalendarsystemcoptic.cpp:153 2855 #, kde-format 2856 msgctxt "Coptic month 1 - KLocale::NarrowName" 2857 msgid "T" 2858 msgstr "" 2859 2860 #: kdecore/kcalendarsystemcoptic.cpp:155 2861 #, kde-format 2862 msgctxt "Coptic month 2 - KLocale::NarrowName" 2863 msgid "P" 2864 msgstr "" 2865 2866 #: kdecore/kcalendarsystemcoptic.cpp:157 2867 #, kde-format 2868 msgctxt "Coptic month 3 - KLocale::NarrowName" 2869 msgid "H" 2870 msgstr "" 2871 2872 #: kdecore/kcalendarsystemcoptic.cpp:159 2873 #, kde-format 2874 msgctxt "Coptic month 4 - KLocale::NarrowName" 2875 msgid "K" 2876 msgstr "" 2877 2878 #: kdecore/kcalendarsystemcoptic.cpp:161 2879 #, kde-format 2880 msgctxt "Coptic month 5 - KLocale::NarrowName" 2881 msgid "T" 2882 msgstr "" 2883 2884 #: kdecore/kcalendarsystemcoptic.cpp:163 2885 #, kde-format 2886 msgctxt "Coptic month 6 - KLocale::NarrowName" 2887 msgid "M" 2888 msgstr "" 2889 2890 #: kdecore/kcalendarsystemcoptic.cpp:165 2891 #, kde-format 2892 msgctxt "Coptic month 7 - KLocale::NarrowName" 2893 msgid "P" 2894 msgstr "" 2895 2896 #: kdecore/kcalendarsystemcoptic.cpp:167 2897 #, kde-format 2898 msgctxt "Coptic month 8 - KLocale::NarrowName" 2899 msgid "P" 2900 msgstr "" 2901 2902 #: kdecore/kcalendarsystemcoptic.cpp:169 2903 #, kde-format 2904 msgctxt "Coptic month 9 - KLocale::NarrowName" 2905 msgid "P" 2906 msgstr "" 2907 2908 #: kdecore/kcalendarsystemcoptic.cpp:171 2909 #, kde-format 2910 msgctxt "Coptic month 10 - KLocale::NarrowName" 2911 msgid "P" 2912 msgstr "" 2913 2914 #: kdecore/kcalendarsystemcoptic.cpp:173 2915 #, kde-format 2916 msgctxt "Coptic month 11 - KLocale::NarrowName" 2917 msgid "E" 2918 msgstr "" 2919 2920 #: kdecore/kcalendarsystemcoptic.cpp:175 2921 #, kde-format 2922 msgctxt "Coptic month 12 - KLocale::NarrowName" 2923 msgid "M" 2924 msgstr "" 2925 2926 #: kdecore/kcalendarsystemcoptic.cpp:177 2927 #, kde-format 2928 msgctxt "Coptic month 13 - KLocale::NarrowName" 2929 msgid "K" 2930 msgstr "" 2931 2932 #: kdecore/kcalendarsystemcoptic.cpp:186 2933 #, fuzzy, kde-format 2934 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2935 msgid "of Tho" 2936 msgstr "خرداد" 2937 2938 #: kdecore/kcalendarsystemcoptic.cpp:188 2939 #, fuzzy, kde-format 2940 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2941 msgid "of Pao" 2942 msgstr "تاموز" 2943 2944 #: kdecore/kcalendarsystemcoptic.cpp:190 2945 #, fuzzy, kde-format 2946 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2947 msgid "of Hat" 2948 msgstr "شوات" 2949 2950 #: kdecore/kcalendarsystemcoptic.cpp:192 2951 #, fuzzy, kde-format 2952 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2953 msgid "of Kia" 2954 msgstr "نیسان" 2955 2956 #: kdecore/kcalendarsystemcoptic.cpp:194 2957 #, fuzzy, kde-format 2958 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2959 msgid "of Tob" 2960 msgstr "فوریه" 2961 2962 #: kdecore/kcalendarsystemcoptic.cpp:196 2963 #, fuzzy, kde-format 2964 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2965 msgid "of Mes" 2966 msgstr "مهر" 2967 2968 #: kdecore/kcalendarsystemcoptic.cpp:198 2969 #, fuzzy, kde-format 2970 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2971 msgid "of Par" 2972 msgstr "مارس" 2973 2974 #: kdecore/kcalendarsystemcoptic.cpp:200 2975 #, fuzzy, kde-format 2976 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2977 msgid "of Pam" 2978 msgstr "تاموز" 2979 2980 #: kdecore/kcalendarsystemcoptic.cpp:202 2981 #, fuzzy, kde-format 2982 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2983 msgid "of Pas" 2984 msgstr "بهمن" 2985 2986 #: kdecore/kcalendarsystemcoptic.cpp:204 2987 #, fuzzy, kde-format 2988 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2989 msgid "of Pan" 2990 msgstr "ژانویه" 2991 2992 #: kdecore/kcalendarsystemcoptic.cpp:206 2993 #, fuzzy, kde-format 2994 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2995 msgid "of Epe" 2996 msgstr "فوریه" 2997 2998 #: kdecore/kcalendarsystemcoptic.cpp:208 2999 #, fuzzy, kde-format 3000 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 3001 msgid "of Meo" 3002 msgstr "مرداد" 3003 3004 #: kdecore/kcalendarsystemcoptic.cpp:210 3005 #, fuzzy, kde-format 3006 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 3007 msgid "of Kou" 3008 msgstr "خرداد" 3009 3010 #: kdecore/kcalendarsystemcoptic.cpp:219 3011 #, fuzzy, kde-format 3012 msgctxt "Coptic month 1 - KLocale::ShortName" 3013 msgid "Tho" 3014 msgstr "سهشنبه" 3015 3016 #: kdecore/kcalendarsystemcoptic.cpp:221 3017 #, fuzzy, kde-format 3018 msgctxt "Coptic month 2 - KLocale::ShortName" 3019 msgid "Pao" 3020 msgstr "مکث" 3021 3022 #: kdecore/kcalendarsystemcoptic.cpp:223 3023 #, fuzzy, kde-format 3024 msgctxt "Coptic month 3 - KLocale::ShortName" 3025 msgid "Hat" 3026 msgstr "شنبه" 3027 3028 #: kdecore/kcalendarsystemcoptic.cpp:225 3029 #, fuzzy, kde-format 3030 msgctxt "Coptic month 4 - KLocale::ShortName" 3031 msgid "Kia" 3032 msgstr "پنجشنبه" 3033 3034 #: kdecore/kcalendarsystemcoptic.cpp:227 3035 #, fuzzy, kde-format 3036 msgctxt "Coptic month 5 - KLocale::ShortName" 3037 msgid "Tob" 3038 msgstr "کار" 3039 3040 #: kdecore/kcalendarsystemcoptic.cpp:229 3041 #, fuzzy, kde-format 3042 msgctxt "Coptic month 6 - KLocale::ShortName" 3043 msgid "Mes" 3044 msgstr "بله" 3045 3046 #: kdecore/kcalendarsystemcoptic.cpp:231 3047 #, fuzzy, kde-format 3048 msgctxt "Coptic month 7 - KLocale::ShortName" 3049 msgid "Par" 3050 msgstr "مارس" 3051 3052 #: kdecore/kcalendarsystemcoptic.cpp:233 3053 #, fuzzy, kde-format 3054 msgctxt "Coptic month 8 - KLocale::ShortName" 3055 msgid "Pam" 3056 msgstr "قبل از ظهر" 3057 3058 #: kdecore/kcalendarsystemcoptic.cpp:235 3059 #, fuzzy, kde-format 3060 msgctxt "Coptic month 9 - KLocale::ShortName" 3061 msgid "Pas" 3062 msgstr "صفحات" 3063 3064 #: kdecore/kcalendarsystemcoptic.cpp:237 3065 #, fuzzy, kde-format 3066 msgctxt "Coptic month 10 - KLocale::ShortName" 3067 msgid "Pan" 3068 msgstr "ژانویه" 3069 3070 #: kdecore/kcalendarsystemcoptic.cpp:239 3071 #, fuzzy, kde-format 3072 msgctxt "Coptic month 11 - KLocale::ShortName" 3073 msgid "Epe" 3074 msgstr "گریز" 3075 3076 #: kdecore/kcalendarsystemcoptic.cpp:241 3077 #, fuzzy, kde-format 3078 msgctxt "Coptic month 12 - KLocale::ShortName" 3079 msgid "Meo" 3080 msgstr "دوشنبه" 3081 3082 #: kdecore/kcalendarsystemcoptic.cpp:243 3083 #, fuzzy, kde-format 3084 msgctxt "Coptic month 12 - KLocale::ShortName" 3085 msgid "Kou" 3086 msgstr "خرداد" 3087 3088 #: kdecore/kcalendarsystemcoptic.cpp:252 3089 #, fuzzy, kde-format 3090 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3091 msgid "of Thoout" 3092 msgstr "خرداد" 3093 3094 #: kdecore/kcalendarsystemcoptic.cpp:254 3095 #, fuzzy, kde-format 3096 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3097 msgid "of Paope" 3098 msgstr "تاموز" 3099 3100 #: kdecore/kcalendarsystemcoptic.cpp:256 3101 #, fuzzy, kde-format 3102 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3103 msgid "of Hathor" 3104 msgstr " ذیالحجه" 3105 3106 #: kdecore/kcalendarsystemcoptic.cpp:258 3107 #, fuzzy, kde-format 3108 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3109 msgid "of Kiahk" 3110 msgstr "خرداد" 3111 3112 #: kdecore/kcalendarsystemcoptic.cpp:260 3113 #, fuzzy, kde-format 3114 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3115 msgid "of Tobe" 3116 msgstr "اکتبر" 3117 3118 #: kdecore/kcalendarsystemcoptic.cpp:262 3119 #, fuzzy, kde-format 3120 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3121 msgid "of Meshir" 3122 msgstr "مهر" 3123 3124 #: kdecore/kcalendarsystemcoptic.cpp:264 3125 #, fuzzy, kde-format 3126 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3127 msgid "of Paremhotep" 3128 msgstr "پارامتر" 3129 3130 #: kdecore/kcalendarsystemcoptic.cpp:266 3131 #, fuzzy, kde-format 3132 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3133 msgid "of Parmoute" 3134 msgstr "تاموز" 3135 3136 #: kdecore/kcalendarsystemcoptic.cpp:268 3137 #, fuzzy, kde-format 3138 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3139 msgid "of Pashons" 3140 msgstr "بهمن" 3141 3142 #: kdecore/kcalendarsystemcoptic.cpp:270 3143 #, fuzzy, kde-format 3144 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3145 msgid "of Paone" 3146 msgstr "ژانویه" 3147 3148 #: kdecore/kcalendarsystemcoptic.cpp:272 3149 #, fuzzy, kde-format 3150 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3151 msgid "of Epep" 3152 msgstr "سپتامبر" 3153 3154 #: kdecore/kcalendarsystemcoptic.cpp:274 3155 #, fuzzy, kde-format 3156 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3157 msgid "of Mesore" 3158 msgstr "مرداد" 3159 3160 #: kdecore/kcalendarsystemcoptic.cpp:276 3161 #, fuzzy, kde-format 3162 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3163 msgid "of Kouji nabot" 3164 msgstr "فوریه" 3165 3166 #: kdecore/kcalendarsystemcoptic.cpp:285 3167 #, fuzzy, kde-format 3168 msgctxt "Coptic month 1 - KLocale::LongName" 3169 msgid "Thoout" 3170 msgstr "پنجشنبه" 3171 3172 #: kdecore/kcalendarsystemcoptic.cpp:287 3173 #, fuzzy, kde-format 3174 msgctxt "Coptic month 2 - KLocale::LongName" 3175 msgid "Paope" 3176 msgstr "ویژگی" 3177 3178 #: kdecore/kcalendarsystemcoptic.cpp:289 3179 #, fuzzy, kde-format 3180 msgctxt "Coptic month 3 - KLocale::LongName" 3181 msgid "Hathor" 3182 msgstr "نویسنده" 3183 3184 #: kdecore/kcalendarsystemcoptic.cpp:291 3185 #, fuzzy, kde-format 3186 msgctxt "Coptic month 4 - KLocale::LongName" 3187 msgid "Kiahk" 3188 msgstr "خرداد" 3189 3190 #: kdecore/kcalendarsystemcoptic.cpp:293 3191 #, fuzzy, kde-format 3192 msgctxt "Coptic month 5 - KLocale::LongName" 3193 msgid "Tobe" 3194 msgstr "کار" 3195 3196 #: kdecore/kcalendarsystemcoptic.cpp:295 3197 #, fuzzy, kde-format 3198 msgctxt "Coptic month 6 - KLocale::LongName" 3199 msgid "Meshir" 3200 msgstr "مهر" 3201 3202 #: kdecore/kcalendarsystemcoptic.cpp:297 3203 #, fuzzy, kde-format 3204 msgctxt "Coptic month 7 - KLocale::LongName" 3205 msgid "Paremhotep" 3206 msgstr "پارامتر" 3207 3208 #: kdecore/kcalendarsystemcoptic.cpp:299 3209 #, fuzzy, kde-format 3210 msgctxt "Coptic month 8 - KLocale::LongName" 3211 msgid "Parmoute" 3212 msgstr "پارامتر" 3213 3214 #: kdecore/kcalendarsystemcoptic.cpp:301 3215 #, fuzzy, kde-format 3216 msgctxt "Coptic month 9 - KLocale::LongName" 3217 msgid "Pashons" 3218 msgstr "مکث" 3219 3220 #: kdecore/kcalendarsystemcoptic.cpp:303 3221 #, fuzzy, kde-format 3222 msgctxt "Coptic month 10 - KLocale::LongName" 3223 msgid "Paone" 3224 msgstr "هیچکدام" 3225 3226 #: kdecore/kcalendarsystemcoptic.cpp:305 3227 #, fuzzy, kde-format 3228 msgctxt "Coptic month 11 - KLocale::LongName" 3229 msgid "Epep" 3230 msgstr "گریز" 3231 3232 #: kdecore/kcalendarsystemcoptic.cpp:307 3233 #, fuzzy, kde-format 3234 msgctxt "Coptic month 12 - KLocale::LongName" 3235 msgid "Mesore" 3236 msgstr "&بازگرداندن" 3237 3238 #: kdecore/kcalendarsystemcoptic.cpp:309 3239 #, fuzzy, kde-format 3240 msgctxt "Coptic month 12 - KLocale::LongName" 3241 msgid "Kouji nabot" 3242 msgstr "فوریه" 3243 3244 #: kdecore/kcalendarsystemcoptic.cpp:324 3245 #, kde-format 3246 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3247 msgid "P" 3248 msgstr "" 3249 3250 #: kdecore/kcalendarsystemcoptic.cpp:326 3251 #, kde-format 3252 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3253 msgid "P" 3254 msgstr "" 3255 3256 #: kdecore/kcalendarsystemcoptic.cpp:328 3257 #, kde-format 3258 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3259 msgid "P" 3260 msgstr "" 3261 3262 #: kdecore/kcalendarsystemcoptic.cpp:330 3263 #, kde-format 3264 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3265 msgid "P" 3266 msgstr "" 3267 3268 #: kdecore/kcalendarsystemcoptic.cpp:332 3269 #, kde-format 3270 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3271 msgid "P" 3272 msgstr "" 3273 3274 #: kdecore/kcalendarsystemcoptic.cpp:334 3275 #, kde-format 3276 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3277 msgid "P" 3278 msgstr "" 3279 3280 #: kdecore/kcalendarsystemcoptic.cpp:336 3281 #, kde-format 3282 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3283 msgid "T" 3284 msgstr "" 3285 3286 #: kdecore/kcalendarsystemcoptic.cpp:345 3287 #, fuzzy, kde-format 3288 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3289 msgid "Pes" 3290 msgstr "صفحات" 3291 3292 #: kdecore/kcalendarsystemcoptic.cpp:347 3293 #, fuzzy, kde-format 3294 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3295 msgid "Psh" 3296 msgstr "مکث" 3297 3298 #: kdecore/kcalendarsystemcoptic.cpp:349 3299 #, fuzzy, kde-format 3300 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3301 msgid "Pef" 3302 msgstr "صفحات" 3303 3304 #: kdecore/kcalendarsystemcoptic.cpp:351 3305 #, kde-format 3306 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3307 msgid "Pti" 3308 msgstr "" 3309 3310 #: kdecore/kcalendarsystemcoptic.cpp:353 3311 #, fuzzy, kde-format 3312 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3313 msgid "Pso" 3314 msgstr "مکث" 3315 3316 #: kdecore/kcalendarsystemcoptic.cpp:355 3317 #, fuzzy, kde-format 3318 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3319 msgid "Psa" 3320 msgstr "مکث" 3321 3322 #: kdecore/kcalendarsystemcoptic.cpp:357 3323 #, kde-format 3324 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3325 msgid "Tky" 3326 msgstr "" 3327 3328 #: kdecore/kcalendarsystemcoptic.cpp:365 3329 #, fuzzy, kde-format 3330 msgctxt "Coptic weekday 1 - KLocale::LongName" 3331 msgid "Pesnau" 3332 msgstr "مکث" 3333 3334 #: kdecore/kcalendarsystemcoptic.cpp:367 3335 #, fuzzy, kde-format 3336 msgctxt "Coptic weekday 2 - KLocale::LongName" 3337 msgid "Pshoment" 3338 msgstr "توضیح" 3339 3340 #: kdecore/kcalendarsystemcoptic.cpp:369 3341 #, kde-format 3342 msgctxt "Coptic weekday 3 - KLocale::LongName" 3343 msgid "Peftoou" 3344 msgstr "" 3345 3346 #: kdecore/kcalendarsystemcoptic.cpp:371 3347 #, kde-format 3348 msgctxt "Coptic weekday 4 - KLocale::LongName" 3349 msgid "Ptiou" 3350 msgstr "" 3351 3352 #: kdecore/kcalendarsystemcoptic.cpp:373 3353 #, fuzzy, kde-format 3354 msgctxt "Coptic weekday 5 - KLocale::LongName" 3355 msgid "Psoou" 3356 msgstr "مکث" 3357 3358 #: kdecore/kcalendarsystemcoptic.cpp:375 3359 #, kde-format 3360 msgctxt "Coptic weekday 6 - KLocale::LongName" 3361 msgid "Psabbaton" 3362 msgstr "" 3363 3364 #: kdecore/kcalendarsystemcoptic.cpp:377 3365 #, kde-format 3366 msgctxt "Coptic weekday 7 - KLocale::LongName" 3367 msgid "Tkyriakē" 3368 msgstr "" 3369 3370 #: kdecore/kcalendarsystemethiopian.cpp:50 3371 #, kde-format 3372 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3373 msgid "Amata Mehrat" 3374 msgstr "" 3375 3376 #: kdecore/kcalendarsystemethiopian.cpp:51 3377 #, kde-format 3378 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3379 msgid "AM" 3380 msgstr "" 3381 3382 #: kdecore/kcalendarsystemethiopian.cpp:52 3383 #, kde-format 3384 msgctxt "" 3385 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3386 msgid "%Ey %EC" 3387 msgstr "" 3388 3389 #: kdecore/kcalendarsystemethiopian.cpp:66 3390 #, kde-format 3391 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3392 msgid "M" 3393 msgstr "" 3394 3395 #: kdecore/kcalendarsystemethiopian.cpp:68 3396 #, kde-format 3397 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3398 msgid "T" 3399 msgstr "" 3400 3401 #: kdecore/kcalendarsystemethiopian.cpp:70 3402 #, kde-format 3403 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3404 msgid "H" 3405 msgstr "" 3406 3407 #: kdecore/kcalendarsystemethiopian.cpp:72 3408 #, kde-format 3409 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3410 msgid "T" 3411 msgstr "" 3412 3413 #: kdecore/kcalendarsystemethiopian.cpp:74 3414 #, kde-format 3415 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3416 msgid "T" 3417 msgstr "" 3418 3419 #: kdecore/kcalendarsystemethiopian.cpp:76 3420 #, kde-format 3421 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3422 msgid "Y" 3423 msgstr "" 3424 3425 #: kdecore/kcalendarsystemethiopian.cpp:78 3426 #, kde-format 3427 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3428 msgid "M" 3429 msgstr "" 3430 3431 #: kdecore/kcalendarsystemethiopian.cpp:80 3432 #, kde-format 3433 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3434 msgid "M" 3435 msgstr "" 3436 3437 #: kdecore/kcalendarsystemethiopian.cpp:82 3438 #, kde-format 3439 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3440 msgid "G" 3441 msgstr "" 3442 3443 #: kdecore/kcalendarsystemethiopian.cpp:84 3444 #, kde-format 3445 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3446 msgid "S" 3447 msgstr "" 3448 3449 #: kdecore/kcalendarsystemethiopian.cpp:86 3450 #, kde-format 3451 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3452 msgid "H" 3453 msgstr "" 3454 3455 #: kdecore/kcalendarsystemethiopian.cpp:88 3456 #, kde-format 3457 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3458 msgid "N" 3459 msgstr "" 3460 3461 #: kdecore/kcalendarsystemethiopian.cpp:90 3462 #, kde-format 3463 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3464 msgid "P" 3465 msgstr "" 3466 3467 #: kdecore/kcalendarsystemethiopian.cpp:99 3468 #, fuzzy, kde-format 3469 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3470 msgid "of Mes" 3471 msgstr "مهر" 3472 3473 #: kdecore/kcalendarsystemethiopian.cpp:101 3474 #, fuzzy, kde-format 3475 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3476 msgid "of Teq" 3477 msgstr "تِوِت" 3478 3479 #: kdecore/kcalendarsystemethiopian.cpp:103 3480 #, fuzzy, kde-format 3481 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3482 msgid "of Hed" 3483 msgstr "فوریه" 3484 3485 #: kdecore/kcalendarsystemethiopian.cpp:105 3486 #, fuzzy, kde-format 3487 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3488 msgid "of Tah" 3489 msgstr "بهمن" 3490 3491 #: kdecore/kcalendarsystemethiopian.cpp:107 3492 #, fuzzy, kde-format 3493 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3494 msgid "of Ter" 3495 msgstr "تیر" 3496 3497 #: kdecore/kcalendarsystemethiopian.cpp:109 3498 #, fuzzy, kde-format 3499 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3500 msgid "of Yak" 3501 msgstr "ژانویه" 3502 3503 #: kdecore/kcalendarsystemethiopian.cpp:111 3504 #, fuzzy, kde-format 3505 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3506 msgid "of Mag" 3507 msgstr "مارس" 3508 3509 #: kdecore/kcalendarsystemethiopian.cpp:113 3510 #, fuzzy, kde-format 3511 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3512 msgid "of Miy" 3513 msgstr "مه" 3514 3515 #: kdecore/kcalendarsystemethiopian.cpp:115 3516 #, fuzzy, kde-format 3517 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3518 msgid "of Gen" 3519 msgstr "ژانویه" 3520 3521 #: kdecore/kcalendarsystemethiopian.cpp:117 3522 #, fuzzy, kde-format 3523 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3524 msgid "of Sen" 3525 msgstr "سپتامبر" 3526 3527 #: kdecore/kcalendarsystemethiopian.cpp:119 3528 #, fuzzy, kde-format 3529 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3530 msgid "of Ham" 3531 msgstr "تاموز" 3532 3533 #: kdecore/kcalendarsystemethiopian.cpp:121 3534 #, fuzzy, kde-format 3535 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3536 msgid "of Neh" 3537 msgstr "مهر" 3538 3539 #: kdecore/kcalendarsystemethiopian.cpp:123 3540 #, fuzzy, kde-format 3541 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3542 msgid "of Pag" 3543 msgstr "تاموز" 3544 3545 #: kdecore/kcalendarsystemethiopian.cpp:132 3546 #, fuzzy, kde-format 3547 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3548 msgid "Mes" 3549 msgstr "بله" 3550 3551 #: kdecore/kcalendarsystemethiopian.cpp:134 3552 #, fuzzy, kde-format 3553 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3554 msgid "Teq" 3555 msgstr "سهشنبه" 3556 3557 #: kdecore/kcalendarsystemethiopian.cpp:136 3558 #, fuzzy, kde-format 3559 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3560 msgid "Hed" 3561 msgstr "چهارشنبه" 3562 3563 #: kdecore/kcalendarsystemethiopian.cpp:138 3564 #, fuzzy, kde-format 3565 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3566 msgid "Tah" 3567 msgstr "زباله" 3568 3569 #: kdecore/kcalendarsystemethiopian.cpp:140 3570 #, fuzzy, kde-format 3571 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3572 msgid "Ter" 3573 msgstr "سهشنبه" 3574 3575 #: kdecore/kcalendarsystemethiopian.cpp:142 3576 #, fuzzy, kde-format 3577 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3578 msgid "Yak" 3579 msgstr "ژانویه" 3580 3581 #: kdecore/kcalendarsystemethiopian.cpp:144 3582 #, fuzzy, kde-format 3583 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3584 msgid "Mag" 3585 msgstr "مارس" 3586 3587 #: kdecore/kcalendarsystemethiopian.cpp:146 3588 #, fuzzy, kde-format 3589 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3590 msgid "Miy" 3591 msgstr "مه" 3592 3593 #: kdecore/kcalendarsystemethiopian.cpp:148 3594 #, fuzzy, kde-format 3595 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3596 msgid "Gen" 3597 msgstr "سبز:" 3598 3599 #: kdecore/kcalendarsystemethiopian.cpp:150 3600 #, fuzzy, kde-format 3601 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3602 msgid "Sen" 3603 msgstr "&ارسال" 3604 3605 #: kdecore/kcalendarsystemethiopian.cpp:152 3606 #, fuzzy, kde-format 3607 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3608 msgid "Ham" 3609 msgstr "قبل از ظهر" 3610 3611 #: kdecore/kcalendarsystemethiopian.cpp:154 3612 #, fuzzy, kde-format 3613 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3614 msgid "Neh" 3615 msgstr "مهر" 3616 3617 #: kdecore/kcalendarsystemethiopian.cpp:156 3618 #, fuzzy, kde-format 3619 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3620 msgid "Pag" 3621 msgstr "صفحات" 3622 3623 #: kdecore/kcalendarsystemethiopian.cpp:165 3624 #, fuzzy, kde-format 3625 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3626 msgid "of Meskerem" 3627 msgstr "مهر" 3628 3629 #: kdecore/kcalendarsystemethiopian.cpp:167 3630 #, fuzzy, kde-format 3631 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3632 msgid "of Tequemt" 3633 msgstr "تِوِت" 3634 3635 #: kdecore/kcalendarsystemethiopian.cpp:169 3636 #, fuzzy, kde-format 3637 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3638 msgid "of Hedar" 3639 msgstr "آدار" 3640 3641 #: kdecore/kcalendarsystemethiopian.cpp:171 3642 #, fuzzy, kde-format 3643 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3644 msgid "of Tahsas" 3645 msgstr "بهمن" 3646 3647 #: kdecore/kcalendarsystemethiopian.cpp:173 3648 #, fuzzy, kde-format 3649 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3650 msgid "of Ter" 3651 msgstr "تیر" 3652 3653 #: kdecore/kcalendarsystemethiopian.cpp:175 3654 #, fuzzy, kde-format 3655 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3656 msgid "of Yakatit" 3657 msgstr "فروردین" 3658 3659 #: kdecore/kcalendarsystemethiopian.cpp:177 3660 #, fuzzy, kde-format 3661 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3662 msgid "of Magabit" 3663 msgstr "رجب" 3664 3665 #: kdecore/kcalendarsystemethiopian.cpp:179 3666 #, fuzzy, kde-format 3667 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3668 msgid "of Miyazya" 3669 msgstr "مه" 3670 3671 #: kdecore/kcalendarsystemethiopian.cpp:181 3672 #, fuzzy, kde-format 3673 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3674 msgid "of Genbot" 3675 msgstr "فوریه" 3676 3677 #: kdecore/kcalendarsystemethiopian.cpp:183 3678 #, fuzzy, kde-format 3679 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3680 msgid "of Sene" 3681 msgstr "سپتامبر" 3682 3683 #: kdecore/kcalendarsystemethiopian.cpp:185 3684 #, fuzzy, kde-format 3685 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3686 msgid "of Hamle" 3687 msgstr "تاموز" 3688 3689 #: kdecore/kcalendarsystemethiopian.cpp:187 3690 #, fuzzy, kde-format 3691 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3692 msgid "of Nehase" 3693 msgstr "شهریور" 3694 3695 #: kdecore/kcalendarsystemethiopian.cpp:189 3696 #, fuzzy, kde-format 3697 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3698 msgid "of Pagumen" 3699 msgstr "تاموز" 3700 3701 #: kdecore/kcalendarsystemethiopian.cpp:198 3702 #, fuzzy, kde-format 3703 msgctxt "Ethiopian month 1 - KLocale::LongName" 3704 msgid "Meskerem" 3705 msgstr "مهر" 3706 3707 #: kdecore/kcalendarsystemethiopian.cpp:200 3708 #, fuzzy, kde-format 3709 msgctxt "Ethiopian month 2 - KLocale::LongName" 3710 msgid "Tequemt" 3711 msgstr "تِوِت" 3712 3713 #: kdecore/kcalendarsystemethiopian.cpp:202 3714 #, fuzzy, kde-format 3715 msgctxt "Ethiopian month 3 - KLocale::LongName" 3716 msgid "Hedar" 3717 msgstr "ادار" 3718 3719 #: kdecore/kcalendarsystemethiopian.cpp:204 3720 #, fuzzy, kde-format 3721 msgctxt "Ethiopian month 4 - KLocale::LongName" 3722 msgid "Tahsas" 3723 msgstr "تکلیف" 3724 3725 #: kdecore/kcalendarsystemethiopian.cpp:206 3726 #, fuzzy, kde-format 3727 msgctxt "Ethiopian month 5 - KLocale::LongName" 3728 msgid "Ter" 3729 msgstr "سهشنبه" 3730 3731 #: kdecore/kcalendarsystemethiopian.cpp:208 3732 #, fuzzy, kde-format 3733 msgctxt "Ethiopian month 6 - KLocale::LongName" 3734 msgid "Yakatit" 3735 msgstr "فروردین" 3736 3737 #: kdecore/kcalendarsystemethiopian.cpp:210 3738 #, fuzzy, kde-format 3739 msgctxt "Ethiopian month 7 - KLocale::LongName" 3740 msgid "Magabit" 3741 msgstr "رجب" 3742 3743 #: kdecore/kcalendarsystemethiopian.cpp:212 3744 #, fuzzy, kde-format 3745 msgctxt "Ethiopian month 8 - KLocale::LongName" 3746 msgid "Miyazya" 3747 msgstr "مه" 3748 3749 #: kdecore/kcalendarsystemethiopian.cpp:214 3750 #, fuzzy, kde-format 3751 msgctxt "Ethiopian month 9 - KLocale::LongName" 3752 msgid "Genbot" 3753 msgstr "فوریه" 3754 3755 #: kdecore/kcalendarsystemethiopian.cpp:216 3756 #, fuzzy, kde-format 3757 msgctxt "Ethiopian month 10 - KLocale::LongName" 3758 msgid "Sene" 3759 msgstr "&ارسال" 3760 3761 #: kdecore/kcalendarsystemethiopian.cpp:218 3762 #, fuzzy, kde-format 3763 msgctxt "Ethiopian month 11 - KLocale::LongName" 3764 msgid "Hamle" 3765 msgstr "نام" 3766 3767 #: kdecore/kcalendarsystemethiopian.cpp:220 3768 #, fuzzy, kde-format 3769 msgctxt "Ethiopian month 12 - KLocale::LongName" 3770 msgid "Nehase" 3771 msgstr "نام" 3772 3773 #: kdecore/kcalendarsystemethiopian.cpp:222 3774 #, fuzzy, kde-format 3775 msgctxt "Ethiopian month 13 - KLocale::LongName" 3776 msgid "Pagumen" 3777 msgstr "صفحات" 3778 3779 #: kdecore/kcalendarsystemethiopian.cpp:236 3780 #, kde-format 3781 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3782 msgid "S" 3783 msgstr "" 3784 3785 #: kdecore/kcalendarsystemethiopian.cpp:238 3786 #, kde-format 3787 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3788 msgid "M" 3789 msgstr "" 3790 3791 #: kdecore/kcalendarsystemethiopian.cpp:240 3792 #, kde-format 3793 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3794 msgid "R" 3795 msgstr "" 3796 3797 #: kdecore/kcalendarsystemethiopian.cpp:242 3798 #, kde-format 3799 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3800 msgid "H" 3801 msgstr "" 3802 3803 #: kdecore/kcalendarsystemethiopian.cpp:244 3804 #, kde-format 3805 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3806 msgid "A" 3807 msgstr "" 3808 3809 #: kdecore/kcalendarsystemethiopian.cpp:246 3810 #, kde-format 3811 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3812 msgid "Q" 3813 msgstr "" 3814 3815 #: kdecore/kcalendarsystemethiopian.cpp:248 3816 #, kde-format 3817 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3818 msgid "E" 3819 msgstr "" 3820 3821 #: kdecore/kcalendarsystemethiopian.cpp:257 3822 #, fuzzy, kde-format 3823 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3824 msgid "Seg" 3825 msgstr "سپتامبر" 3826 3827 #: kdecore/kcalendarsystemethiopian.cpp:259 3828 #, fuzzy, kde-format 3829 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3830 msgid "Mak" 3831 msgstr "مارس" 3832 3833 #: kdecore/kcalendarsystemethiopian.cpp:261 3834 #, fuzzy, kde-format 3835 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3836 msgid "Rob" 3837 msgstr "کار" 3838 3839 #: kdecore/kcalendarsystemethiopian.cpp:263 3840 #, fuzzy, kde-format 3841 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3842 msgid "Ham" 3843 msgstr "قبل از ظهر" 3844 3845 #: kdecore/kcalendarsystemethiopian.cpp:265 3846 #, fuzzy, kde-format 3847 #| msgid "Arb" 3848 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3849 msgid "Arb" 3850 msgstr "چهارشنبه" 3851 3852 #: kdecore/kcalendarsystemethiopian.cpp:267 3853 #, fuzzy, kde-format 3854 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3855 msgid "Qed" 3856 msgstr "چهارشنبه" 3857 3858 #: kdecore/kcalendarsystemethiopian.cpp:269 3859 #, fuzzy, kde-format 3860 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3861 msgid "Ehu" 3862 msgstr "پنجشنبه" 3863 3864 #: kdecore/kcalendarsystemethiopian.cpp:276 3865 #, fuzzy, kde-format 3866 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3867 msgid "Segno" 3868 msgstr "&ارسال" 3869 3870 #: kdecore/kcalendarsystemethiopian.cpp:278 3871 #, fuzzy, kde-format 3872 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3873 msgid "Maksegno" 3874 msgstr "&ارسال" 3875 3876 #: kdecore/kcalendarsystemethiopian.cpp:280 3877 #, fuzzy, kde-format 3878 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3879 msgid "Rob" 3880 msgstr "کار" 3881 3882 #: kdecore/kcalendarsystemethiopian.cpp:282 3883 #, fuzzy, kde-format 3884 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3885 msgid "Hamus" 3886 msgstr "مکث" 3887 3888 #: kdecore/kcalendarsystemethiopian.cpp:284 3889 #, fuzzy, kde-format 3890 #| msgid "Arb" 3891 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3892 msgid "Arb" 3893 msgstr "چهارشنبه" 3894 3895 #: kdecore/kcalendarsystemethiopian.cpp:286 3896 #, fuzzy, kde-format 3897 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3898 msgid "Qedame" 3899 msgstr "نام" 3900 3901 #: kdecore/kcalendarsystemethiopian.cpp:288 3902 #, fuzzy, kde-format 3903 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3904 msgid "Ehud" 3905 msgstr "پنجشنبه" 3906 3907 #: kdecore/kcalendarsystemgregorian.cpp:53 3908 #, kde-format 3909 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3910 msgid "Before Common Era" 3911 msgstr "" 3912 3913 #: kdecore/kcalendarsystemgregorian.cpp:54 3914 #, kde-format 3915 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3916 msgid "BCE" 3917 msgstr "" 3918 3919 #: kdecore/kcalendarsystemgregorian.cpp:56 3920 #, kde-format 3921 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3922 msgid "Before Christ" 3923 msgstr "" 3924 3925 #: kdecore/kcalendarsystemgregorian.cpp:57 3926 #, kde-format 3927 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3928 msgid "BC" 3929 msgstr "" 3930 3931 #: kdecore/kcalendarsystemgregorian.cpp:59 3932 #, kde-format 3933 msgctxt "" 3934 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3935 msgid "%Ey %EC" 3936 msgstr "" 3937 3938 #: kdecore/kcalendarsystemgregorian.cpp:63 3939 #, kde-format 3940 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3941 msgid "Common Era" 3942 msgstr "" 3943 3944 #: kdecore/kcalendarsystemgregorian.cpp:64 3945 #, kde-format 3946 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3947 msgid "CE" 3948 msgstr "" 3949 3950 #: kdecore/kcalendarsystemgregorian.cpp:66 3951 #: kdecore/kcalendarsystemjapanese.cpp:57 3952 #, kde-format 3953 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3954 msgid "Anno Domini" 3955 msgstr "" 3956 3957 #: kdecore/kcalendarsystemgregorian.cpp:67 3958 #: kdecore/kcalendarsystemjapanese.cpp:58 3959 #, kde-format 3960 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3961 msgid "AD" 3962 msgstr "" 3963 3964 #: kdecore/kcalendarsystemgregorian.cpp:69 3965 #: kdecore/kcalendarsystemjapanese.cpp:59 3966 #, kde-format 3967 msgctxt "" 3968 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3969 msgid "%Ey %EC" 3970 msgstr "" 3971 3972 #: kdecore/kcalendarsystemgregorian.cpp:138 3973 #, kde-format 3974 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3975 msgid "J" 3976 msgstr "" 3977 3978 #: kdecore/kcalendarsystemgregorian.cpp:140 3979 #, kde-format 3980 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3981 msgid "F" 3982 msgstr "" 3983 3984 #: kdecore/kcalendarsystemgregorian.cpp:142 3985 #, kde-format 3986 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3987 msgid "M" 3988 msgstr "" 3989 3990 #: kdecore/kcalendarsystemgregorian.cpp:144 3991 #, kde-format 3992 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3993 msgid "A" 3994 msgstr "" 3995 3996 #: kdecore/kcalendarsystemgregorian.cpp:146 3997 #, kde-format 3998 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3999 msgid "M" 4000 msgstr "" 4001 4002 #: kdecore/kcalendarsystemgregorian.cpp:148 4003 #, kde-format 4004 msgctxt "Gregorian month 6 - KLocale::NarrowName" 4005 msgid "J" 4006 msgstr "" 4007 4008 #: kdecore/kcalendarsystemgregorian.cpp:150 4009 #, kde-format 4010 msgctxt "Gregorian month 7 - KLocale::NarrowName" 4011 msgid "J" 4012 msgstr "" 4013 4014 #: kdecore/kcalendarsystemgregorian.cpp:152 4015 #, kde-format 4016 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4017 msgid "A" 4018 msgstr "" 4019 4020 #: kdecore/kcalendarsystemgregorian.cpp:154 4021 #, kde-format 4022 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4023 msgid "S" 4024 msgstr "" 4025 4026 #: kdecore/kcalendarsystemgregorian.cpp:156 4027 #, kde-format 4028 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4029 msgid "O" 4030 msgstr "" 4031 4032 #: kdecore/kcalendarsystemgregorian.cpp:158 4033 #, kde-format 4034 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4035 msgid "N" 4036 msgstr "" 4037 4038 #: kdecore/kcalendarsystemgregorian.cpp:160 4039 #, kde-format 4040 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4041 msgid "D" 4042 msgstr "" 4043 4044 #: kdecore/kcalendarsystemgregorian.cpp:169 4045 #, fuzzy, kde-format 4046 #| msgctxt "of January" 4047 #| msgid "of Jan" 4048 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4049 msgid "of Jan" 4050 msgstr "ژانویه" 4051 4052 #: kdecore/kcalendarsystemgregorian.cpp:171 4053 #, fuzzy, kde-format 4054 #| msgctxt "of February" 4055 #| msgid "of Feb" 4056 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4057 msgid "of Feb" 4058 msgstr "فوریه" 4059 4060 #: kdecore/kcalendarsystemgregorian.cpp:173 4061 #, fuzzy, kde-format 4062 #| msgctxt "of March" 4063 #| msgid "of Mar" 4064 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4065 msgid "of Mar" 4066 msgstr "مارس" 4067 4068 #: kdecore/kcalendarsystemgregorian.cpp:175 4069 #, fuzzy, kde-format 4070 #| msgctxt "of April" 4071 #| msgid "of Apr" 4072 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4073 msgid "of Apr" 4074 msgstr "آوریل" 4075 4076 #: kdecore/kcalendarsystemgregorian.cpp:177 4077 #, fuzzy, kde-format 4078 #| msgctxt "of May short" 4079 #| msgid "of May" 4080 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4081 msgid "of May" 4082 msgstr "مه" 4083 4084 #: kdecore/kcalendarsystemgregorian.cpp:179 4085 #, fuzzy, kde-format 4086 #| msgctxt "of June" 4087 #| msgid "of Jun" 4088 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4089 msgid "of Jun" 4090 msgstr "ژوئن" 4091 4092 #: kdecore/kcalendarsystemgregorian.cpp:181 4093 #, fuzzy, kde-format 4094 #| msgctxt "of July" 4095 #| msgid "of Jul" 4096 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4097 msgid "of Jul" 4098 msgstr "ژوئیه" 4099 4100 #: kdecore/kcalendarsystemgregorian.cpp:183 4101 #, fuzzy, kde-format 4102 #| msgctxt "of August" 4103 #| msgid "of Aug" 4104 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4105 msgid "of Aug" 4106 msgstr "اوت" 4107 4108 #: kdecore/kcalendarsystemgregorian.cpp:185 4109 #, fuzzy, kde-format 4110 #| msgctxt "of September" 4111 #| msgid "of Sep" 4112 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4113 msgid "of Sep" 4114 msgstr "سپتامبر" 4115 4116 #: kdecore/kcalendarsystemgregorian.cpp:187 4117 #, fuzzy, kde-format 4118 #| msgctxt "of October" 4119 #| msgid "of Oct" 4120 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4121 msgid "of Oct" 4122 msgstr "اکتبر" 4123 4124 #: kdecore/kcalendarsystemgregorian.cpp:189 4125 #, fuzzy, kde-format 4126 #| msgctxt "of November" 4127 #| msgid "of Nov" 4128 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4129 msgid "of Nov" 4130 msgstr "نوامبر" 4131 4132 #: kdecore/kcalendarsystemgregorian.cpp:191 4133 #, fuzzy, kde-format 4134 #| msgctxt "of December" 4135 #| msgid "of Dec" 4136 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4137 msgid "of Dec" 4138 msgstr "دسامبر" 4139 4140 #: kdecore/kcalendarsystemgregorian.cpp:200 4141 #, fuzzy, kde-format 4142 #| msgctxt "January" 4143 #| msgid "Jan" 4144 msgctxt "Gregorian month 1 - KLocale::ShortName" 4145 msgid "Jan" 4146 msgstr "ژانویه" 4147 4148 #: kdecore/kcalendarsystemgregorian.cpp:202 4149 #, fuzzy, kde-format 4150 #| msgctxt "February" 4151 #| msgid "Feb" 4152 msgctxt "Gregorian month 2 - KLocale::ShortName" 4153 msgid "Feb" 4154 msgstr "فوریه" 4155 4156 #: kdecore/kcalendarsystemgregorian.cpp:204 4157 #, fuzzy, kde-format 4158 #| msgctxt "March" 4159 #| msgid "Mar" 4160 msgctxt "Gregorian month 3 - KLocale::ShortName" 4161 msgid "Mar" 4162 msgstr "مارس" 4163 4164 #: kdecore/kcalendarsystemgregorian.cpp:206 4165 #, fuzzy, kde-format 4166 #| msgctxt "April" 4167 #| msgid "Apr" 4168 msgctxt "Gregorian month 4 - KLocale::ShortName" 4169 msgid "Apr" 4170 msgstr "آوریل" 4171 4172 #: kdecore/kcalendarsystemgregorian.cpp:208 4173 #, fuzzy, kde-format 4174 #| msgctxt "May short" 4175 #| msgid "May" 4176 msgctxt "Gregorian month 5 - KLocale::ShortName" 4177 msgid "May" 4178 msgstr "مه" 4179 4180 #: kdecore/kcalendarsystemgregorian.cpp:210 4181 #, fuzzy, kde-format 4182 #| msgctxt "June" 4183 #| msgid "Jun" 4184 msgctxt "Gregorian month 6 - KLocale::ShortName" 4185 msgid "Jun" 4186 msgstr "ژوئن" 4187 4188 #: kdecore/kcalendarsystemgregorian.cpp:212 4189 #, fuzzy, kde-format 4190 #| msgctxt "July" 4191 #| msgid "Jul" 4192 msgctxt "Gregorian month 7 - KLocale::ShortName" 4193 msgid "Jul" 4194 msgstr "ژوئیه" 4195 4196 #: kdecore/kcalendarsystemgregorian.cpp:214 4197 #, fuzzy, kde-format 4198 #| msgctxt "August" 4199 #| msgid "Aug" 4200 msgctxt "Gregorian month 8 - KLocale::ShortName" 4201 msgid "Aug" 4202 msgstr "اوت" 4203 4204 #: kdecore/kcalendarsystemgregorian.cpp:216 4205 #, fuzzy, kde-format 4206 #| msgctxt "September" 4207 #| msgid "Sep" 4208 msgctxt "Gregorian month 9 - KLocale::ShortName" 4209 msgid "Sep" 4210 msgstr "سپتامبر" 4211 4212 #: kdecore/kcalendarsystemgregorian.cpp:218 4213 #, fuzzy, kde-format 4214 #| msgctxt "October" 4215 #| msgid "Oct" 4216 msgctxt "Gregorian month 10 - KLocale::ShortName" 4217 msgid "Oct" 4218 msgstr "اکتبر" 4219 4220 #: kdecore/kcalendarsystemgregorian.cpp:220 4221 #, fuzzy, kde-format 4222 #| msgctxt "November" 4223 #| msgid "Nov" 4224 msgctxt "Gregorian month 11 - KLocale::ShortName" 4225 msgid "Nov" 4226 msgstr "نوامبر" 4227 4228 #: kdecore/kcalendarsystemgregorian.cpp:222 4229 #, fuzzy, kde-format 4230 #| msgctxt "December" 4231 #| msgid "Dec" 4232 msgctxt "Gregorian month 12 - KLocale::ShortName" 4233 msgid "Dec" 4234 msgstr "دسامبر" 4235 4236 #: kdecore/kcalendarsystemgregorian.cpp:231 4237 #, fuzzy, kde-format 4238 #| msgid "of January" 4239 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4240 msgid "of January" 4241 msgstr "ژانویه" 4242 4243 #: kdecore/kcalendarsystemgregorian.cpp:233 4244 #, fuzzy, kde-format 4245 #| msgid "of February" 4246 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4247 msgid "of February" 4248 msgstr "فوریه" 4249 4250 #: kdecore/kcalendarsystemgregorian.cpp:235 4251 #, fuzzy, kde-format 4252 #| msgid "of March" 4253 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4254 msgid "of March" 4255 msgstr "مارس" 4256 4257 #: kdecore/kcalendarsystemgregorian.cpp:237 4258 #, fuzzy, kde-format 4259 #| msgid "of April" 4260 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4261 msgid "of April" 4262 msgstr "آوریل" 4263 4264 #: kdecore/kcalendarsystemgregorian.cpp:239 4265 #, fuzzy, kde-format 4266 #| msgctxt "of May short" 4267 #| msgid "of May" 4268 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4269 msgid "of May" 4270 msgstr "مه" 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:241 4273 #, fuzzy, kde-format 4274 #| msgid "of June" 4275 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4276 msgid "of June" 4277 msgstr "ژوئن" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:243 4280 #, fuzzy, kde-format 4281 #| msgid "of July" 4282 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4283 msgid "of July" 4284 msgstr "ژوئیه" 4285 4286 #: kdecore/kcalendarsystemgregorian.cpp:245 4287 #, fuzzy, kde-format 4288 #| msgid "of August" 4289 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4290 msgid "of August" 4291 msgstr "اوت" 4292 4293 #: kdecore/kcalendarsystemgregorian.cpp:247 4294 #, fuzzy, kde-format 4295 #| msgid "of September" 4296 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4297 msgid "of September" 4298 msgstr "سپتامبر" 4299 4300 #: kdecore/kcalendarsystemgregorian.cpp:249 4301 #, fuzzy, kde-format 4302 #| msgid "of October" 4303 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4304 msgid "of October" 4305 msgstr "اکتبر" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:251 4308 #, fuzzy, kde-format 4309 #| msgid "of November" 4310 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4311 msgid "of November" 4312 msgstr "نوامبر" 4313 4314 #: kdecore/kcalendarsystemgregorian.cpp:253 4315 #, fuzzy, kde-format 4316 #| msgid "of December" 4317 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4318 msgid "of December" 4319 msgstr "دسامبر" 4320 4321 #: kdecore/kcalendarsystemgregorian.cpp:262 4322 #, fuzzy, kde-format 4323 #| msgid "January" 4324 msgctxt "Gregorian month 1 - KLocale::LongName" 4325 msgid "January" 4326 msgstr "ژانویه" 4327 4328 #: kdecore/kcalendarsystemgregorian.cpp:264 4329 #, fuzzy, kde-format 4330 #| msgid "February" 4331 msgctxt "Gregorian month 2 - KLocale::LongName" 4332 msgid "February" 4333 msgstr "فوریه" 4334 4335 #: kdecore/kcalendarsystemgregorian.cpp:266 4336 #, fuzzy, kde-format 4337 #| msgctxt "March long" 4338 #| msgid "March" 4339 msgctxt "Gregorian month 3 - KLocale::LongName" 4340 msgid "March" 4341 msgstr "مارس" 4342 4343 #: kdecore/kcalendarsystemgregorian.cpp:268 4344 #, fuzzy, kde-format 4345 #| msgid "April" 4346 msgctxt "Gregorian month 4 - KLocale::LongName" 4347 msgid "April" 4348 msgstr "آوریل" 4349 4350 #: kdecore/kcalendarsystemgregorian.cpp:270 4351 #, fuzzy, kde-format 4352 #| msgctxt "May short" 4353 #| msgid "May" 4354 msgctxt "Gregorian month 5 - KLocale::LongName" 4355 msgid "May" 4356 msgstr "مه" 4357 4358 #: kdecore/kcalendarsystemgregorian.cpp:272 4359 #, fuzzy, kde-format 4360 #| msgid "June" 4361 msgctxt "Gregorian month 6 - KLocale::LongName" 4362 msgid "June" 4363 msgstr "ژوئن" 4364 4365 #: kdecore/kcalendarsystemgregorian.cpp:274 4366 #, fuzzy, kde-format 4367 #| msgid "July" 4368 msgctxt "Gregorian month 7 - KLocale::LongName" 4369 msgid "July" 4370 msgstr "ژوئیه" 4371 4372 #: kdecore/kcalendarsystemgregorian.cpp:276 4373 #, fuzzy, kde-format 4374 #| msgctxt "August long" 4375 #| msgid "August" 4376 msgctxt "Gregorian month 8 - KLocale::LongName" 4377 msgid "August" 4378 msgstr "اوت" 4379 4380 #: kdecore/kcalendarsystemgregorian.cpp:278 4381 #, fuzzy, kde-format 4382 #| msgid "September" 4383 msgctxt "Gregorian month 9 - KLocale::LongName" 4384 msgid "September" 4385 msgstr "سپتامبر" 4386 4387 #: kdecore/kcalendarsystemgregorian.cpp:280 4388 #, fuzzy, kde-format 4389 #| msgid "October" 4390 msgctxt "Gregorian month 10 - KLocale::LongName" 4391 msgid "October" 4392 msgstr "اکتبر" 4393 4394 #: kdecore/kcalendarsystemgregorian.cpp:282 4395 #, fuzzy, kde-format 4396 #| msgid "November" 4397 msgctxt "Gregorian month 11 - KLocale::LongName" 4398 msgid "November" 4399 msgstr "نوامبر" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:284 4402 #, fuzzy, kde-format 4403 #| msgid "December" 4404 msgctxt "Gregorian month 12 - KLocale::LongName" 4405 msgid "December" 4406 msgstr "دسامبر" 4407 4408 #: kdecore/kcalendarsystemgregorian.cpp:297 4409 #: kdecore/kcalendarsystemhebrew.cpp:807 4410 #, kde-format 4411 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4412 msgid "M" 4413 msgstr "" 4414 4415 #: kdecore/kcalendarsystemgregorian.cpp:299 4416 #: kdecore/kcalendarsystemhebrew.cpp:809 4417 #, kde-format 4418 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4419 msgid "T" 4420 msgstr "" 4421 4422 #: kdecore/kcalendarsystemgregorian.cpp:301 4423 #: kdecore/kcalendarsystemhebrew.cpp:811 4424 #, kde-format 4425 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4426 msgid "W" 4427 msgstr "" 4428 4429 #: kdecore/kcalendarsystemgregorian.cpp:303 4430 #: kdecore/kcalendarsystemhebrew.cpp:813 4431 #, kde-format 4432 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4433 msgid "T" 4434 msgstr "" 4435 4436 #: kdecore/kcalendarsystemgregorian.cpp:305 4437 #: kdecore/kcalendarsystemhebrew.cpp:815 4438 #, kde-format 4439 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4440 msgid "F" 4441 msgstr "" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:307 4444 #: kdecore/kcalendarsystemhebrew.cpp:817 4445 #, kde-format 4446 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4447 msgid "S" 4448 msgstr "" 4449 4450 #: kdecore/kcalendarsystemgregorian.cpp:309 4451 #: kdecore/kcalendarsystemhebrew.cpp:819 4452 #, kde-format 4453 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4454 msgid "S" 4455 msgstr "" 4456 4457 #: kdecore/kcalendarsystemgregorian.cpp:318 4458 #: kdecore/kcalendarsystemhebrew.cpp:828 4459 #, fuzzy, kde-format 4460 #| msgctxt "Monday" 4461 #| msgid "Mon" 4462 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4463 msgid "Mon" 4464 msgstr "دوشنبه" 4465 4466 #: kdecore/kcalendarsystemgregorian.cpp:320 4467 #: kdecore/kcalendarsystemhebrew.cpp:830 4468 #, fuzzy, kde-format 4469 #| msgctxt "Tuesday" 4470 #| msgid "Tue" 4471 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4472 msgid "Tue" 4473 msgstr "سهشنبه" 4474 4475 #: kdecore/kcalendarsystemgregorian.cpp:322 4476 #: kdecore/kcalendarsystemhebrew.cpp:832 4477 #, fuzzy, kde-format 4478 #| msgctxt "Wednesday" 4479 #| msgid "Wed" 4480 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4481 msgid "Wed" 4482 msgstr "چهارشنبه" 4483 4484 #: kdecore/kcalendarsystemgregorian.cpp:324 4485 #: kdecore/kcalendarsystemhebrew.cpp:834 4486 #, fuzzy, kde-format 4487 #| msgctxt "Thursday" 4488 #| msgid "Thu" 4489 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4490 msgid "Thu" 4491 msgstr "پنجشنبه" 4492 4493 #: kdecore/kcalendarsystemgregorian.cpp:326 4494 #: kdecore/kcalendarsystemhebrew.cpp:836 4495 #, fuzzy, kde-format 4496 #| msgctxt "Friday" 4497 #| msgid "Fri" 4498 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4499 msgid "Fri" 4500 msgstr "جمعه" 4501 4502 #: kdecore/kcalendarsystemgregorian.cpp:328 4503 #: kdecore/kcalendarsystemhebrew.cpp:838 4504 #, fuzzy, kde-format 4505 #| msgctxt "Saturday" 4506 #| msgid "Sat" 4507 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4508 msgid "Sat" 4509 msgstr "شنبه" 4510 4511 #: kdecore/kcalendarsystemgregorian.cpp:330 4512 #: kdecore/kcalendarsystemhebrew.cpp:840 4513 #, fuzzy, kde-format 4514 #| msgctxt "Sunday" 4515 #| msgid "Sun" 4516 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4517 msgid "Sun" 4518 msgstr "یکشنبه" 4519 4520 #: kdecore/kcalendarsystemgregorian.cpp:337 4521 #: kdecore/kcalendarsystemhebrew.cpp:847 4522 #, fuzzy, kde-format 4523 #| msgid "Monday" 4524 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4525 msgid "Monday" 4526 msgstr "دوشنبه" 4527 4528 #: kdecore/kcalendarsystemgregorian.cpp:339 4529 #: kdecore/kcalendarsystemhebrew.cpp:849 4530 #, fuzzy, kde-format 4531 #| msgid "Tuesday" 4532 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4533 msgid "Tuesday" 4534 msgstr "سهشنبه" 4535 4536 #: kdecore/kcalendarsystemgregorian.cpp:341 4537 #: kdecore/kcalendarsystemhebrew.cpp:851 4538 #, fuzzy, kde-format 4539 #| msgid "Wednesday" 4540 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4541 msgid "Wednesday" 4542 msgstr "چهارشنبه" 4543 4544 #: kdecore/kcalendarsystemgregorian.cpp:343 4545 #: kdecore/kcalendarsystemhebrew.cpp:853 4546 #, fuzzy, kde-format 4547 #| msgid "Thursday" 4548 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4549 msgid "Thursday" 4550 msgstr "پنجشنبه" 4551 4552 #: kdecore/kcalendarsystemgregorian.cpp:345 4553 #: kdecore/kcalendarsystemhebrew.cpp:855 4554 #, fuzzy, kde-format 4555 #| msgid "Friday" 4556 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4557 msgid "Friday" 4558 msgstr "جمعه" 4559 4560 #: kdecore/kcalendarsystemgregorian.cpp:347 4561 #: kdecore/kcalendarsystemhebrew.cpp:857 4562 #, fuzzy, kde-format 4563 #| msgid "Saturday" 4564 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4565 msgid "Saturday" 4566 msgstr "شنبه" 4567 4568 #: kdecore/kcalendarsystemgregorian.cpp:349 4569 #: kdecore/kcalendarsystemhebrew.cpp:859 4570 #, fuzzy, kde-format 4571 #| msgid "Sunday" 4572 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4573 msgid "Sunday" 4574 msgstr "یکشنبه" 4575 4576 #: kdecore/kcalendarsystemhebrew.cpp:281 4577 #, kde-format 4578 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4579 msgid "Anno Mundi" 4580 msgstr "" 4581 4582 #: kdecore/kcalendarsystemhebrew.cpp:282 4583 #, kde-format 4584 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4585 msgid "AM" 4586 msgstr "" 4587 4588 #: kdecore/kcalendarsystemhebrew.cpp:283 4589 #, kde-format 4590 msgctxt "" 4591 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4592 msgid "%Ey %EC" 4593 msgstr "" 4594 4595 #: kdecore/kcalendarsystemhebrew.cpp:625 4596 #, kde-format 4597 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4598 msgid "T" 4599 msgstr "" 4600 4601 #: kdecore/kcalendarsystemhebrew.cpp:627 4602 #, kde-format 4603 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4604 msgid "H" 4605 msgstr "" 4606 4607 #: kdecore/kcalendarsystemhebrew.cpp:629 4608 #, kde-format 4609 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4610 msgid "K" 4611 msgstr "" 4612 4613 #: kdecore/kcalendarsystemhebrew.cpp:631 4614 #, kde-format 4615 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4616 msgid "T" 4617 msgstr "" 4618 4619 #: kdecore/kcalendarsystemhebrew.cpp:633 4620 #, kde-format 4621 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4622 msgid "S" 4623 msgstr "" 4624 4625 #: kdecore/kcalendarsystemhebrew.cpp:635 4626 #, kde-format 4627 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4628 msgid "A" 4629 msgstr "" 4630 4631 #: kdecore/kcalendarsystemhebrew.cpp:637 4632 #, kde-format 4633 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4634 msgid "N" 4635 msgstr "" 4636 4637 #: kdecore/kcalendarsystemhebrew.cpp:639 4638 #, kde-format 4639 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4640 msgid "I" 4641 msgstr "" 4642 4643 #: kdecore/kcalendarsystemhebrew.cpp:641 4644 #, kde-format 4645 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4646 msgid "S" 4647 msgstr "" 4648 4649 #: kdecore/kcalendarsystemhebrew.cpp:643 4650 #, kde-format 4651 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4652 msgid "T" 4653 msgstr "" 4654 4655 #: kdecore/kcalendarsystemhebrew.cpp:645 4656 #, kde-format 4657 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4658 msgid "A" 4659 msgstr "" 4660 4661 #: kdecore/kcalendarsystemhebrew.cpp:647 4662 #, kde-format 4663 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4664 msgid "E" 4665 msgstr "" 4666 4667 #: kdecore/kcalendarsystemhebrew.cpp:649 4668 #, kde-format 4669 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4670 msgid "A" 4671 msgstr "" 4672 4673 #: kdecore/kcalendarsystemhebrew.cpp:651 4674 #, kde-format 4675 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4676 msgid "A" 4677 msgstr "" 4678 4679 #: kdecore/kcalendarsystemhebrew.cpp:660 4680 #, fuzzy, kde-format 4681 #| msgctxt "of Tir short" 4682 #| msgid "of Tir" 4683 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4684 msgid "of Tis" 4685 msgstr "تیر" 4686 4687 #: kdecore/kcalendarsystemhebrew.cpp:662 4688 #, fuzzy, kde-format 4689 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4690 msgid "of Hes" 4691 msgstr "مهر" 4692 4693 #: kdecore/kcalendarsystemhebrew.cpp:664 4694 #, fuzzy, kde-format 4695 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4696 msgid "of Kis" 4697 msgstr "نیسان" 4698 4699 #: kdecore/kcalendarsystemhebrew.cpp:666 4700 #, fuzzy, kde-format 4701 #| msgid "of Tevet" 4702 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4703 msgid "of Tev" 4704 msgstr "تِوِت" 4705 4706 #: kdecore/kcalendarsystemhebrew.cpp:668 4707 #, fuzzy, kde-format 4708 #| msgid "of Shvat" 4709 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4710 msgid "of Shv" 4711 msgstr "شوات" 4712 4713 #: kdecore/kcalendarsystemhebrew.cpp:670 4714 #, fuzzy, kde-format 4715 #| msgid "of Adar" 4716 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4717 msgid "of Ada" 4718 msgstr "آدار" 4719 4720 #: kdecore/kcalendarsystemhebrew.cpp:672 4721 #, fuzzy, kde-format 4722 #| msgid "of Nisan" 4723 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4724 msgid "of Nis" 4725 msgstr "نیسان" 4726 4727 #: kdecore/kcalendarsystemhebrew.cpp:674 4728 #, fuzzy, kde-format 4729 #| msgid "of Iyar" 4730 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4731 msgid "of Iya" 4732 msgstr "لیار" 4733 4734 #: kdecore/kcalendarsystemhebrew.cpp:676 4735 #, fuzzy, kde-format 4736 #| msgid "of Sivan" 4737 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4738 msgid "of Siv" 4739 msgstr "سیوان" 4740 4741 #: kdecore/kcalendarsystemhebrew.cpp:678 4742 #, fuzzy, kde-format 4743 #| msgid "of Tamuz" 4744 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4745 msgid "of Tam" 4746 msgstr "تاموز" 4747 4748 #: kdecore/kcalendarsystemhebrew.cpp:680 4749 #, fuzzy, kde-format 4750 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4751 msgid "of Av" 4752 msgstr "آوریل" 4753 4754 #: kdecore/kcalendarsystemhebrew.cpp:682 4755 #, fuzzy, kde-format 4756 #| msgid "of Elul" 4757 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4758 msgid "of Elu" 4759 msgstr "اِلول" 4760 4761 #: kdecore/kcalendarsystemhebrew.cpp:684 4762 #, fuzzy, kde-format 4763 #| msgid "of Adar" 4764 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4765 msgid "of Ad1" 4766 msgstr "آدار" 4767 4768 #: kdecore/kcalendarsystemhebrew.cpp:686 4769 #, fuzzy, kde-format 4770 #| msgid "of Adar" 4771 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4772 msgid "of Ad2" 4773 msgstr "آدار" 4774 4775 #: kdecore/kcalendarsystemhebrew.cpp:695 4776 #, fuzzy, kde-format 4777 #| msgctxt "Tir short" 4778 #| msgid "Tir" 4779 msgctxt "Hebrew month 1 - KLocale::ShortName" 4780 msgid "Tis" 4781 msgstr "تیر" 4782 4783 #: kdecore/kcalendarsystemhebrew.cpp:697 4784 #, fuzzy, kde-format 4785 msgctxt "Hebrew month 2 - KLocale::ShortName" 4786 msgid "Hes" 4787 msgstr "بله" 4788 4789 #: kdecore/kcalendarsystemhebrew.cpp:699 4790 #, fuzzy, kde-format 4791 #| msgid "Kislev" 4792 msgctxt "Hebrew month 3 - KLocale::ShortName" 4793 msgid "Kis" 4794 msgstr "کیسلِو" 4795 4796 #: kdecore/kcalendarsystemhebrew.cpp:701 4797 #, fuzzy, kde-format 4798 #| msgid "Tevet" 4799 msgctxt "Hebrew month 4 - KLocale::ShortName" 4800 msgid "Tev" 4801 msgstr "تِوِت" 4802 4803 #: kdecore/kcalendarsystemhebrew.cpp:703 4804 #, fuzzy, kde-format 4805 #| msgid "Shvat" 4806 msgctxt "Hebrew month 5 - KLocale::ShortName" 4807 msgid "Shv" 4808 msgstr "شوات" 4809 4810 #: kdecore/kcalendarsystemhebrew.cpp:705 4811 #, fuzzy, kde-format 4812 #| msgid "Adar" 4813 msgctxt "Hebrew month 6 - KLocale::ShortName" 4814 msgid "Ada" 4815 msgstr "ادار" 4816 4817 #: kdecore/kcalendarsystemhebrew.cpp:707 4818 #, fuzzy, kde-format 4819 #| msgid "Nisan" 4820 msgctxt "Hebrew month 7 - KLocale::ShortName" 4821 msgid "Nis" 4822 msgstr "نیسان" 4823 4824 #: kdecore/kcalendarsystemhebrew.cpp:709 4825 #, fuzzy, kde-format 4826 #| msgid "Iyar" 4827 msgctxt "Hebrew month 8 - KLocale::ShortName" 4828 msgid "Iya" 4829 msgstr "لیار" 4830 4831 #: kdecore/kcalendarsystemhebrew.cpp:711 4832 #, fuzzy, kde-format 4833 #| msgid "Sivan" 4834 msgctxt "Hebrew month 9 - KLocale::ShortName" 4835 msgid "Siv" 4836 msgstr "سیوان" 4837 4838 #: kdecore/kcalendarsystemhebrew.cpp:713 4839 #, fuzzy, kde-format 4840 #| msgid "Tamuz" 4841 msgctxt "Hebrew month 10 - KLocale::ShortName" 4842 msgid "Tam" 4843 msgstr "تاموز" 4844 4845 #: kdecore/kcalendarsystemhebrew.cpp:715 4846 #, kde-format 4847 msgctxt "Hebrew month 11 - KLocale::ShortName" 4848 msgid "Av" 4849 msgstr "" 4850 4851 #: kdecore/kcalendarsystemhebrew.cpp:717 4852 #, fuzzy, kde-format 4853 #| msgid "Elul" 4854 msgctxt "Hebrew month 12 - KLocale::ShortName" 4855 msgid "Elu" 4856 msgstr "اِلول" 4857 4858 #: kdecore/kcalendarsystemhebrew.cpp:719 4859 #, fuzzy, kde-format 4860 #| msgid "Ahd" 4861 msgctxt "Hebrew month 13 - KLocale::ShortName" 4862 msgid "Ad1" 4863 msgstr "یکشنبه" 4864 4865 #: kdecore/kcalendarsystemhebrew.cpp:721 4866 #, fuzzy, kde-format 4867 #| msgid "Ahd" 4868 msgctxt "Hebrew month 14 - KLocale::ShortName" 4869 msgid "Ad2" 4870 msgstr "یکشنبه" 4871 4872 #: kdecore/kcalendarsystemhebrew.cpp:730 4873 #, fuzzy, kde-format 4874 #| msgid "of Tishrey" 4875 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4876 msgid "of Tishrey" 4877 msgstr "تیشرِی" 4878 4879 #: kdecore/kcalendarsystemhebrew.cpp:732 4880 #, fuzzy, kde-format 4881 #| msgid "of Heshvan" 4882 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4883 msgid "of Heshvan" 4884 msgstr "هشوان" 4885 4886 #: kdecore/kcalendarsystemhebrew.cpp:734 4887 #, fuzzy, kde-format 4888 #| msgid "of Kislev" 4889 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4890 msgid "of Kislev" 4891 msgstr "کیسلِو" 4892 4893 #: kdecore/kcalendarsystemhebrew.cpp:736 4894 #, fuzzy, kde-format 4895 #| msgid "of Tevet" 4896 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4897 msgid "of Tevet" 4898 msgstr "تِوِت" 4899 4900 #: kdecore/kcalendarsystemhebrew.cpp:738 4901 #, fuzzy, kde-format 4902 #| msgid "of Shvat" 4903 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4904 msgid "of Shvat" 4905 msgstr "شوات" 4906 4907 #: kdecore/kcalendarsystemhebrew.cpp:740 4908 #, fuzzy, kde-format 4909 #| msgid "of Adar" 4910 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4911 msgid "of Adar" 4912 msgstr "آدار" 4913 4914 #: kdecore/kcalendarsystemhebrew.cpp:742 4915 #, fuzzy, kde-format 4916 #| msgid "of Nisan" 4917 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4918 msgid "of Nisan" 4919 msgstr "نیسان" 4920 4921 #: kdecore/kcalendarsystemhebrew.cpp:744 4922 #, fuzzy, kde-format 4923 #| msgid "of Iyar" 4924 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4925 msgid "of Iyar" 4926 msgstr "لیار" 4927 4928 #: kdecore/kcalendarsystemhebrew.cpp:746 4929 #, fuzzy, kde-format 4930 #| msgid "of Sivan" 4931 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4932 msgid "of Sivan" 4933 msgstr "سیوان" 4934 4935 #: kdecore/kcalendarsystemhebrew.cpp:748 4936 #, fuzzy, kde-format 4937 #| msgid "of Tamuz" 4938 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4939 msgid "of Tamuz" 4940 msgstr "تاموز" 4941 4942 #: kdecore/kcalendarsystemhebrew.cpp:750 4943 #, fuzzy, kde-format 4944 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4945 msgid "of Av" 4946 msgstr "آوریل" 4947 4948 #: kdecore/kcalendarsystemhebrew.cpp:752 4949 #, fuzzy, kde-format 4950 #| msgid "of Elul" 4951 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4952 msgid "of Elul" 4953 msgstr "اِلول" 4954 4955 #: kdecore/kcalendarsystemhebrew.cpp:754 4956 #, fuzzy, kde-format 4957 #| msgid "of Adar I" 4958 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4959 msgid "of Adar I" 4960 msgstr "ادار I" 4961 4962 #: kdecore/kcalendarsystemhebrew.cpp:756 4963 #, fuzzy, kde-format 4964 #| msgid "of Adar II" 4965 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4966 msgid "of Adar II" 4967 msgstr "ادار II" 4968 4969 #: kdecore/kcalendarsystemhebrew.cpp:765 4970 #, fuzzy, kde-format 4971 #| msgid "Tishrey" 4972 msgctxt "Hebrew month 1 - KLocale::LongName" 4973 msgid "Tishrey" 4974 msgstr "تیشرِی" 4975 4976 #: kdecore/kcalendarsystemhebrew.cpp:767 4977 #, fuzzy, kde-format 4978 #| msgid "Heshvan" 4979 msgctxt "Hebrew month 2 - KLocale::LongName" 4980 msgid "Heshvan" 4981 msgstr "هشوان" 4982 4983 #: kdecore/kcalendarsystemhebrew.cpp:769 4984 #, fuzzy, kde-format 4985 #| msgid "Kislev" 4986 msgctxt "Hebrew month 3 - KLocale::LongName" 4987 msgid "Kislev" 4988 msgstr "کیسلِو" 4989 4990 #: kdecore/kcalendarsystemhebrew.cpp:771 4991 #, fuzzy, kde-format 4992 #| msgid "Tevet" 4993 msgctxt "Hebrew month 4 - KLocale::LongName" 4994 msgid "Tevet" 4995 msgstr "تِوِت" 4996 4997 #: kdecore/kcalendarsystemhebrew.cpp:773 4998 #, fuzzy, kde-format 4999 #| msgid "Shvat" 5000 msgctxt "Hebrew month 5 - KLocale::LongName" 5001 msgid "Shvat" 5002 msgstr "شوات" 5003 5004 #: kdecore/kcalendarsystemhebrew.cpp:775 5005 #, fuzzy, kde-format 5006 #| msgid "Adar" 5007 msgctxt "Hebrew month 6 - KLocale::LongName" 5008 msgid "Adar" 5009 msgstr "ادار" 5010 5011 #: kdecore/kcalendarsystemhebrew.cpp:777 5012 #, fuzzy, kde-format 5013 #| msgid "Nisan" 5014 msgctxt "Hebrew month 7 - KLocale::LongName" 5015 msgid "Nisan" 5016 msgstr "نیسان" 5017 5018 #: kdecore/kcalendarsystemhebrew.cpp:779 5019 #, fuzzy, kde-format 5020 #| msgid "Iyar" 5021 msgctxt "Hebrew month 8 - KLocale::LongName" 5022 msgid "Iyar" 5023 msgstr "لیار" 5024 5025 #: kdecore/kcalendarsystemhebrew.cpp:781 5026 #, fuzzy, kde-format 5027 #| msgid "Sivan" 5028 msgctxt "Hebrew month 9 - KLocale::LongName" 5029 msgid "Sivan" 5030 msgstr "سیوان" 5031 5032 #: kdecore/kcalendarsystemhebrew.cpp:783 5033 #, fuzzy, kde-format 5034 #| msgid "Tamuz" 5035 msgctxt "Hebrew month 10 - KLocale::LongName" 5036 msgid "Tamuz" 5037 msgstr "تاموز" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:785 5040 #, kde-format 5041 msgctxt "Hebrew month 11 - KLocale::LongName" 5042 msgid "Av" 5043 msgstr "" 5044 5045 #: kdecore/kcalendarsystemhebrew.cpp:787 5046 #, fuzzy, kde-format 5047 #| msgid "Elul" 5048 msgctxt "Hebrew month 12 - KLocale::LongName" 5049 msgid "Elul" 5050 msgstr "اِلول" 5051 5052 #: kdecore/kcalendarsystemhebrew.cpp:789 5053 #, fuzzy, kde-format 5054 #| msgid "Adar I" 5055 msgctxt "Hebrew month 13 - KLocale::LongName" 5056 msgid "Adar I" 5057 msgstr "ادار I" 5058 5059 #: kdecore/kcalendarsystemhebrew.cpp:791 5060 #, fuzzy, kde-format 5061 #| msgid "Adar II" 5062 msgctxt "Hebrew month 14 - KLocale::LongName" 5063 msgid "Adar II" 5064 msgstr "ادار II" 5065 5066 #: kdecore/kcalendarsystemindiannational.cpp:66 5067 #, fuzzy, kde-format 5068 #| msgid "Safar" 5069 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5070 msgid "Saka Era" 5071 msgstr "صفر" 5072 5073 #: kdecore/kcalendarsystemindiannational.cpp:67 5074 #, kde-format 5075 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5076 msgid "SE" 5077 msgstr "" 5078 5079 #: kdecore/kcalendarsystemindiannational.cpp:68 5080 #, kde-format 5081 msgctxt "" 5082 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5083 "2000 SE" 5084 msgid "%Ey %EC" 5085 msgstr "" 5086 5087 #: kdecore/kcalendarsystemindiannational.cpp:158 5088 #, kde-format 5089 msgctxt "Indian National month 1 - KLocale::NarrowName" 5090 msgid "C" 5091 msgstr "" 5092 5093 #: kdecore/kcalendarsystemindiannational.cpp:160 5094 #, kde-format 5095 msgctxt "Indian National month 2 - KLocale::NarrowName" 5096 msgid "V" 5097 msgstr "" 5098 5099 #: kdecore/kcalendarsystemindiannational.cpp:162 5100 #, kde-format 5101 msgctxt "Indian National month 3 - KLocale::NarrowName" 5102 msgid "J" 5103 msgstr "" 5104 5105 #: kdecore/kcalendarsystemindiannational.cpp:164 5106 #, fuzzy, kde-format 5107 msgctxt "Indian National month 4 - KLocale::NarrowName" 5108 msgid "Ā" 5109 msgstr "خرداد" 5110 5111 #: kdecore/kcalendarsystemindiannational.cpp:166 5112 #, kde-format 5113 msgctxt "Indian National month 5 - KLocale::NarrowName" 5114 msgid "S" 5115 msgstr "" 5116 5117 #: kdecore/kcalendarsystemindiannational.cpp:168 5118 #, kde-format 5119 msgctxt "Indian National month 6 - KLocale::NarrowName" 5120 msgid "B" 5121 msgstr "" 5122 5123 #: kdecore/kcalendarsystemindiannational.cpp:170 5124 #, fuzzy, kde-format 5125 msgctxt "Indian National month 7 - KLocale::NarrowName" 5126 msgid "Ā" 5127 msgstr "خرداد" 5128 5129 #: kdecore/kcalendarsystemindiannational.cpp:172 5130 #, kde-format 5131 msgctxt "Indian National month 8 - KLocale::NarrowName" 5132 msgid "K" 5133 msgstr "" 5134 5135 #: kdecore/kcalendarsystemindiannational.cpp:174 5136 #, kde-format 5137 msgctxt "Indian National month 9 - KLocale::NarrowName" 5138 msgid "A" 5139 msgstr "" 5140 5141 #: kdecore/kcalendarsystemindiannational.cpp:176 5142 #, kde-format 5143 msgctxt "Indian National month 10 - KLocale::NarrowName" 5144 msgid "P" 5145 msgstr "" 5146 5147 #: kdecore/kcalendarsystemindiannational.cpp:178 5148 #, kde-format 5149 msgctxt "Indian National month 11 - KLocale::NarrowName" 5150 msgid "M" 5151 msgstr "" 5152 5153 #: kdecore/kcalendarsystemindiannational.cpp:180 5154 #, kde-format 5155 msgctxt "Indian National month 12 - KLocale::NarrowName" 5156 msgid "P" 5157 msgstr "" 5158 5159 #: kdecore/kcalendarsystemindiannational.cpp:189 5160 #, fuzzy, kde-format 5161 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5162 msgid "of Cha" 5163 msgstr "شهریور" 5164 5165 #: kdecore/kcalendarsystemindiannational.cpp:191 5166 #, fuzzy, kde-format 5167 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5168 msgid "of Vai" 5169 msgstr "فروردین" 5170 5171 #: kdecore/kcalendarsystemindiannational.cpp:193 5172 #, fuzzy, kde-format 5173 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5174 msgid "of Jya" 5175 msgstr "ژانویه" 5176 5177 #: kdecore/kcalendarsystemindiannational.cpp:195 5178 #, fuzzy, kde-format 5179 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5180 msgid "of Āsh" 5181 msgstr "خرداد" 5182 5183 #: kdecore/kcalendarsystemindiannational.cpp:197 5184 #, fuzzy, kde-format 5185 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5186 msgid "of Shr" 5187 msgstr "شهریور" 5188 5189 #: kdecore/kcalendarsystemindiannational.cpp:199 5190 #, fuzzy, kde-format 5191 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5192 msgid "of Bhā" 5193 msgstr "بهمن" 5194 5195 #: kdecore/kcalendarsystemindiannational.cpp:201 5196 #, fuzzy, kde-format 5197 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5198 msgid "of Āsw" 5199 msgstr "اسفند" 5200 5201 #: kdecore/kcalendarsystemindiannational.cpp:203 5202 #, fuzzy, kde-format 5203 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5204 msgid "of Kār" 5205 msgstr "فروردین" 5206 5207 #: kdecore/kcalendarsystemindiannational.cpp:205 5208 #, fuzzy, kde-format 5209 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5210 msgid "of Agr" 5211 msgstr "آوریل" 5212 5213 #: kdecore/kcalendarsystemindiannational.cpp:207 5214 #, fuzzy, kde-format 5215 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5216 msgid "of Pau" 5217 msgstr "تاموز" 5218 5219 #: kdecore/kcalendarsystemindiannational.cpp:209 5220 #, fuzzy, kde-format 5221 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5222 msgid "of Māg" 5223 msgstr "مرداد" 5224 5225 #: kdecore/kcalendarsystemindiannational.cpp:211 5226 #, fuzzy, kde-format 5227 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5228 msgid "of Phā" 5229 msgstr "خرداد" 5230 5231 #: kdecore/kcalendarsystemindiannational.cpp:220 5232 #, fuzzy, kde-format 5233 msgctxt "Indian National month 1 - KLocale::ShortName" 5234 msgid "Cha" 5235 msgstr "پنجشنبه" 5236 5237 #: kdecore/kcalendarsystemindiannational.cpp:222 5238 #, fuzzy, kde-format 5239 msgctxt "Indian National month 2 - KLocale::ShortName" 5240 msgid "Vai" 5241 msgstr "فروردین" 5242 5243 #: kdecore/kcalendarsystemindiannational.cpp:224 5244 #, fuzzy, kde-format 5245 msgctxt "Indian National month 3 - KLocale::ShortName" 5246 msgid "Jya" 5247 msgstr "ژانویه" 5248 5249 #: kdecore/kcalendarsystemindiannational.cpp:226 5250 #, fuzzy, kde-format 5251 msgctxt "Indian National month 4 - KLocale::ShortName" 5252 msgid "Āsh" 5253 msgstr "خرداد" 5254 5255 #: kdecore/kcalendarsystemindiannational.cpp:228 5256 #, fuzzy, kde-format 5257 msgctxt "Indian National month 5 - KLocale::ShortName" 5258 msgid "Shr" 5259 msgstr "شهریور" 5260 5261 #: kdecore/kcalendarsystemindiannational.cpp:230 5262 #, fuzzy, kde-format 5263 msgctxt "Indian National month 6 - KLocale::ShortName" 5264 msgid "Bhā" 5265 msgstr "بهمن" 5266 5267 #: kdecore/kcalendarsystemindiannational.cpp:232 5268 #, fuzzy, kde-format 5269 msgctxt "Indian National month 7 - KLocale::ShortName" 5270 msgid "Āsw" 5271 msgstr "اسفند" 5272 5273 #: kdecore/kcalendarsystemindiannational.cpp:234 5274 #, fuzzy, kde-format 5275 msgctxt "Indian National month 8 - KLocale::ShortName" 5276 msgid "Kār" 5277 msgstr "فروردین" 5278 5279 #: kdecore/kcalendarsystemindiannational.cpp:236 5280 #, fuzzy, kde-format 5281 msgctxt "Indian National month 9 - KLocale::ShortName" 5282 msgid "Agr" 5283 msgstr "چهارشنبه" 5284 5285 #: kdecore/kcalendarsystemindiannational.cpp:238 5286 #, fuzzy, kde-format 5287 msgctxt "Indian National month 10 - KLocale::ShortName" 5288 msgid "Pau" 5289 msgstr "مکث" 5290 5291 #: kdecore/kcalendarsystemindiannational.cpp:240 5292 #, fuzzy, kde-format 5293 msgctxt "Indian National month 11 - KLocale::ShortName" 5294 msgid "Māg" 5295 msgstr "مرداد" 5296 5297 #: kdecore/kcalendarsystemindiannational.cpp:242 5298 #, fuzzy, kde-format 5299 msgctxt "Indian National month 12 - KLocale::ShortName" 5300 msgid "Phā" 5301 msgstr "خرداد" 5302 5303 #: kdecore/kcalendarsystemindiannational.cpp:251 5304 #, fuzzy, kde-format 5305 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5306 msgid "of Chaitra" 5307 msgstr " محرم" 5308 5309 #: kdecore/kcalendarsystemindiannational.cpp:253 5310 #, fuzzy, kde-format 5311 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5312 msgid "of Vaishākh" 5313 msgstr "فروردین" 5314 5315 #: kdecore/kcalendarsystemindiannational.cpp:255 5316 #, fuzzy, kde-format 5317 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5318 msgid "of Jyaishtha" 5319 msgstr "نیسان" 5320 5321 #: kdecore/kcalendarsystemindiannational.cpp:257 5322 #, fuzzy, kde-format 5323 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5324 msgid "of Āshādha" 5325 msgstr "خرداد" 5326 5327 #: kdecore/kcalendarsystemindiannational.cpp:259 5328 #, fuzzy, kde-format 5329 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5330 msgid "of Shrāvana" 5331 msgstr "شوات" 5332 5333 #: kdecore/kcalendarsystemindiannational.cpp:261 5334 #, fuzzy, kde-format 5335 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5336 msgid "of Bhādrapad" 5337 msgstr "خرداد" 5338 5339 #: kdecore/kcalendarsystemindiannational.cpp:263 5340 #, fuzzy, kde-format 5341 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5342 msgid "of Āshwin" 5343 msgstr "هشوان" 5344 5345 #: kdecore/kcalendarsystemindiannational.cpp:265 5346 #, fuzzy, kde-format 5347 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5348 msgid "of Kārtik" 5349 msgstr "فروردین" 5350 5351 #: kdecore/kcalendarsystemindiannational.cpp:267 5352 #, fuzzy, kde-format 5353 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5354 msgid "of Agrahayana" 5355 msgstr "بهمن" 5356 5357 #: kdecore/kcalendarsystemindiannational.cpp:269 5358 #, fuzzy, kde-format 5359 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5360 msgid "of Paush" 5361 msgstr "بهمن" 5362 5363 #: kdecore/kcalendarsystemindiannational.cpp:271 5364 #, fuzzy, kde-format 5365 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5366 msgid "of Māgh" 5367 msgstr "مهر" 5368 5369 #: kdecore/kcalendarsystemindiannational.cpp:273 5370 #, fuzzy, kde-format 5371 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5372 msgid "of Phālgun" 5373 msgstr "خرداد" 5374 5375 #: kdecore/kcalendarsystemindiannational.cpp:282 5376 #, fuzzy, kde-format 5377 msgctxt "Indian National month 1 - KLocale::LongName" 5378 msgid "Chaitra" 5379 msgstr " محرم" 5380 5381 #: kdecore/kcalendarsystemindiannational.cpp:284 5382 #, fuzzy, kde-format 5383 msgctxt "Indian National month 2 - KLocale::LongName" 5384 msgid "Vaishākh" 5385 msgstr "فروردین" 5386 5387 #: kdecore/kcalendarsystemindiannational.cpp:286 5388 #, fuzzy, kde-format 5389 msgctxt "Indian National month 3 - KLocale::LongName" 5390 msgid "Jyaishtha" 5391 msgstr "نیسان" 5392 5393 #: kdecore/kcalendarsystemindiannational.cpp:288 5394 #, fuzzy, kde-format 5395 msgctxt "Indian National month 4 - KLocale::LongName" 5396 msgid "Āshādha" 5397 msgstr "خرداد" 5398 5399 #: kdecore/kcalendarsystemindiannational.cpp:290 5400 #, fuzzy, kde-format 5401 msgctxt "Indian National month 5 - KLocale::LongName" 5402 msgid "Shrāvana" 5403 msgstr "شوات" 5404 5405 #: kdecore/kcalendarsystemindiannational.cpp:292 5406 #, fuzzy, kde-format 5407 msgctxt "Indian National month 6 - KLocale::LongName" 5408 msgid "Bhādrapad" 5409 msgstr "خرداد" 5410 5411 #: kdecore/kcalendarsystemindiannational.cpp:294 5412 #, fuzzy, kde-format 5413 msgctxt "Indian National month 7 - KLocale::LongName" 5414 msgid "Āshwin" 5415 msgstr "هشوان" 5416 5417 #: kdecore/kcalendarsystemindiannational.cpp:296 5418 #, fuzzy, kde-format 5419 msgctxt "Indian National month 8 - KLocale::LongName" 5420 msgid "Kārtik" 5421 msgstr "فروردین" 5422 5423 #: kdecore/kcalendarsystemindiannational.cpp:298 5424 #, fuzzy, kde-format 5425 msgctxt "Indian National month 9 - KLocale::LongName" 5426 msgid "Agrahayana" 5427 msgstr "ثانا" 5428 5429 #: kdecore/kcalendarsystemindiannational.cpp:300 5430 #, fuzzy, kde-format 5431 msgctxt "Indian National month 10 - KLocale::LongName" 5432 msgid "Paush" 5433 msgstr "مکث" 5434 5435 #: kdecore/kcalendarsystemindiannational.cpp:302 5436 #, fuzzy, kde-format 5437 msgctxt "Indian National month 11 - KLocale::LongName" 5438 msgid "Māgh" 5439 msgstr "مهر" 5440 5441 #: kdecore/kcalendarsystemindiannational.cpp:304 5442 #, fuzzy, kde-format 5443 msgctxt "Indian National month 12 - KLocale::LongName" 5444 msgid "Phālgun" 5445 msgstr "خرداد" 5446 5447 #: kdecore/kcalendarsystemindiannational.cpp:317 5448 #, kde-format 5449 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5450 msgid "S" 5451 msgstr "" 5452 5453 #: kdecore/kcalendarsystemindiannational.cpp:319 5454 #, kde-format 5455 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5456 msgid "M" 5457 msgstr "" 5458 5459 #: kdecore/kcalendarsystemindiannational.cpp:321 5460 #, kde-format 5461 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5462 msgid "B" 5463 msgstr "" 5464 5465 #: kdecore/kcalendarsystemindiannational.cpp:323 5466 #, kde-format 5467 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5468 msgid "G" 5469 msgstr "" 5470 5471 #: kdecore/kcalendarsystemindiannational.cpp:325 5472 #, kde-format 5473 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5474 msgid "S" 5475 msgstr "" 5476 5477 #: kdecore/kcalendarsystemindiannational.cpp:327 5478 #, kde-format 5479 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5480 msgid "S" 5481 msgstr "" 5482 5483 #: kdecore/kcalendarsystemindiannational.cpp:329 5484 #, kde-format 5485 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5486 msgid "R" 5487 msgstr "" 5488 5489 #: kdecore/kcalendarsystemindiannational.cpp:338 5490 #, fuzzy, kde-format 5491 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5492 msgid "Som" 5493 msgstr "جمعه" 5494 5495 #: kdecore/kcalendarsystemindiannational.cpp:340 5496 #, kde-format 5497 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5498 msgid "Mañ" 5499 msgstr "" 5500 5501 #: kdecore/kcalendarsystemindiannational.cpp:342 5502 #, kde-format 5503 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5504 msgid "Bud" 5505 msgstr "" 5506 5507 #: kdecore/kcalendarsystemindiannational.cpp:344 5508 #, kde-format 5509 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5510 msgid "Gur" 5511 msgstr "" 5512 5513 #: kdecore/kcalendarsystemindiannational.cpp:346 5514 #, fuzzy, kde-format 5515 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5516 msgid "Suk" 5517 msgstr "یکشنبه" 5518 5519 #: kdecore/kcalendarsystemindiannational.cpp:348 5520 #, fuzzy, kde-format 5521 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5522 msgid "San" 5523 msgstr "سیوان" 5524 5525 #: kdecore/kcalendarsystemindiannational.cpp:350 5526 #, kde-format 5527 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5528 msgid "Rav" 5529 msgstr "" 5530 5531 #: kdecore/kcalendarsystemindiannational.cpp:357 5532 #, kde-format 5533 msgctxt "Indian National weekday 1 - KLocale::LongName" 5534 msgid "Somavãra" 5535 msgstr "" 5536 5537 #: kdecore/kcalendarsystemindiannational.cpp:359 5538 #, kde-format 5539 msgctxt "Indian National weekday 2 - KLocale::LongName" 5540 msgid "Mañgalvã" 5541 msgstr "" 5542 5543 #: kdecore/kcalendarsystemindiannational.cpp:361 5544 #, kde-format 5545 msgctxt "Indian National weekday 3 - KLocale::LongName" 5546 msgid "Budhavãra" 5547 msgstr "" 5548 5549 #: kdecore/kcalendarsystemindiannational.cpp:363 5550 #, kde-format 5551 msgctxt "Indian National weekday 4 - KLocale::LongName" 5552 msgid "Guruvãra" 5553 msgstr "" 5554 5555 #: kdecore/kcalendarsystemindiannational.cpp:365 5556 #, kde-format 5557 msgctxt "Indian National weekday 5 - KLocale::LongName" 5558 msgid "Sukravãra" 5559 msgstr "" 5560 5561 #: kdecore/kcalendarsystemindiannational.cpp:367 5562 #, kde-format 5563 msgctxt "Indian National weekday 6 - KLocale::LongName" 5564 msgid "Sanivãra" 5565 msgstr "" 5566 5567 #: kdecore/kcalendarsystemindiannational.cpp:369 5568 #, kde-format 5569 msgctxt "Indian National weekday 7 - KLocale::LongName" 5570 msgid "Raviãra" 5571 msgstr "" 5572 5573 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5574 #, kde-format 5575 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5576 msgid "Anno Hegirae" 5577 msgstr "" 5578 5579 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5580 #, kde-format 5581 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5582 msgid "AH" 5583 msgstr "" 5584 5585 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5586 #, kde-format 5587 msgctxt "" 5588 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5589 msgid "%Ey %EC" 5590 msgstr "" 5591 5592 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5593 #, kde-format 5594 msgctxt "Hijri month 1 - KLocale::NarrowName" 5595 msgid "M" 5596 msgstr "" 5597 5598 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5599 #, kde-format 5600 msgctxt "Hijri month 2 - KLocale::NarrowName" 5601 msgid "S" 5602 msgstr "" 5603 5604 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5605 #, kde-format 5606 msgctxt "Hijri month 3 - KLocale::NarrowName" 5607 msgid "A" 5608 msgstr "" 5609 5610 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5611 #, kde-format 5612 msgctxt "Hijri month 4 - KLocale::NarrowName" 5613 msgid "T" 5614 msgstr "" 5615 5616 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5617 #, kde-format 5618 msgctxt "Hijri month 5 - KLocale::NarrowName" 5619 msgid "A" 5620 msgstr "" 5621 5622 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5623 #, kde-format 5624 msgctxt "Hijri month 6 - KLocale::NarrowName" 5625 msgid "T" 5626 msgstr "" 5627 5628 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5629 #, kde-format 5630 msgctxt "Hijri month 7 - KLocale::NarrowName" 5631 msgid "R" 5632 msgstr "" 5633 5634 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5635 #, kde-format 5636 msgctxt "Hijri month 8 - KLocale::NarrowName" 5637 msgid "S" 5638 msgstr "" 5639 5640 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5641 #, kde-format 5642 msgctxt "Hijri month 9 - KLocale::NarrowName" 5643 msgid "R" 5644 msgstr "" 5645 5646 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5647 #, kde-format 5648 msgctxt "Hijri month 10 - KLocale::NarrowName" 5649 msgid "S" 5650 msgstr "" 5651 5652 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5653 #, kde-format 5654 msgctxt "Hijri month 11 - KLocale::NarrowName" 5655 msgid "Q" 5656 msgstr "" 5657 5658 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5659 #, kde-format 5660 msgctxt "Hijri month 12 - KLocale::NarrowName" 5661 msgid "H" 5662 msgstr "" 5663 5664 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5665 #, fuzzy, kde-format 5666 #| msgctxt "of Mehr short" 5667 #| msgid "of Meh" 5668 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5669 msgid "of Muh" 5670 msgstr "مهر" 5671 5672 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5673 #, fuzzy, kde-format 5674 #| msgid "of Safar" 5675 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5676 msgid "of Saf" 5677 msgstr " صفر" 5678 5679 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5680 #, fuzzy, kde-format 5681 #| msgid "of R. Awal" 5682 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5683 msgid "of R.A" 5684 msgstr " ربیعالاول" 5685 5686 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5687 #, fuzzy, kde-format 5688 #| msgid "of R. Thaani" 5689 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5690 msgid "of R.T" 5691 msgstr "ربیعالثانی" 5692 5693 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5694 #, fuzzy, kde-format 5695 #| msgid "of J. Awal" 5696 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5697 msgid "of J.A" 5698 msgstr " جمادیالاول" 5699 5700 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5701 #, fuzzy, kde-format 5702 #| msgid "of J. Thaani" 5703 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5704 msgid "of J.T" 5705 msgstr " جمادیالثانی" 5706 5707 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5708 #, fuzzy, kde-format 5709 #| msgid "of Rajab" 5710 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5711 msgid "of Raj" 5712 msgstr "رجب" 5713 5714 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5715 #, fuzzy, kde-format 5716 #| msgctxt "of Shahrivar short" 5717 #| msgid "of Sha" 5718 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5719 msgid "of Sha" 5720 msgstr "شهریور" 5721 5722 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5723 #, fuzzy, kde-format 5724 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5725 msgid "of Ram" 5726 msgstr "تاموز" 5727 5728 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5729 #, fuzzy, kde-format 5730 #| msgctxt "of Shahrivar short" 5731 #| msgid "of Sha" 5732 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5733 msgid "of Shw" 5734 msgstr "شهریور" 5735 5736 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5737 #, fuzzy, kde-format 5738 #| msgid "of Qi`dah" 5739 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5740 msgid "of Qid" 5741 msgstr "ذیالقعده" 5742 5743 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5744 #, fuzzy, kde-format 5745 #| msgid "of Hijjah" 5746 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5747 msgid "of Hij" 5748 msgstr " ذیالحجه" 5749 5750 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5751 #, fuzzy, kde-format 5752 #| msgctxt "Mehr short" 5753 #| msgid "Meh" 5754 msgctxt "Hijri month 1 - KLocale::ShortName" 5755 msgid "Muh" 5756 msgstr "مهر" 5757 5758 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5759 #, fuzzy, kde-format 5760 #| msgid "Safar" 5761 msgctxt "Hijri month 2 - KLocale::ShortName" 5762 msgid "Saf" 5763 msgstr "صفر" 5764 5765 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5766 #, fuzzy, kde-format 5767 #| msgid "R. Awal" 5768 msgctxt "Hijri month 3 - KLocale::ShortName" 5769 msgid "R.A" 5770 msgstr "ربیعالاول" 5771 5772 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5773 #, kde-format 5774 msgctxt "Hijri month 4 - KLocale::ShortName" 5775 msgid "R.T" 5776 msgstr "" 5777 5778 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5779 #, fuzzy, kde-format 5780 #| msgid "J. Awal" 5781 msgctxt "Hijri month 5 - KLocale::ShortName" 5782 msgid "J.A" 5783 msgstr "جمادیالاول" 5784 5785 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5786 #, kde-format 5787 msgctxt "Hijri month 6 - KLocale::ShortName" 5788 msgid "J.T" 5789 msgstr "" 5790 5791 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5792 #, fuzzy, kde-format 5793 #| msgid "Rajab" 5794 msgctxt "Hijri month 7 - KLocale::ShortName" 5795 msgid "Raj" 5796 msgstr "رجب" 5797 5798 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5799 #, fuzzy, kde-format 5800 #| msgctxt "Shahrivar short" 5801 #| msgid "Sha" 5802 msgctxt "Hijri month 8 - KLocale::ShortName" 5803 msgid "Sha" 5804 msgstr "شهریور" 5805 5806 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5807 #, fuzzy, kde-format 5808 msgctxt "Hijri month 9 - KLocale::ShortName" 5809 msgid "Ram" 5810 msgstr "قبل از ظهر" 5811 5812 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5813 #, fuzzy, kde-format 5814 #| msgctxt "Shahrivar short" 5815 #| msgid "Sha" 5816 msgctxt "Hijri month 10 - KLocale::ShortName" 5817 msgid "Shw" 5818 msgstr "شهریور" 5819 5820 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5821 #, fuzzy, kde-format 5822 #| msgid "Qi`dah" 5823 msgctxt "Hijri month 11 - KLocale::ShortName" 5824 msgid "Qid" 5825 msgstr "قعده" 5826 5827 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5828 #, fuzzy, kde-format 5829 #| msgctxt "@item Calendar system" 5830 #| msgid "Hijri" 5831 msgctxt "Hijri month 12 - KLocale::ShortName" 5832 msgid "Hij" 5833 msgstr "هجری" 5834 5835 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5836 #, fuzzy, kde-format 5837 #| msgid "of Muharram" 5838 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5839 msgid "of Muharram" 5840 msgstr " محرم" 5841 5842 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5843 #, fuzzy, kde-format 5844 #| msgid "of Safar" 5845 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5846 msgid "of Safar" 5847 msgstr " صفر" 5848 5849 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5850 #, fuzzy, kde-format 5851 #| msgid "of Rabi` al-Awal" 5852 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5853 msgid "of Rabi` al-Awal" 5854 msgstr " ربیعالاول" 5855 5856 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5857 #, fuzzy, kde-format 5858 #| msgid "of Rabi` al-Thaani" 5859 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5860 msgid "of Rabi` al-Thaani" 5861 msgstr " ربیعالثانی" 5862 5863 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5864 #, fuzzy, kde-format 5865 #| msgid "of Jumaada al-Awal" 5866 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5867 msgid "of Jumaada al-Awal" 5868 msgstr " جمادیالاول" 5869 5870 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5871 #, fuzzy, kde-format 5872 #| msgid "of Jumaada al-Thaani" 5873 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5874 msgid "of Jumaada al-Thaani" 5875 msgstr "جمادیالثانی" 5876 5877 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5878 #, fuzzy, kde-format 5879 #| msgid "of Rajab" 5880 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5881 msgid "of Rajab" 5882 msgstr "رجب" 5883 5884 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5885 #, fuzzy, kde-format 5886 #| msgid "of Sha`ban" 5887 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5888 msgid "of Sha`ban" 5889 msgstr " شعبان" 5890 5891 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5892 #, fuzzy, kde-format 5893 #| msgid "of Ramadan" 5894 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5895 msgid "of Ramadan" 5896 msgstr "رمضان" 5897 5898 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5899 #, fuzzy, kde-format 5900 #| msgid "of Shawwal" 5901 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5902 msgid "of Shawwal" 5903 msgstr " شوال" 5904 5905 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5906 #, fuzzy, kde-format 5907 #| msgid "of Thu al-Qi`dah" 5908 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5909 msgid "of Thu al-Qi`dah" 5910 msgstr "ذیالقعده" 5911 5912 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5913 #, fuzzy, kde-format 5914 #| msgid "of Thu al-Hijjah" 5915 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5916 msgid "of Thu al-Hijjah" 5917 msgstr " ذیالحجه" 5918 5919 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5920 #, fuzzy, kde-format 5921 #| msgid "Muharram" 5922 msgctxt "Hijri month 1 - KLocale::LongName" 5923 msgid "Muharram" 5924 msgstr "محرم" 5925 5926 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5927 #, fuzzy, kde-format 5928 #| msgid "Safar" 5929 msgctxt "Hijri month 2 - KLocale::LongName" 5930 msgid "Safar" 5931 msgstr "صفر" 5932 5933 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5934 #, fuzzy, kde-format 5935 #| msgid "Rabi` al-Awal" 5936 msgctxt "Hijri month 3 - KLocale::LongName" 5937 msgid "Rabi` al-Awal" 5938 msgstr "ربیعالاول" 5939 5940 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5941 #, fuzzy, kde-format 5942 #| msgid "Rabi` al-Thaani" 5943 msgctxt "Hijri month 4 - KLocale::LongName" 5944 msgid "Rabi` al-Thaani" 5945 msgstr "ربیعالثانی" 5946 5947 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5948 #, fuzzy, kde-format 5949 #| msgid "Jumaada al-Awal" 5950 msgctxt "Hijri month 5 - KLocale::LongName" 5951 msgid "Jumaada al-Awal" 5952 msgstr "جمادیالاول" 5953 5954 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5955 #, fuzzy, kde-format 5956 #| msgid "Jumaada al-Thaani" 5957 msgctxt "Hijri month 6 - KLocale::LongName" 5958 msgid "Jumaada al-Thaani" 5959 msgstr "جمادیالثانی" 5960 5961 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5962 #, fuzzy, kde-format 5963 #| msgid "Rajab" 5964 msgctxt "Hijri month 7 - KLocale::LongName" 5965 msgid "Rajab" 5966 msgstr "رجب" 5967 5968 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5969 #, fuzzy, kde-format 5970 #| msgid "Sha`ban" 5971 msgctxt "Hijri month 8 - KLocale::LongName" 5972 msgid "Sha`ban" 5973 msgstr "شعبان" 5974 5975 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5976 #, fuzzy, kde-format 5977 #| msgid "Ramadan" 5978 msgctxt "Hijri month 9 - KLocale::LongName" 5979 msgid "Ramadan" 5980 msgstr "رمضان" 5981 5982 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5983 #, fuzzy, kde-format 5984 #| msgid "Shawwal" 5985 msgctxt "Hijri month 10 - KLocale::LongName" 5986 msgid "Shawwal" 5987 msgstr "شوال" 5988 5989 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5990 #, fuzzy, kde-format 5991 #| msgid "Thu al-Qi`dah" 5992 msgctxt "Hijri month 11 - KLocale::LongName" 5993 msgid "Thu al-Qi`dah" 5994 msgstr "ذیالقعده" 5995 5996 #: kdecore/kcalendarsystemislamiccivil.cpp:312 5997 #, fuzzy, kde-format 5998 #| msgid "Thu al-Hijjah" 5999 msgctxt "Hijri month 12 - KLocale::LongName" 6000 msgid "Thu al-Hijjah" 6001 msgstr "ذیالحجه" 6002 6003 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6004 #, kde-format 6005 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6006 msgid "I" 6007 msgstr "" 6008 6009 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6010 #, kde-format 6011 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6012 msgid "T" 6013 msgstr "" 6014 6015 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6016 #, kde-format 6017 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6018 msgid "A" 6019 msgstr "" 6020 6021 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6022 #, kde-format 6023 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6024 msgid "K" 6025 msgstr "" 6026 6027 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6028 #, kde-format 6029 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6030 msgid "J" 6031 msgstr "" 6032 6033 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6034 #, kde-format 6035 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6036 msgid "S" 6037 msgstr "" 6038 6039 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6040 #, kde-format 6041 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6042 msgid "A" 6043 msgstr "" 6044 6045 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6046 #, fuzzy, kde-format 6047 #| msgid "Ith" 6048 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6049 msgid "Ith" 6050 msgstr "دوشنبه" 6051 6052 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6053 #, fuzzy, kde-format 6054 #| msgid "Thl" 6055 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6056 msgid "Thl" 6057 msgstr "سهشنبه" 6058 6059 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6060 #, fuzzy, kde-format 6061 #| msgid "Arb" 6062 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6063 msgid "Arb" 6064 msgstr "چهارشنبه" 6065 6066 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6067 #, fuzzy, kde-format 6068 #| msgid "Kha" 6069 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6070 msgid "Kha" 6071 msgstr "پنجشنبه" 6072 6073 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6074 #, fuzzy, kde-format 6075 #| msgid "Jum" 6076 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6077 msgid "Jum" 6078 msgstr "جمعه" 6079 6080 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6081 #, fuzzy, kde-format 6082 #| msgid "Sab" 6083 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6084 msgid "Sab" 6085 msgstr "شنبه" 6086 6087 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6088 #, fuzzy, kde-format 6089 #| msgid "Ahd" 6090 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6091 msgid "Ahd" 6092 msgstr "یکشنبه" 6093 6094 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6095 #, fuzzy, kde-format 6096 #| msgid "Yaum al-Ithnain" 6097 msgctxt "Hijri weekday 1 - KLocale::LongName" 6098 msgid "Yaum al-Ithnain" 6099 msgstr "روز دوشنبه" 6100 6101 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6102 #, fuzzy, kde-format 6103 #| msgid "Yau al-Thulatha" 6104 msgctxt "Hijri weekday 2 - KLocale::LongName" 6105 msgid "Yau al-Thulatha" 6106 msgstr "روز سهشنبه" 6107 6108 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6109 #, fuzzy, kde-format 6110 #| msgid "Yaum al-Arbi'a" 6111 msgctxt "Hijri weekday 3 - KLocale::LongName" 6112 msgid "Yaum al-Arbi'a" 6113 msgstr "روز چهارشنبه" 6114 6115 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6116 #, fuzzy, kde-format 6117 #| msgid "Yaum al-Khamees" 6118 msgctxt "Hijri weekday 4 - KLocale::LongName" 6119 msgid "Yaum al-Khamees" 6120 msgstr "روز پنجشنبه" 6121 6122 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6123 #, fuzzy, kde-format 6124 #| msgid "Yaum al-Jumma" 6125 msgctxt "Hijri weekday 5 - KLocale::LongName" 6126 msgid "Yaum al-Jumma" 6127 msgstr "روز جمعه" 6128 6129 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6130 #, fuzzy, kde-format 6131 #| msgid "Yaum al-Sabt" 6132 msgctxt "Hijri weekday 6 - KLocale::LongName" 6133 msgid "Yaum al-Sabt" 6134 msgstr "روز شنبه" 6135 6136 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6137 #, fuzzy, kde-format 6138 #| msgid "Yaum al-Ahad" 6139 msgctxt "Hijri weekday 7 - KLocale::LongName" 6140 msgid "Yaum al-Ahad" 6141 msgstr "روز چهارشنبه" 6142 6143 #: kdecore/kcalendarsystemjalali.cpp:74 6144 #, kde-format 6145 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6146 msgid "Anno Persico" 6147 msgstr "" 6148 6149 #: kdecore/kcalendarsystemjalali.cpp:75 6150 #, kde-format 6151 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6152 msgid "AP" 6153 msgstr "" 6154 6155 #: kdecore/kcalendarsystemjalali.cpp:76 6156 #, kde-format 6157 msgctxt "" 6158 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6159 msgid "%Ey %EC" 6160 msgstr "" 6161 6162 #: kdecore/kcalendarsystemjalali.cpp:172 6163 #, kde-format 6164 msgctxt "Jalali month 1 - KLocale::NarrowName" 6165 msgid "F" 6166 msgstr "" 6167 6168 #: kdecore/kcalendarsystemjalali.cpp:174 6169 #, kde-format 6170 msgctxt "Jalali month 2 - KLocale::NarrowName" 6171 msgid "O" 6172 msgstr "" 6173 6174 #: kdecore/kcalendarsystemjalali.cpp:176 6175 #, kde-format 6176 msgctxt "Jalali month 3 - KLocale::NarrowName" 6177 msgid "K" 6178 msgstr "" 6179 6180 #: kdecore/kcalendarsystemjalali.cpp:178 6181 #, kde-format 6182 msgctxt "Jalali month 4 - KLocale::NarrowName" 6183 msgid "T" 6184 msgstr "" 6185 6186 #: kdecore/kcalendarsystemjalali.cpp:180 6187 #, kde-format 6188 msgctxt "Jalali month 5 - KLocale::NarrowName" 6189 msgid "M" 6190 msgstr "" 6191 6192 #: kdecore/kcalendarsystemjalali.cpp:182 6193 #, kde-format 6194 msgctxt "Jalali month 6 - KLocale::NarrowName" 6195 msgid "S" 6196 msgstr "" 6197 6198 #: kdecore/kcalendarsystemjalali.cpp:184 6199 #, kde-format 6200 msgctxt "Jalali month 7 - KLocale::NarrowName" 6201 msgid "M" 6202 msgstr "" 6203 6204 #: kdecore/kcalendarsystemjalali.cpp:186 6205 #, kde-format 6206 msgctxt "Jalali month 8 - KLocale::NarrowName" 6207 msgid "A" 6208 msgstr "" 6209 6210 #: kdecore/kcalendarsystemjalali.cpp:188 6211 #, kde-format 6212 msgctxt "Jalali month 9 - KLocale::NarrowName" 6213 msgid "A" 6214 msgstr "" 6215 6216 #: kdecore/kcalendarsystemjalali.cpp:190 6217 #, kde-format 6218 msgctxt "Jalali month 10 - KLocale::NarrowName" 6219 msgid "D" 6220 msgstr "" 6221 6222 #: kdecore/kcalendarsystemjalali.cpp:192 6223 #, kde-format 6224 msgctxt "Jalali month 11 - KLocale::NarrowName" 6225 msgid "B" 6226 msgstr "" 6227 6228 #: kdecore/kcalendarsystemjalali.cpp:194 6229 #, kde-format 6230 msgctxt "Jalali month 12 - KLocale::NarrowName" 6231 msgid "E" 6232 msgstr "" 6233 6234 #: kdecore/kcalendarsystemjalali.cpp:203 6235 #, fuzzy, kde-format 6236 #| msgctxt "of Farvardin short" 6237 #| msgid "of Far" 6238 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6239 msgid "of Far" 6240 msgstr "فروردین" 6241 6242 #: kdecore/kcalendarsystemjalali.cpp:205 6243 #, fuzzy, kde-format 6244 #| msgctxt "of Ordibehesht short" 6245 #| msgid "of Ord" 6246 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6247 msgid "of Ord" 6248 msgstr "اردیبهشت" 6249 6250 #: kdecore/kcalendarsystemjalali.cpp:207 6251 #, fuzzy, kde-format 6252 #| msgctxt "of Khordad short" 6253 #| msgid "of Kho" 6254 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6255 msgid "of Kho" 6256 msgstr "خرداد" 6257 6258 #: kdecore/kcalendarsystemjalali.cpp:209 6259 #, fuzzy, kde-format 6260 #| msgctxt "of Tir short" 6261 #| msgid "of Tir" 6262 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6263 msgid "of Tir" 6264 msgstr "تیر" 6265 6266 #: kdecore/kcalendarsystemjalali.cpp:211 6267 #, fuzzy, kde-format 6268 #| msgctxt "of Mordad short" 6269 #| msgid "of Mor" 6270 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6271 msgid "of Mor" 6272 msgstr "مرداد" 6273 6274 #: kdecore/kcalendarsystemjalali.cpp:213 6275 #, fuzzy, kde-format 6276 #| msgctxt "of Shahrivar short" 6277 #| msgid "of Sha" 6278 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6279 msgid "of Sha" 6280 msgstr "شهریور" 6281 6282 #: kdecore/kcalendarsystemjalali.cpp:215 6283 #, fuzzy, kde-format 6284 #| msgctxt "of Mehr short" 6285 #| msgid "of Meh" 6286 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6287 msgid "of Meh" 6288 msgstr "مهر" 6289 6290 #: kdecore/kcalendarsystemjalali.cpp:217 6291 #, fuzzy, kde-format 6292 #| msgctxt "of Aban short" 6293 #| msgid "of Aba" 6294 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6295 msgid "of Aba" 6296 msgstr "آبان" 6297 6298 #: kdecore/kcalendarsystemjalali.cpp:219 6299 #, fuzzy, kde-format 6300 #| msgctxt "of Azar short" 6301 #| msgid "of Aza" 6302 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6303 msgid "of Aza" 6304 msgstr "آذر" 6305 6306 #: kdecore/kcalendarsystemjalali.cpp:221 6307 #, fuzzy, kde-format 6308 #| msgctxt "of Dei short" 6309 #| msgid "of Dei" 6310 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6311 msgid "of Dei" 6312 msgstr "دی" 6313 6314 #: kdecore/kcalendarsystemjalali.cpp:223 6315 #, fuzzy, kde-format 6316 #| msgctxt "of Bahman short" 6317 #| msgid "of Bah" 6318 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6319 msgid "of Bah" 6320 msgstr "بهمن" 6321 6322 #: kdecore/kcalendarsystemjalali.cpp:225 6323 #, fuzzy, kde-format 6324 #| msgctxt "of Esfand short" 6325 #| msgid "of Esf" 6326 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6327 msgid "of Esf" 6328 msgstr "اسفند" 6329 6330 #: kdecore/kcalendarsystemjalali.cpp:234 6331 #, fuzzy, kde-format 6332 #| msgctxt "Farvardin short" 6333 #| msgid "Far" 6334 msgctxt "Jalali month 1 - KLocale::ShortName" 6335 msgid "Far" 6336 msgstr "فروردین" 6337 6338 #: kdecore/kcalendarsystemjalali.cpp:236 6339 #, fuzzy, kde-format 6340 #| msgctxt "Ordibehesht short" 6341 #| msgid "Ord" 6342 msgctxt "Jalali month 2 - KLocale::ShortName" 6343 msgid "Ord" 6344 msgstr "اردیبهشت" 6345 6346 #: kdecore/kcalendarsystemjalali.cpp:238 6347 #, fuzzy, kde-format 6348 #| msgctxt "Khordad short" 6349 #| msgid "Kho" 6350 msgctxt "Jalali month 3 - KLocale::ShortName" 6351 msgid "Kho" 6352 msgstr "خرداد" 6353 6354 #: kdecore/kcalendarsystemjalali.cpp:240 6355 #, fuzzy, kde-format 6356 #| msgctxt "Tir short" 6357 #| msgid "Tir" 6358 msgctxt "Jalali month 4 - KLocale::ShortName" 6359 msgid "Tir" 6360 msgstr "تیر" 6361 6362 #: kdecore/kcalendarsystemjalali.cpp:242 6363 #, fuzzy, kde-format 6364 #| msgctxt "Mordad short" 6365 #| msgid "Mor" 6366 msgctxt "Jalali month 5 - KLocale::ShortName" 6367 msgid "Mor" 6368 msgstr "مرداد" 6369 6370 #: kdecore/kcalendarsystemjalali.cpp:244 6371 #, fuzzy, kde-format 6372 #| msgctxt "Shahrivar short" 6373 #| msgid "Sha" 6374 msgctxt "Jalali month 6 - KLocale::ShortName" 6375 msgid "Sha" 6376 msgstr "شهریور" 6377 6378 #: kdecore/kcalendarsystemjalali.cpp:246 6379 #, fuzzy, kde-format 6380 #| msgctxt "Mehr short" 6381 #| msgid "Meh" 6382 msgctxt "Jalali month 7 - KLocale::ShortName" 6383 msgid "Meh" 6384 msgstr "مهر" 6385 6386 #: kdecore/kcalendarsystemjalali.cpp:248 6387 #, fuzzy, kde-format 6388 #| msgctxt "Aban short" 6389 #| msgid "Aba" 6390 msgctxt "Jalali month 8 - KLocale::ShortName" 6391 msgid "Aba" 6392 msgstr "آبان" 6393 6394 #: kdecore/kcalendarsystemjalali.cpp:250 6395 #, fuzzy, kde-format 6396 #| msgctxt "Azar short" 6397 #| msgid "Aza" 6398 msgctxt "Jalali month 9 - KLocale::ShortName" 6399 msgid "Aza" 6400 msgstr "آذر" 6401 6402 #: kdecore/kcalendarsystemjalali.cpp:252 6403 #, fuzzy, kde-format 6404 #| msgctxt "Dei short" 6405 #| msgid "Dei" 6406 msgctxt "Jalali month 10 - KLocale::ShortName" 6407 msgid "Dei" 6408 msgstr "دی" 6409 6410 #: kdecore/kcalendarsystemjalali.cpp:254 6411 #, fuzzy, kde-format 6412 #| msgctxt "Bahman short" 6413 #| msgid "Bah" 6414 msgctxt "Jalali month 11 - KLocale::ShortName" 6415 msgid "Bah" 6416 msgstr "بهمن" 6417 6418 #: kdecore/kcalendarsystemjalali.cpp:256 6419 #, fuzzy, kde-format 6420 #| msgctxt "Esfand" 6421 #| msgid "Esf" 6422 msgctxt "Jalali month 12 - KLocale::ShortName" 6423 msgid "Esf" 6424 msgstr "اسفند" 6425 6426 #: kdecore/kcalendarsystemjalali.cpp:265 6427 #, fuzzy, kde-format 6428 #| msgid "of Farvardin" 6429 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6430 msgid "of Farvardin" 6431 msgstr "فروردین" 6432 6433 #: kdecore/kcalendarsystemjalali.cpp:267 6434 #, fuzzy, kde-format 6435 #| msgid "of Ordibehesht" 6436 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6437 msgid "of Ordibehesht" 6438 msgstr "اردیبهشت" 6439 6440 #: kdecore/kcalendarsystemjalali.cpp:269 6441 #, fuzzy, kde-format 6442 #| msgid "of Khordad" 6443 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6444 msgid "of Khordad" 6445 msgstr "خرداد" 6446 6447 #: kdecore/kcalendarsystemjalali.cpp:271 6448 #, fuzzy, kde-format 6449 #| msgctxt "of Tir short" 6450 #| msgid "of Tir" 6451 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6452 msgid "of Tir" 6453 msgstr "تیر" 6454 6455 #: kdecore/kcalendarsystemjalali.cpp:273 6456 #, fuzzy, kde-format 6457 #| msgid "of Mordad" 6458 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6459 msgid "of Mordad" 6460 msgstr "مرداد" 6461 6462 #: kdecore/kcalendarsystemjalali.cpp:275 6463 #, fuzzy, kde-format 6464 #| msgid "of Shahrivar" 6465 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6466 msgid "of Shahrivar" 6467 msgstr "شهریور" 6468 6469 #: kdecore/kcalendarsystemjalali.cpp:277 6470 #, fuzzy, kde-format 6471 #| msgid "of Mehr" 6472 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6473 msgid "of Mehr" 6474 msgstr "مهر" 6475 6476 #: kdecore/kcalendarsystemjalali.cpp:279 6477 #, fuzzy, kde-format 6478 #| msgid "of Aban" 6479 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6480 msgid "of Aban" 6481 msgstr "آبان" 6482 6483 #: kdecore/kcalendarsystemjalali.cpp:281 6484 #, fuzzy, kde-format 6485 #| msgid "of Azar" 6486 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6487 msgid "of Azar" 6488 msgstr "آذر" 6489 6490 #: kdecore/kcalendarsystemjalali.cpp:283 6491 #, fuzzy, kde-format 6492 #| msgctxt "of Dei short" 6493 #| msgid "of Dei" 6494 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6495 msgid "of Dei" 6496 msgstr "دی" 6497 6498 #: kdecore/kcalendarsystemjalali.cpp:285 6499 #, fuzzy, kde-format 6500 #| msgid "of Bahman" 6501 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6502 msgid "of Bahman" 6503 msgstr "بهمن" 6504 6505 #: kdecore/kcalendarsystemjalali.cpp:287 6506 #, fuzzy, kde-format 6507 #| msgid "of Esfand" 6508 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6509 msgid "of Esfand" 6510 msgstr "اسفند" 6511 6512 #: kdecore/kcalendarsystemjalali.cpp:296 6513 #, fuzzy, kde-format 6514 #| msgid "Farvardin" 6515 msgctxt "Jalali month 1 - KLocale::LongName" 6516 msgid "Farvardin" 6517 msgstr "فروردین" 6518 6519 #: kdecore/kcalendarsystemjalali.cpp:298 6520 #, fuzzy, kde-format 6521 #| msgid "Ordibehesht" 6522 msgctxt "Jalali month 2 - KLocale::LongName" 6523 msgid "Ordibehesht" 6524 msgstr "اردیبهشت" 6525 6526 #: kdecore/kcalendarsystemjalali.cpp:300 6527 #, fuzzy, kde-format 6528 #| msgid "Khordad" 6529 msgctxt "Jalali month 3 - KLocale::LongName" 6530 msgid "Khordad" 6531 msgstr "خرداد" 6532 6533 #: kdecore/kcalendarsystemjalali.cpp:302 6534 #, fuzzy, kde-format 6535 #| msgctxt "Tir short" 6536 #| msgid "Tir" 6537 msgctxt "Jalali month 4 - KLocale::LongName" 6538 msgid "Tir" 6539 msgstr "تیر" 6540 6541 #: kdecore/kcalendarsystemjalali.cpp:304 6542 #, fuzzy, kde-format 6543 #| msgid "Mordad" 6544 msgctxt "Jalali month 5 - KLocale::LongName" 6545 msgid "Mordad" 6546 msgstr "مرداد" 6547 6548 #: kdecore/kcalendarsystemjalali.cpp:306 6549 #, fuzzy, kde-format 6550 #| msgid "Shahrivar" 6551 msgctxt "Jalali month 6 - KLocale::LongName" 6552 msgid "Shahrivar" 6553 msgstr "شهریور" 6554 6555 #: kdecore/kcalendarsystemjalali.cpp:308 6556 #, fuzzy, kde-format 6557 #| msgid "Mehr" 6558 msgctxt "Jalali month 7 - KLocale::LongName" 6559 msgid "Mehr" 6560 msgstr "مهر" 6561 6562 #: kdecore/kcalendarsystemjalali.cpp:310 6563 #, fuzzy, kde-format 6564 #| msgid "Aban" 6565 msgctxt "Jalali month 8 - KLocale::LongName" 6566 msgid "Aban" 6567 msgstr "آبان" 6568 6569 #: kdecore/kcalendarsystemjalali.cpp:312 6570 #, fuzzy, kde-format 6571 #| msgid "Azar" 6572 msgctxt "Jalali month 9 - KLocale::LongName" 6573 msgid "Azar" 6574 msgstr "آذر" 6575 6576 #: kdecore/kcalendarsystemjalali.cpp:314 6577 #, fuzzy, kde-format 6578 #| msgctxt "Dei short" 6579 #| msgid "Dei" 6580 msgctxt "Jalali month 10 - KLocale::LongName" 6581 msgid "Dei" 6582 msgstr "دی" 6583 6584 #: kdecore/kcalendarsystemjalali.cpp:316 6585 #, fuzzy, kde-format 6586 #| msgid "Bahman" 6587 msgctxt "Jalali month 11 - KLocale::LongName" 6588 msgid "Bahman" 6589 msgstr "بهمن" 6590 6591 #: kdecore/kcalendarsystemjalali.cpp:318 6592 #, fuzzy, kde-format 6593 #| msgid "Esfand" 6594 msgctxt "Jalali month 12 - KLocale::LongName" 6595 msgid "Esfand" 6596 msgstr "اسفند" 6597 6598 #: kdecore/kcalendarsystemjalali.cpp:331 6599 #, kde-format 6600 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6601 msgid "2" 6602 msgstr "" 6603 6604 #: kdecore/kcalendarsystemjalali.cpp:333 6605 #, kde-format 6606 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6607 msgid "3" 6608 msgstr "" 6609 6610 #: kdecore/kcalendarsystemjalali.cpp:335 6611 #, kde-format 6612 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6613 msgid "4" 6614 msgstr "" 6615 6616 #: kdecore/kcalendarsystemjalali.cpp:337 6617 #, kde-format 6618 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6619 msgid "5" 6620 msgstr "" 6621 6622 #: kdecore/kcalendarsystemjalali.cpp:339 6623 #, kde-format 6624 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6625 msgid "J" 6626 msgstr "" 6627 6628 #: kdecore/kcalendarsystemjalali.cpp:341 6629 #, kde-format 6630 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6631 msgid "S" 6632 msgstr "" 6633 6634 #: kdecore/kcalendarsystemjalali.cpp:343 6635 #, kde-format 6636 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6637 msgid "1" 6638 msgstr "" 6639 6640 #: kdecore/kcalendarsystemjalali.cpp:352 6641 #, fuzzy, kde-format 6642 #| msgctxt "Do shanbe short" 6643 #| msgid "2sh" 6644 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6645 msgid "2sh" 6646 msgstr "دوشنبه" 6647 6648 #: kdecore/kcalendarsystemjalali.cpp:354 6649 #, fuzzy, kde-format 6650 #| msgctxt "Se shanbe short" 6651 #| msgid "3sh" 6652 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6653 msgid "3sh" 6654 msgstr "سهشنبه" 6655 6656 #: kdecore/kcalendarsystemjalali.cpp:356 6657 #, fuzzy, kde-format 6658 #| msgctxt "Chahar shanbe short" 6659 #| msgid "4sh" 6660 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6661 msgid "4sh" 6662 msgstr "چهارشنبه" 6663 6664 #: kdecore/kcalendarsystemjalali.cpp:358 6665 #, fuzzy, kde-format 6666 #| msgctxt "Panj shanbe short" 6667 #| msgid "5sh" 6668 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6669 msgid "5sh" 6670 msgstr "پنجشنبه" 6671 6672 #: kdecore/kcalendarsystemjalali.cpp:360 6673 #, fuzzy, kde-format 6674 #| msgctxt "Jumee short" 6675 #| msgid "Jom" 6676 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6677 msgid "Jom" 6678 msgstr "جمعه" 6679 6680 #: kdecore/kcalendarsystemjalali.cpp:362 6681 #, fuzzy, kde-format 6682 #| msgid "Shanbe" 6683 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6684 msgid "Shn" 6685 msgstr "شنبه" 6686 6687 #: kdecore/kcalendarsystemjalali.cpp:364 6688 #, fuzzy, kde-format 6689 #| msgctxt "Yek-shanbe short" 6690 #| msgid "1sh" 6691 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6692 msgid "1sh" 6693 msgstr "یکشنبه" 6694 6695 #: kdecore/kcalendarsystemjalali.cpp:371 6696 #, fuzzy, kde-format 6697 #| msgid "Do shanbe" 6698 msgctxt "Jalali weekday 1 - KLocale::LongName" 6699 msgid "Do shanbe" 6700 msgstr "دوشنبه" 6701 6702 #: kdecore/kcalendarsystemjalali.cpp:373 6703 #, fuzzy, kde-format 6704 #| msgid "Se shanbe" 6705 msgctxt "Jalali weekday 2 - KLocale::LongName" 6706 msgid "Se shanbe" 6707 msgstr "سهشنبه" 6708 6709 #: kdecore/kcalendarsystemjalali.cpp:375 6710 #, fuzzy, kde-format 6711 #| msgid "Chahar shanbe" 6712 msgctxt "Jalali weekday 3 - KLocale::LongName" 6713 msgid "Chahar shanbe" 6714 msgstr "چهارشنبه" 6715 6716 #: kdecore/kcalendarsystemjalali.cpp:377 6717 #, fuzzy, kde-format 6718 #| msgid "Panj shanbe" 6719 msgctxt "Jalali weekday 4 - KLocale::LongName" 6720 msgid "Panj shanbe" 6721 msgstr "پنجشنبه" 6722 6723 #: kdecore/kcalendarsystemjalali.cpp:379 6724 #, fuzzy, kde-format 6725 #| msgid "Jumee" 6726 msgctxt "Jalali weekday 5 - KLocale::LongName" 6727 msgid "Jumee" 6728 msgstr "جمعه" 6729 6730 #: kdecore/kcalendarsystemjalali.cpp:381 6731 #, fuzzy, kde-format 6732 #| msgid "Shanbe" 6733 msgctxt "Jalali weekday 6 - KLocale::LongName" 6734 msgid "Shanbe" 6735 msgstr "شنبه" 6736 6737 #: kdecore/kcalendarsystemjalali.cpp:383 6738 #, fuzzy, kde-format 6739 #| msgid "Yek-shanbe" 6740 msgctxt "Jalali weekday 7 - KLocale::LongName" 6741 msgid "Yek-shanbe" 6742 msgstr "یکشنبه" 6743 6744 #: kdecore/kcalendarsystemjapanese.cpp:62 6745 #, kde-format 6746 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6747 msgid "Meiji" 6748 msgstr "" 6749 6750 #: kdecore/kcalendarsystemjapanese.cpp:64 6751 #, kde-format 6752 msgctxt "" 6753 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6754 "e.g. Meiji 1" 6755 msgid "%EC Gannen" 6756 msgstr "" 6757 6758 #: kdecore/kcalendarsystemjapanese.cpp:66 6759 #, kde-format 6760 msgctxt "" 6761 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6762 "e.g. Meiji 22" 6763 msgid "%EC %Ey" 6764 msgstr "" 6765 6766 #: kdecore/kcalendarsystemjapanese.cpp:69 6767 #, kde-format 6768 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6769 msgid "Taishō" 6770 msgstr "" 6771 6772 #: kdecore/kcalendarsystemjapanese.cpp:71 6773 #, kde-format 6774 msgctxt "" 6775 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6776 "1, e.g. Taishō 1" 6777 msgid "%EC Gannen" 6778 msgstr "" 6779 6780 #: kdecore/kcalendarsystemjapanese.cpp:73 6781 #, kde-format 6782 msgctxt "" 6783 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6784 "1, e.g. Taishō 22" 6785 msgid "%EC %Ey" 6786 msgstr "" 6787 6788 #: kdecore/kcalendarsystemjapanese.cpp:76 6789 #, fuzzy, kde-format 6790 #| msgctxt "Shahrivar short" 6791 #| msgid "Sha" 6792 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6793 msgid "Shōwa" 6794 msgstr "شهریور" 6795 6796 #: kdecore/kcalendarsystemjapanese.cpp:78 6797 #, kde-format 6798 msgctxt "" 6799 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6800 "e.g. Shōwa 1" 6801 msgid "%EC Gannen" 6802 msgstr "" 6803 6804 #: kdecore/kcalendarsystemjapanese.cpp:80 6805 #, kde-format 6806 msgctxt "" 6807 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6808 "e.g. Shōwa 22" 6809 msgid "%EC %Ey" 6810 msgstr "" 6811 6812 #: kdecore/kcalendarsystemjapanese.cpp:83 6813 #, kde-format 6814 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6815 msgid "Heisei" 6816 msgstr "" 6817 6818 #: kdecore/kcalendarsystemjapanese.cpp:85 6819 #, kde-format 6820 msgctxt "" 6821 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6822 "1, e.g. Heisei 1" 6823 msgid "%EC Gannen" 6824 msgstr "" 6825 6826 #: kdecore/kcalendarsystemjapanese.cpp:87 6827 #, kde-format 6828 msgctxt "" 6829 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6830 "1, e.g. Heisei 22" 6831 msgid "%EC %Ey" 6832 msgstr "" 6833 6834 #: kdecore/kcalendarsystemjapanese.cpp:164 6835 #, fuzzy, kde-format 6836 msgctxt "Japanese year 1 of era" 6837 msgid "Gannen" 6838 msgstr "سبز:" 6839 6840 #: kdecore/kcalendarsystemjulian.cpp:73 6841 #, kde-format 6842 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6843 msgid "Before Common Era" 6844 msgstr "" 6845 6846 #: kdecore/kcalendarsystemjulian.cpp:74 6847 #, kde-format 6848 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6849 msgid "BCE" 6850 msgstr "" 6851 6852 #: kdecore/kcalendarsystemjulian.cpp:76 6853 #, kde-format 6854 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6855 msgid "Before Christ" 6856 msgstr "" 6857 6858 #: kdecore/kcalendarsystemjulian.cpp:77 6859 #, kde-format 6860 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6861 msgid "BC" 6862 msgstr "" 6863 6864 #: kdecore/kcalendarsystemjulian.cpp:79 6865 #, kde-format 6866 msgctxt "" 6867 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6868 msgid "%Ey %EC" 6869 msgstr "" 6870 6871 #: kdecore/kcalendarsystemjulian.cpp:83 6872 #, kde-format 6873 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6874 msgid "Common Era" 6875 msgstr "" 6876 6877 #: kdecore/kcalendarsystemjulian.cpp:84 6878 #, kde-format 6879 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6880 msgid "CE" 6881 msgstr "" 6882 6883 #: kdecore/kcalendarsystemjulian.cpp:86 6884 #, kde-format 6885 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6886 msgid "Anno Domini" 6887 msgstr "" 6888 6889 #: kdecore/kcalendarsystemjulian.cpp:87 6890 #, kde-format 6891 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6892 msgid "AD" 6893 msgstr "" 6894 6895 #: kdecore/kcalendarsystemjulian.cpp:89 6896 #, kde-format 6897 msgctxt "" 6898 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6899 msgid "%Ey %EC" 6900 msgstr "" 6901 6902 #: kdecore/kcalendarsystemjulian.cpp:172 6903 #, kde-format 6904 msgctxt "Julian month 1 - KLocale::NarrowName" 6905 msgid "J" 6906 msgstr "" 6907 6908 #: kdecore/kcalendarsystemjulian.cpp:174 6909 #, kde-format 6910 msgctxt "Julian month 2 - KLocale::NarrowName" 6911 msgid "F" 6912 msgstr "" 6913 6914 #: kdecore/kcalendarsystemjulian.cpp:176 6915 #, kde-format 6916 msgctxt "Julian month 3 - KLocale::NarrowName" 6917 msgid "M" 6918 msgstr "" 6919 6920 #: kdecore/kcalendarsystemjulian.cpp:178 6921 #, kde-format 6922 msgctxt "Julian month 4 - KLocale::NarrowName" 6923 msgid "A" 6924 msgstr "" 6925 6926 #: kdecore/kcalendarsystemjulian.cpp:180 6927 #, kde-format 6928 msgctxt "Julian month 5 - KLocale::NarrowName" 6929 msgid "M" 6930 msgstr "" 6931 6932 #: kdecore/kcalendarsystemjulian.cpp:182 6933 #, kde-format 6934 msgctxt "Julian month 6 - KLocale::NarrowName" 6935 msgid "J" 6936 msgstr "" 6937 6938 #: kdecore/kcalendarsystemjulian.cpp:184 6939 #, kde-format 6940 msgctxt "Julian month 7 - KLocale::NarrowName" 6941 msgid "J" 6942 msgstr "" 6943 6944 #: kdecore/kcalendarsystemjulian.cpp:186 6945 #, kde-format 6946 msgctxt "Julian month 8 - KLocale::NarrowName" 6947 msgid "A" 6948 msgstr "" 6949 6950 #: kdecore/kcalendarsystemjulian.cpp:188 6951 #, kde-format 6952 msgctxt "Julian month 9 - KLocale::NarrowName" 6953 msgid "S" 6954 msgstr "" 6955 6956 #: kdecore/kcalendarsystemjulian.cpp:190 6957 #, kde-format 6958 msgctxt "Julian month 10 - KLocale::NarrowName" 6959 msgid "O" 6960 msgstr "" 6961 6962 #: kdecore/kcalendarsystemjulian.cpp:192 6963 #, kde-format 6964 msgctxt "Julian month 11 - KLocale::NarrowName" 6965 msgid "N" 6966 msgstr "" 6967 6968 #: kdecore/kcalendarsystemjulian.cpp:194 6969 #, kde-format 6970 msgctxt "Julian month 12 - KLocale::NarrowName" 6971 msgid "D" 6972 msgstr "" 6973 6974 #: kdecore/kcalendarsystemjulian.cpp:203 6975 #, fuzzy, kde-format 6976 #| msgctxt "of January" 6977 #| msgid "of Jan" 6978 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6979 msgid "of Jan" 6980 msgstr "ژانویه" 6981 6982 #: kdecore/kcalendarsystemjulian.cpp:205 6983 #, fuzzy, kde-format 6984 #| msgctxt "of February" 6985 #| msgid "of Feb" 6986 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6987 msgid "of Feb" 6988 msgstr "فوریه" 6989 6990 #: kdecore/kcalendarsystemjulian.cpp:207 6991 #, fuzzy, kde-format 6992 #| msgctxt "of March" 6993 #| msgid "of Mar" 6994 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6995 msgid "of Mar" 6996 msgstr "مارس" 6997 6998 #: kdecore/kcalendarsystemjulian.cpp:209 6999 #, fuzzy, kde-format 7000 #| msgctxt "of April" 7001 #| msgid "of Apr" 7002 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7003 msgid "of Apr" 7004 msgstr "آوریل" 7005 7006 #: kdecore/kcalendarsystemjulian.cpp:211 7007 #, fuzzy, kde-format 7008 #| msgctxt "of May short" 7009 #| msgid "of May" 7010 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7011 msgid "of May" 7012 msgstr "مه" 7013 7014 #: kdecore/kcalendarsystemjulian.cpp:213 7015 #, fuzzy, kde-format 7016 #| msgctxt "of June" 7017 #| msgid "of Jun" 7018 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7019 msgid "of Jun" 7020 msgstr "ژوئن" 7021 7022 #: kdecore/kcalendarsystemjulian.cpp:215 7023 #, fuzzy, kde-format 7024 #| msgctxt "of July" 7025 #| msgid "of Jul" 7026 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7027 msgid "of Jul" 7028 msgstr "ژوئیه" 7029 7030 #: kdecore/kcalendarsystemjulian.cpp:217 7031 #, fuzzy, kde-format 7032 #| msgctxt "of August" 7033 #| msgid "of Aug" 7034 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7035 msgid "of Aug" 7036 msgstr "اوت" 7037 7038 #: kdecore/kcalendarsystemjulian.cpp:219 7039 #, fuzzy, kde-format 7040 #| msgctxt "of September" 7041 #| msgid "of Sep" 7042 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7043 msgid "of Sep" 7044 msgstr "سپتامبر" 7045 7046 #: kdecore/kcalendarsystemjulian.cpp:221 7047 #, fuzzy, kde-format 7048 #| msgctxt "of October" 7049 #| msgid "of Oct" 7050 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7051 msgid "of Oct" 7052 msgstr "اکتبر" 7053 7054 #: kdecore/kcalendarsystemjulian.cpp:223 7055 #, fuzzy, kde-format 7056 #| msgctxt "of November" 7057 #| msgid "of Nov" 7058 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7059 msgid "of Nov" 7060 msgstr "نوامبر" 7061 7062 #: kdecore/kcalendarsystemjulian.cpp:225 7063 #, fuzzy, kde-format 7064 #| msgctxt "of December" 7065 #| msgid "of Dec" 7066 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7067 msgid "of Dec" 7068 msgstr "دسامبر" 7069 7070 #: kdecore/kcalendarsystemjulian.cpp:234 7071 #, fuzzy, kde-format 7072 #| msgctxt "January" 7073 #| msgid "Jan" 7074 msgctxt "Julian month 1 - KLocale::ShortName" 7075 msgid "Jan" 7076 msgstr "ژانویه" 7077 7078 #: kdecore/kcalendarsystemjulian.cpp:236 7079 #, fuzzy, kde-format 7080 #| msgctxt "February" 7081 #| msgid "Feb" 7082 msgctxt "Julian month 2 - KLocale::ShortName" 7083 msgid "Feb" 7084 msgstr "فوریه" 7085 7086 #: kdecore/kcalendarsystemjulian.cpp:238 7087 #, fuzzy, kde-format 7088 #| msgctxt "March" 7089 #| msgid "Mar" 7090 msgctxt "Julian month 3 - KLocale::ShortName" 7091 msgid "Mar" 7092 msgstr "مارس" 7093 7094 #: kdecore/kcalendarsystemjulian.cpp:240 7095 #, fuzzy, kde-format 7096 #| msgctxt "April" 7097 #| msgid "Apr" 7098 msgctxt "Julian month 4 - KLocale::ShortName" 7099 msgid "Apr" 7100 msgstr "آوریل" 7101 7102 #: kdecore/kcalendarsystemjulian.cpp:242 7103 #, fuzzy, kde-format 7104 #| msgctxt "May short" 7105 #| msgid "May" 7106 msgctxt "Julian month 5 - KLocale::ShortName" 7107 msgid "May" 7108 msgstr "مه" 7109 7110 #: kdecore/kcalendarsystemjulian.cpp:244 7111 #, fuzzy, kde-format 7112 #| msgctxt "June" 7113 #| msgid "Jun" 7114 msgctxt "Julian month 6 - KLocale::ShortName" 7115 msgid "Jun" 7116 msgstr "ژوئن" 7117 7118 #: kdecore/kcalendarsystemjulian.cpp:246 7119 #, fuzzy, kde-format 7120 #| msgctxt "July" 7121 #| msgid "Jul" 7122 msgctxt "Julian month 7 - KLocale::ShortName" 7123 msgid "Jul" 7124 msgstr "ژوئیه" 7125 7126 #: kdecore/kcalendarsystemjulian.cpp:248 7127 #, fuzzy, kde-format 7128 #| msgctxt "August" 7129 #| msgid "Aug" 7130 msgctxt "Julian month 8 - KLocale::ShortName" 7131 msgid "Aug" 7132 msgstr "اوت" 7133 7134 #: kdecore/kcalendarsystemjulian.cpp:250 7135 #, fuzzy, kde-format 7136 #| msgctxt "September" 7137 #| msgid "Sep" 7138 msgctxt "Julian month 9 - KLocale::ShortName" 7139 msgid "Sep" 7140 msgstr "سپتامبر" 7141 7142 #: kdecore/kcalendarsystemjulian.cpp:252 7143 #, fuzzy, kde-format 7144 #| msgctxt "October" 7145 #| msgid "Oct" 7146 msgctxt "Julian month 10 - KLocale::ShortName" 7147 msgid "Oct" 7148 msgstr "اکتبر" 7149 7150 #: kdecore/kcalendarsystemjulian.cpp:254 7151 #, fuzzy, kde-format 7152 #| msgctxt "November" 7153 #| msgid "Nov" 7154 msgctxt "Julian month 11 - KLocale::ShortName" 7155 msgid "Nov" 7156 msgstr "نوامبر" 7157 7158 #: kdecore/kcalendarsystemjulian.cpp:256 7159 #, fuzzy, kde-format 7160 #| msgctxt "December" 7161 #| msgid "Dec" 7162 msgctxt "Julian month 12 - KLocale::ShortName" 7163 msgid "Dec" 7164 msgstr "دسامبر" 7165 7166 #: kdecore/kcalendarsystemjulian.cpp:265 7167 #, fuzzy, kde-format 7168 #| msgid "of January" 7169 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7170 msgid "of January" 7171 msgstr "ژانویه" 7172 7173 #: kdecore/kcalendarsystemjulian.cpp:267 7174 #, fuzzy, kde-format 7175 #| msgid "of February" 7176 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7177 msgid "of February" 7178 msgstr "فوریه" 7179 7180 #: kdecore/kcalendarsystemjulian.cpp:269 7181 #, fuzzy, kde-format 7182 #| msgid "of March" 7183 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7184 msgid "of March" 7185 msgstr "مارس" 7186 7187 #: kdecore/kcalendarsystemjulian.cpp:271 7188 #, fuzzy, kde-format 7189 #| msgid "of April" 7190 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7191 msgid "of April" 7192 msgstr "آوریل" 7193 7194 #: kdecore/kcalendarsystemjulian.cpp:273 7195 #, fuzzy, kde-format 7196 #| msgctxt "of May short" 7197 #| msgid "of May" 7198 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7199 msgid "of May" 7200 msgstr "مه" 7201 7202 #: kdecore/kcalendarsystemjulian.cpp:275 7203 #, fuzzy, kde-format 7204 #| msgid "of June" 7205 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7206 msgid "of June" 7207 msgstr "ژوئن" 7208 7209 #: kdecore/kcalendarsystemjulian.cpp:277 7210 #, fuzzy, kde-format 7211 #| msgid "of July" 7212 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7213 msgid "of July" 7214 msgstr "ژوئیه" 7215 7216 #: kdecore/kcalendarsystemjulian.cpp:279 7217 #, fuzzy, kde-format 7218 #| msgid "of August" 7219 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7220 msgid "of August" 7221 msgstr "اوت" 7222 7223 #: kdecore/kcalendarsystemjulian.cpp:281 7224 #, fuzzy, kde-format 7225 #| msgid "of September" 7226 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7227 msgid "of September" 7228 msgstr "سپتامبر" 7229 7230 #: kdecore/kcalendarsystemjulian.cpp:283 7231 #, fuzzy, kde-format 7232 #| msgid "of October" 7233 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7234 msgid "of October" 7235 msgstr "اکتبر" 7236 7237 #: kdecore/kcalendarsystemjulian.cpp:285 7238 #, fuzzy, kde-format 7239 #| msgid "of November" 7240 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7241 msgid "of November" 7242 msgstr "نوامبر" 7243 7244 #: kdecore/kcalendarsystemjulian.cpp:287 7245 #, fuzzy, kde-format 7246 #| msgid "of December" 7247 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7248 msgid "of December" 7249 msgstr "دسامبر" 7250 7251 #: kdecore/kcalendarsystemjulian.cpp:296 7252 #, fuzzy, kde-format 7253 #| msgid "January" 7254 msgctxt "Julian month 1 - KLocale::LongName" 7255 msgid "January" 7256 msgstr "ژانویه" 7257 7258 #: kdecore/kcalendarsystemjulian.cpp:298 7259 #, fuzzy, kde-format 7260 #| msgid "February" 7261 msgctxt "Julian month 2 - KLocale::LongName" 7262 msgid "February" 7263 msgstr "فوریه" 7264 7265 #: kdecore/kcalendarsystemjulian.cpp:300 7266 #, fuzzy, kde-format 7267 #| msgctxt "March long" 7268 #| msgid "March" 7269 msgctxt "Julian month 3 - KLocale::LongName" 7270 msgid "March" 7271 msgstr "مارس" 7272 7273 #: kdecore/kcalendarsystemjulian.cpp:302 7274 #, fuzzy, kde-format 7275 #| msgid "April" 7276 msgctxt "Julian month 4 - KLocale::LongName" 7277 msgid "April" 7278 msgstr "آوریل" 7279 7280 #: kdecore/kcalendarsystemjulian.cpp:304 7281 #, fuzzy, kde-format 7282 #| msgctxt "May short" 7283 #| msgid "May" 7284 msgctxt "Julian month 5 - KLocale::LongName" 7285 msgid "May" 7286 msgstr "مه" 7287 7288 #: kdecore/kcalendarsystemjulian.cpp:306 7289 #, fuzzy, kde-format 7290 #| msgid "June" 7291 msgctxt "Julian month 6 - KLocale::LongName" 7292 msgid "June" 7293 msgstr "ژوئن" 7294 7295 #: kdecore/kcalendarsystemjulian.cpp:308 7296 #, fuzzy, kde-format 7297 #| msgid "July" 7298 msgctxt "Julian month 7 - KLocale::LongName" 7299 msgid "July" 7300 msgstr "ژوئیه" 7301 7302 #: kdecore/kcalendarsystemjulian.cpp:310 7303 #, fuzzy, kde-format 7304 #| msgctxt "August long" 7305 #| msgid "August" 7306 msgctxt "Julian month 8 - KLocale::LongName" 7307 msgid "August" 7308 msgstr "اوت" 7309 7310 #: kdecore/kcalendarsystemjulian.cpp:312 7311 #, fuzzy, kde-format 7312 #| msgid "September" 7313 msgctxt "Julian month 9 - KLocale::LongName" 7314 msgid "September" 7315 msgstr "سپتامبر" 7316 7317 #: kdecore/kcalendarsystemjulian.cpp:314 7318 #, fuzzy, kde-format 7319 #| msgid "October" 7320 msgctxt "Julian month 10 - KLocale::LongName" 7321 msgid "October" 7322 msgstr "اکتبر" 7323 7324 #: kdecore/kcalendarsystemjulian.cpp:316 7325 #, fuzzy, kde-format 7326 #| msgid "November" 7327 msgctxt "Julian month 11 - KLocale::LongName" 7328 msgid "November" 7329 msgstr "نوامبر" 7330 7331 #: kdecore/kcalendarsystemjulian.cpp:318 7332 #, fuzzy, kde-format 7333 #| msgid "December" 7334 msgctxt "Julian month 12 - KLocale::LongName" 7335 msgid "December" 7336 msgstr "دسامبر" 7337 7338 #: kdecore/kcalendarsystemjulian.cpp:331 7339 #, kde-format 7340 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7341 msgid "M" 7342 msgstr "" 7343 7344 #: kdecore/kcalendarsystemjulian.cpp:333 7345 #, kde-format 7346 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7347 msgid "T" 7348 msgstr "" 7349 7350 #: kdecore/kcalendarsystemjulian.cpp:335 7351 #, kde-format 7352 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7353 msgid "W" 7354 msgstr "" 7355 7356 #: kdecore/kcalendarsystemjulian.cpp:337 7357 #, kde-format 7358 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7359 msgid "T" 7360 msgstr "" 7361 7362 #: kdecore/kcalendarsystemjulian.cpp:339 7363 #, kde-format 7364 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7365 msgid "F" 7366 msgstr "" 7367 7368 #: kdecore/kcalendarsystemjulian.cpp:341 7369 #, kde-format 7370 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7371 msgid "S" 7372 msgstr "" 7373 7374 #: kdecore/kcalendarsystemjulian.cpp:343 7375 #, kde-format 7376 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7377 msgid "S" 7378 msgstr "" 7379 7380 #: kdecore/kcalendarsystemjulian.cpp:352 7381 #, fuzzy, kde-format 7382 #| msgctxt "Monday" 7383 #| msgid "Mon" 7384 msgctxt "Julian weekday 1 - KLocale::ShortName" 7385 msgid "Mon" 7386 msgstr "دوشنبه" 7387 7388 #: kdecore/kcalendarsystemjulian.cpp:354 7389 #, fuzzy, kde-format 7390 #| msgctxt "Tuesday" 7391 #| msgid "Tue" 7392 msgctxt "Julian weekday 2 - KLocale::ShortName" 7393 msgid "Tue" 7394 msgstr "سهشنبه" 7395 7396 #: kdecore/kcalendarsystemjulian.cpp:356 7397 #, fuzzy, kde-format 7398 #| msgctxt "Wednesday" 7399 #| msgid "Wed" 7400 msgctxt "Julian weekday 3 - KLocale::ShortName" 7401 msgid "Wed" 7402 msgstr "چهارشنبه" 7403 7404 #: kdecore/kcalendarsystemjulian.cpp:358 7405 #, fuzzy, kde-format 7406 #| msgctxt "Thursday" 7407 #| msgid "Thu" 7408 msgctxt "Julian weekday 4 - KLocale::ShortName" 7409 msgid "Thu" 7410 msgstr "پنجشنبه" 7411 7412 #: kdecore/kcalendarsystemjulian.cpp:360 7413 #, fuzzy, kde-format 7414 #| msgctxt "Friday" 7415 #| msgid "Fri" 7416 msgctxt "Julian weekday 5 - KLocale::ShortName" 7417 msgid "Fri" 7418 msgstr "جمعه" 7419 7420 #: kdecore/kcalendarsystemjulian.cpp:362 7421 #, fuzzy, kde-format 7422 #| msgctxt "Saturday" 7423 #| msgid "Sat" 7424 msgctxt "Julian weekday 6 - KLocale::ShortName" 7425 msgid "Sat" 7426 msgstr "شنبه" 7427 7428 #: kdecore/kcalendarsystemjulian.cpp:364 7429 #, fuzzy, kde-format 7430 #| msgctxt "Sunday" 7431 #| msgid "Sun" 7432 msgctxt "Julian weekday 7 - KLocale::ShortName" 7433 msgid "Sun" 7434 msgstr "یکشنبه" 7435 7436 #: kdecore/kcalendarsystemjulian.cpp:371 7437 #, fuzzy, kde-format 7438 #| msgid "Monday" 7439 msgctxt "Julian weekday 1 - KLocale::LongName" 7440 msgid "Monday" 7441 msgstr "دوشنبه" 7442 7443 #: kdecore/kcalendarsystemjulian.cpp:373 7444 #, fuzzy, kde-format 7445 #| msgid "Tuesday" 7446 msgctxt "Julian weekday 2 - KLocale::LongName" 7447 msgid "Tuesday" 7448 msgstr "سهشنبه" 7449 7450 #: kdecore/kcalendarsystemjulian.cpp:375 7451 #, fuzzy, kde-format 7452 #| msgid "Wednesday" 7453 msgctxt "Julian weekday 3 - KLocale::LongName" 7454 msgid "Wednesday" 7455 msgstr "چهارشنبه" 7456 7457 #: kdecore/kcalendarsystemjulian.cpp:377 7458 #, fuzzy, kde-format 7459 #| msgid "Thursday" 7460 msgctxt "Julian weekday 4 - KLocale::LongName" 7461 msgid "Thursday" 7462 msgstr "پنجشنبه" 7463 7464 #: kdecore/kcalendarsystemjulian.cpp:379 7465 #, fuzzy, kde-format 7466 #| msgid "Friday" 7467 msgctxt "Julian weekday 5 - KLocale::LongName" 7468 msgid "Friday" 7469 msgstr "جمعه" 7470 7471 #: kdecore/kcalendarsystemjulian.cpp:381 7472 #, fuzzy, kde-format 7473 #| msgid "Saturday" 7474 msgctxt "Julian weekday 6 - KLocale::LongName" 7475 msgid "Saturday" 7476 msgstr "شنبه" 7477 7478 #: kdecore/kcalendarsystemjulian.cpp:383 7479 #, fuzzy, kde-format 7480 #| msgid "Sunday" 7481 msgctxt "Julian weekday 7 - KLocale::LongName" 7482 msgid "Sunday" 7483 msgstr "یکشنبه" 7484 7485 #: kdecore/kcalendarsystemminguo.cpp:57 7486 #, kde-format 7487 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7488 msgid "Republic of China Era" 7489 msgstr "" 7490 7491 #: kdecore/kcalendarsystemminguo.cpp:58 7492 #, kde-format 7493 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7494 msgid "ROC" 7495 msgstr "" 7496 7497 #: kdecore/kcalendarsystemminguo.cpp:59 7498 #, kde-format 7499 msgctxt "" 7500 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7501 msgid "%EC %Ey" 7502 msgstr "" 7503 7504 #: kdecore/kcalendarsystemthai.cpp:58 7505 #, kde-format 7506 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7507 msgid "Buddhist Era" 7508 msgstr "" 7509 7510 #: kdecore/kcalendarsystemthai.cpp:59 7511 #, kde-format 7512 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7513 msgid "BE" 7514 msgstr "" 7515 7516 #: kdecore/kcalendarsystemthai.cpp:60 7517 #, kde-format 7518 msgctxt "" 7519 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7520 msgid "%Ey %EC" 7521 msgstr "" 7522 7523 #: kdecore/kcmdlineargs.cpp:278 7524 #, kde-format 7525 msgid "Use the X-server display 'displayname'" 7526 msgstr "استفاده از »displayname« نمایش کارساز X" 7527 7528 #: kdecore/kcmdlineargs.cpp:281 7529 #, kde-format 7530 msgid "Restore the application for the given 'sessionId'" 7531 msgstr "بازگرداندن کاربرد برای »sessionId« معین" 7532 7533 #: kdecore/kcmdlineargs.cpp:282 7534 #, kde-format 7535 msgid "" 7536 "Causes the application to install a private color\n" 7537 "map on an 8-bit display" 7538 msgstr "" 7539 "باعث میشود کاربرد نگاشت رنگ خصوصی را\n" 7540 "روی صفحه نمایش ۸ بیتی نصب کند" 7541 7542 #: kdecore/kcmdlineargs.cpp:283 7543 #, kde-format 7544 msgid "" 7545 "Limits the number of colors allocated in the color\n" 7546 "cube on an 8-bit display, if the application is\n" 7547 "using the QApplication::ManyColor color\n" 7548 "specification" 7549 msgstr "" 7550 "تعداد رنگهای تخصیصیافته در مکعب رنگ\n" 7551 "روی صفحه نمایش ۸ بیتی را محدود میکند، اگر کاربرد \n" 7552 "از مشخصه رنگ QApplication::ManyColor استفاده کند" 7553 7554 #: kdecore/kcmdlineargs.cpp:284 7555 #, kde-format 7556 msgid "tells Qt to never grab the mouse or the keyboard" 7557 msgstr "به Qt میگوید هرگز به موشی یا صفحه کلید چنگ نیندازد" 7558 7559 #: kdecore/kcmdlineargs.cpp:285 7560 #, kde-format 7561 msgid "" 7562 "running under a debugger can cause an implicit\n" 7563 "-nograb, use -dograb to override" 7564 msgstr "" 7565 "اجرا تحت اشکالزدا میتواند باعث یک nograb- ضمنی\n" 7566 "شود، برای لغو آن از dograb- استفاده شود" 7567 7568 #: kdecore/kcmdlineargs.cpp:286 7569 #, kde-format 7570 msgid "switches to synchronous mode for debugging" 7571 msgstr " حالت همگام برای اشکالزدایی را سودهی میکند" 7572 7573 #: kdecore/kcmdlineargs.cpp:288 7574 #, kde-format 7575 msgid "defines the application font" 7576 msgstr "قلم کاربرد را تعریف میکند" 7577 7578 #: kdecore/kcmdlineargs.cpp:290 7579 #, kde-format 7580 msgid "" 7581 "sets the default background color and an\n" 7582 "application palette (light and dark shades are\n" 7583 "calculated)" 7584 msgstr "" 7585 "رنگ زمینه پیشفرض و یک \n" 7586 "پالت کاربرد را تنظیم میکند )سایههای روشن و تاریک \n" 7587 "محاسبه شدهاند(" 7588 7589 #: kdecore/kcmdlineargs.cpp:292 7590 #, kde-format 7591 msgid "sets the default foreground color" 7592 msgstr "رنگ پیشزمینه پیشفرض را تنظیم میکند" 7593 7594 #: kdecore/kcmdlineargs.cpp:294 7595 #, kde-format 7596 msgid "sets the default button color" 7597 msgstr "رنگ دکمه پیشفرض را تنظیم میکند" 7598 7599 #: kdecore/kcmdlineargs.cpp:295 7600 #, kde-format 7601 msgid "sets the application name" 7602 msgstr "نام کاربرد را تنظیم میکند" 7603 7604 #: kdecore/kcmdlineargs.cpp:296 7605 #, kde-format 7606 msgid "sets the application title (caption)" 7607 msgstr "عنوان کاربرد را تنظیم میکند )عنوان(" 7608 7609 #: kdecore/kcmdlineargs.cpp:297 7610 #, kde-format 7611 msgid "load the testability framework" 7612 msgstr "بارگیری چارچوب آزمودنی" 7613 7614 #: kdecore/kcmdlineargs.cpp:299 7615 #, kde-format 7616 msgid "" 7617 "forces the application to use a TrueColor visual on\n" 7618 "an 8-bit display" 7619 msgstr "" 7620 "کاربردها را مجبور به استفاده از یک رنگ حقیقی تصویری روی \n" 7621 "یک صفحه نمایش ۸ بیتی میکند" 7622 7623 #: kdecore/kcmdlineargs.cpp:300 7624 #, kde-format 7625 msgid "" 7626 "sets XIM (X Input Method) input style. Possible\n" 7627 "values are onthespot, overthespot, offthespot and\n" 7628 "root" 7629 msgstr "" 7630 "سبک ورودی XIM )روش ورودی X( را تنظیم میکند. مقادیر ممکن\n" 7631 "onthespot, overthespot, offthespoو\n" 7632 "root میباشد" 7633 7634 #: kdecore/kcmdlineargs.cpp:301 7635 #, kde-format 7636 msgid "set XIM server" 7637 msgstr "تنظیم کارساز XIM" 7638 7639 #: kdecore/kcmdlineargs.cpp:302 7640 #, kde-format 7641 msgid "disable XIM" 7642 msgstr "غیرفعالسازی XIM" 7643 7644 #: kdecore/kcmdlineargs.cpp:304 7645 #, kde-format 7646 msgid "mirrors the whole layout of widgets" 7647 msgstr "کل طرحبندی عناصر را منعکس میکند" 7648 7649 #: kdecore/kcmdlineargs.cpp:305 7650 #, kde-format 7651 msgid "applies the Qt stylesheet to the application widgets" 7652 msgstr "برگه سبک Qt را روی ویجتهای برنامه به کار میبرد" 7653 7654 #: kdecore/kcmdlineargs.cpp:306 7655 #, kde-format 7656 msgid "" 7657 "use a different graphics system instead of the default one, options are " 7658 "raster and opengl (experimental)" 7659 msgstr "" 7660 7661 #: kdecore/kcmdlineargs.cpp:307 7662 #, kde-format 7663 msgid "" 7664 "QML JS debugger information. Application must be\n" 7665 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7666 "enabled" 7667 msgstr "" 7668 7669 #: kdecore/kcmdlineargs.cpp:308 7670 #, kde-format 7671 msgid "The windowing system platform (e.g. xcb or wayland)" 7672 msgstr "" 7673 7674 #: kdecore/kcmdlineargs.cpp:310 7675 #, kde-format 7676 msgid "Use 'caption' as name in the titlebar" 7677 msgstr " استفاده از »عنوان« به عنوان نام در میله عنوان" 7678 7679 #: kdecore/kcmdlineargs.cpp:311 7680 #, kde-format 7681 msgid "Use 'icon' as the application icon" 7682 msgstr "استفاده از »شمایل« به عنوان شمایل کاربرد" 7683 7684 #: kdecore/kcmdlineargs.cpp:312 7685 #, kde-format 7686 msgid "Use alternative configuration file" 7687 msgstr "استفاده از پرونده پیکربندی خودکار جایگزین" 7688 7689 #: kdecore/kcmdlineargs.cpp:313 7690 #, kde-format 7691 msgid "Disable crash handler, to get core dumps" 7692 msgstr "غیرفعالسازی گرداننده فروپاشی، برای به دست آوردن تخلیههای هسته" 7693 7694 #: kdecore/kcmdlineargs.cpp:315 7695 #, kde-format 7696 msgid "Waits for a WM_NET compatible windowmanager" 7697 msgstr "منتظر مدیر پنجره همساز WM_NET میماند" 7698 7699 #: kdecore/kcmdlineargs.cpp:317 7700 #, kde-format 7701 msgid "sets the application GUI style" 7702 msgstr "سبک واسط نگارهای کاربرد را تنظیم میکند" 7703 7704 #: kdecore/kcmdlineargs.cpp:318 7705 #, fuzzy, kde-format 7706 #| msgid "" 7707 #| "sets the client geometry of the main widget - see man X for the argument " 7708 #| "format" 7709 msgid "" 7710 "sets the client geometry of the main widget - see man X for the argument " 7711 "format (usually WidthxHeight+XPos+YPos)" 7712 msgstr "" 7713 "هندسه کارخواه عنصر اصلی را تنظیم میکند- راهنمای X را برای قالب نشانوند ببینید" 7714 7715 #: kdecore/kcmdlineargs.cpp:436 7716 #, kde-format 7717 msgid "KDE Application" 7718 msgstr "برنامه KDE" 7719 7720 # Qt 7721 #: kdecore/kcmdlineargs.cpp:497 7722 #, kde-format 7723 msgid "Qt" 7724 msgstr "Qt" 7725 7726 # KDE 7727 #: kdecore/kcmdlineargs.cpp:500 7728 #, kde-format 7729 msgid "KDE" 7730 msgstr "KDE" 7731 7732 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7733 #, fuzzy, kde-format 7734 #| msgid "ERROR: Unknown protocol '%1'" 7735 msgid "Unknown option '%1'." 7736 msgstr "خطا: قرارداد ناشناخته »%1«" 7737 7738 # '%1' missing. 7739 #: kdecore/kcmdlineargs.cpp:841 7740 #, kde-format 7741 msgctxt "@info:shell %1 is cmdoption name" 7742 msgid "'%1' missing." 7743 msgstr "'%1' مفقود است." 7744 7745 #: kdecore/kcmdlineargs.cpp:895 7746 #, fuzzy, kde-format 7747 #| msgctxt "" 7748 #| "@info:shell message on appcmd --version; do not translate 'Development " 7749 #| "Platform'%3 application name, other %n version strings" 7750 #| msgid "" 7751 #| "Qt: %1\n" 7752 #| "KDE Development Platform: %2\n" 7753 #| "%3: %4\n" 7754 msgctxt "" 7755 "@info:shell message on appcmd --version; do not translate 'Development " 7756 "Platform'%3 application name, other %n version strings" 7757 msgid "" 7758 "Qt: %1\n" 7759 "KDE Frameworks: %2\n" 7760 "%3: %4\n" 7761 msgstr "" 7762 "Qt: %1\n" 7763 "KDE Development Platform: %2\n" 7764 "%3: %4\n" 7765 7766 #: kdecore/kcmdlineargs.cpp:921 7767 #, kde-format 7768 msgctxt "the 2nd argument is a list of name+address, one on each line" 7769 msgid "" 7770 "%1 was written by\n" 7771 "%2" 7772 msgstr "" 7773 "%1 توسط \n" 7774 "%2 نوشته شد" 7775 7776 #: kdecore/kcmdlineargs.cpp:924 7777 #, kde-format 7778 msgid "This application was written by somebody who wants to remain anonymous." 7779 msgstr "" 7780 7781 #: kdecore/kcmdlineargs.cpp:929 7782 #, kde-format 7783 msgid "Please use http://bugs.kde.org to report bugs.\n" 7784 msgstr "" 7785 7786 #: kdecore/kcmdlineargs.cpp:931 7787 #, kde-format 7788 msgid "Please report bugs to %1.\n" 7789 msgstr "" 7790 7791 #: kdecore/kcmdlineargs.cpp:961 7792 #, kde-format 7793 msgid "Unexpected argument '%1'." 7794 msgstr "" 7795 7796 #: kdecore/kcmdlineargs.cpp:1074 7797 #, kde-format 7798 msgid "Use --help to get a list of available command line options." 7799 msgstr "" 7800 7801 #: kdecore/kcmdlineargs.cpp:1096 7802 #, kde-format 7803 msgid "[options] " 7804 msgstr "" 7805 7806 #: kdecore/kcmdlineargs.cpp:1101 7807 #, kde-format 7808 msgid "[%1-options]" 7809 msgstr "" 7810 7811 #: kdecore/kcmdlineargs.cpp:1122 7812 #, kde-format 7813 msgid "Usage: %1 %2\n" 7814 msgstr "" 7815 7816 #: kdecore/kcmdlineargs.cpp:1125 7817 #, kde-format 7818 msgid "" 7819 "\n" 7820 "Generic options:\n" 7821 msgstr "" 7822 7823 #: kdecore/kcmdlineargs.cpp:1127 7824 #, kde-format 7825 msgid "Show help about options" 7826 msgstr "" 7827 7828 #: kdecore/kcmdlineargs.cpp:1133 7829 #, kde-format 7830 msgid "Show %1 specific options" 7831 msgstr "" 7832 7833 #: kdecore/kcmdlineargs.cpp:1140 7834 #, kde-format 7835 msgid "Show all options" 7836 msgstr "" 7837 7838 #: kdecore/kcmdlineargs.cpp:1141 7839 #, kde-format 7840 msgid "Show author information" 7841 msgstr "" 7842 7843 #: kdecore/kcmdlineargs.cpp:1142 7844 #, kde-format 7845 msgid "Show version information" 7846 msgstr "" 7847 7848 #: kdecore/kcmdlineargs.cpp:1143 7849 #, kde-format 7850 msgid "Show license information" 7851 msgstr "" 7852 7853 #: kdecore/kcmdlineargs.cpp:1144 7854 #, kde-format 7855 msgid "End of options" 7856 msgstr "" 7857 7858 #: kdecore/kcmdlineargs.cpp:1164 7859 #, kde-format 7860 msgid "" 7861 "\n" 7862 "%1 options:\n" 7863 msgstr "" 7864 7865 #: kdecore/kcmdlineargs.cpp:1166 7866 #, kde-format 7867 msgid "" 7868 "\n" 7869 "Options:\n" 7870 msgstr "" 7871 7872 #: kdecore/kcmdlineargs.cpp:1219 7873 #, kde-format 7874 msgid "" 7875 "\n" 7876 "Arguments:\n" 7877 msgstr "" 7878 7879 #: kdecore/kcmdlineargs.cpp:1580 7880 #, kde-format 7881 msgid "The files/URLs opened by the application will be deleted after use" 7882 msgstr "" 7883 "این پروندهها/نشانیهای وب که توسط کاربرد باز شدهاند، پس از استفاده حذف خواهند " 7884 "شد" 7885 7886 # KDE-tempfile 7887 #: kdecore/kcmdlineargs.cpp:1581 7888 #, kde-format 7889 msgid "KDE-tempfile" 7890 msgstr "KDE-tempfile" 7891 7892 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7893 #: kdecore/kdatetime.cpp:2985 7894 #, fuzzy, kde-format 7895 msgid "am" 7896 msgstr "قبل از ظهر" 7897 7898 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7899 #: kdecore/kdatetime.cpp:2990 7900 #, kde-format 7901 msgid "pm" 7902 msgstr "بعد از ظهر" 7903 7904 #: kdecore/klibloader.cpp:100 7905 #, kde-format 7906 msgid "Library \"%1\" not found" 7907 msgstr "کتابخانه \"%1\" یافت نشد" 7908 7909 #: kdecore/klocale_kde.cpp:785 7910 #, kde-format 7911 msgctxt "digit set" 7912 msgid "Arabic-Indic" 7913 msgstr "عربی-هندی" 7914 7915 #: kdecore/klocale_kde.cpp:788 7916 #, kde-format 7917 msgctxt "digit set" 7918 msgid "Bengali" 7919 msgstr "بنگالی" 7920 7921 #: kdecore/klocale_kde.cpp:791 7922 #, kde-format 7923 msgctxt "digit set" 7924 msgid "Devanagari" 7925 msgstr "دواناگری" 7926 7927 #: kdecore/klocale_kde.cpp:794 7928 #, kde-format 7929 msgctxt "digit set" 7930 msgid "Eastern Arabic-Indic" 7931 msgstr "عربی-هندی شرقی" 7932 7933 #: kdecore/klocale_kde.cpp:797 7934 #, kde-format 7935 msgctxt "digit set" 7936 msgid "Gujarati" 7937 msgstr "گجراتی" 7938 7939 #: kdecore/klocale_kde.cpp:800 7940 #, kde-format 7941 msgctxt "digit set" 7942 msgid "Gurmukhi" 7943 msgstr "گورموخی" 7944 7945 #: kdecore/klocale_kde.cpp:803 7946 #, kde-format 7947 msgctxt "digit set" 7948 msgid "Kannada" 7949 msgstr "کناده" 7950 7951 #: kdecore/klocale_kde.cpp:806 7952 #, kde-format 7953 msgctxt "digit set" 7954 msgid "Khmer" 7955 msgstr "خمر" 7956 7957 #: kdecore/klocale_kde.cpp:809 7958 #, kde-format 7959 msgctxt "digit set" 7960 msgid "Malayalam" 7961 msgstr "مالایالام" 7962 7963 #: kdecore/klocale_kde.cpp:812 7964 #, kde-format 7965 msgctxt "digit set" 7966 msgid "Oriya" 7967 msgstr "اوریهای" 7968 7969 #: kdecore/klocale_kde.cpp:815 7970 #, kde-format 7971 msgctxt "digit set" 7972 msgid "Tamil" 7973 msgstr "تامیل" 7974 7975 #: kdecore/klocale_kde.cpp:818 7976 #, kde-format 7977 msgctxt "digit set" 7978 msgid "Telugu" 7979 msgstr "تلوگو" 7980 7981 #: kdecore/klocale_kde.cpp:821 7982 #, fuzzy, kde-format 7983 #| msgid "R. Thaani" 7984 msgctxt "digit set" 7985 msgid "Thai" 7986 msgstr "ربیعالثانی" 7987 7988 #: kdecore/klocale_kde.cpp:824 7989 #, kde-format 7990 msgctxt "digit set" 7991 msgid "Arabic" 7992 msgstr "Arabic" 7993 7994 # %1 (%2) 7995 #: kdecore/klocale_kde.cpp:829 7996 #, kde-format 7997 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 7998 msgid "%1 (%2)" 7999 msgstr "%1 (%2)" 8000 8001 #. i18n: comments below, they are used by the 8002 #. translators. 8003 #. This prefix is shared by all current dialects. 8004 #. i18n: Dumb message, avoid any markup or scripting. 8005 #: kdecore/klocale_kde.cpp:1327 8006 #, kde-format 8007 msgctxt "size in bytes" 8008 msgid "%1 B" 8009 msgstr "%1 بایت" 8010 8011 #. i18n: Dumb message, avoid any markup or scripting. 8012 #: kdecore/klocale_kde.cpp:1332 8013 #, kde-format 8014 msgctxt "size in 1000 bytes" 8015 msgid "%1 kB" 8016 msgstr "%1 کیلو بایت" 8017 8018 #. i18n: Dumb message, avoid any markup or scripting. 8019 #: kdecore/klocale_kde.cpp:1334 8020 #, kde-format 8021 msgctxt "size in 10^6 bytes" 8022 msgid "%1 MB" 8023 msgstr "%1 مگابایت" 8024 8025 #. i18n: Dumb message, avoid any markup or scripting. 8026 #: kdecore/klocale_kde.cpp:1336 8027 #, kde-format 8028 msgctxt "size in 10^9 bytes" 8029 msgid "%1 GB" 8030 msgstr "%1 گیگابایت" 8031 8032 #. i18n: Dumb message, avoid any markup or scripting. 8033 #: kdecore/klocale_kde.cpp:1338 8034 #, kde-format 8035 msgctxt "size in 10^12 bytes" 8036 msgid "%1 TB" 8037 msgstr "%1 ترابایت" 8038 8039 #. i18n: Dumb message, avoid any markup or scripting. 8040 #: kdecore/klocale_kde.cpp:1340 8041 #, kde-format 8042 msgctxt "size in 10^15 bytes" 8043 msgid "%1 PB" 8044 msgstr "%1 PB" 8045 8046 #. i18n: Dumb message, avoid any markup or scripting. 8047 #: kdecore/klocale_kde.cpp:1342 8048 #, kde-format 8049 msgctxt "size in 10^18 bytes" 8050 msgid "%1 EB" 8051 msgstr "%1 EB" 8052 8053 #. i18n: Dumb message, avoid any markup or scripting. 8054 #: kdecore/klocale_kde.cpp:1344 8055 #, kde-format 8056 msgctxt "size in 10^21 bytes" 8057 msgid "%1 ZB" 8058 msgstr "%1 ZB" 8059 8060 #. i18n: Dumb message, avoid any markup or scripting. 8061 #: kdecore/klocale_kde.cpp:1346 8062 #, kde-format 8063 msgctxt "size in 10^24 bytes" 8064 msgid "%1 YB" 8065 msgstr "%1 YB" 8066 8067 #. i18n: Dumb message, avoid any markup or scripting. 8068 #: kdecore/klocale_kde.cpp:1351 8069 #, kde-format 8070 msgctxt "memory size in 1024 bytes" 8071 msgid "%1 KB" 8072 msgstr "%1 کیلوبایت" 8073 8074 #. i18n: Dumb message, avoid any markup or scripting. 8075 #: kdecore/klocale_kde.cpp:1353 8076 #, kde-format 8077 msgctxt "memory size in 2^20 bytes" 8078 msgid "%1 MB" 8079 msgstr "%1 مگابایت" 8080 8081 #. i18n: Dumb message, avoid any markup or scripting. 8082 #: kdecore/klocale_kde.cpp:1355 8083 #, kde-format 8084 msgctxt "memory size in 2^30 bytes" 8085 msgid "%1 GB" 8086 msgstr "%1 گیگابایت" 8087 8088 #. i18n: Dumb message, avoid any markup or scripting. 8089 #: kdecore/klocale_kde.cpp:1357 8090 #, kde-format 8091 msgctxt "memory size in 2^40 bytes" 8092 msgid "%1 TB" 8093 msgstr "%1 ترابایت" 8094 8095 #. i18n: Dumb message, avoid any markup or scripting. 8096 #: kdecore/klocale_kde.cpp:1359 8097 #, kde-format 8098 msgctxt "memory size in 2^50 bytes" 8099 msgid "%1 PB" 8100 msgstr "%1 PB" 8101 8102 #. i18n: Dumb message, avoid any markup or scripting. 8103 #: kdecore/klocale_kde.cpp:1361 8104 #, kde-format 8105 msgctxt "memory size in 2^60 bytes" 8106 msgid "%1 EB" 8107 msgstr "%1 EB" 8108 8109 #. i18n: Dumb message, avoid any markup or scripting. 8110 #: kdecore/klocale_kde.cpp:1363 8111 #, kde-format 8112 msgctxt "memory size in 2^70 bytes" 8113 msgid "%1 ZB" 8114 msgstr "%1 ZB" 8115 8116 #. i18n: Dumb message, avoid any markup or scripting. 8117 #: kdecore/klocale_kde.cpp:1365 8118 #, kde-format 8119 msgctxt "memory size in 2^80 bytes" 8120 msgid "%1 YB" 8121 msgstr "%1 YB" 8122 8123 #. i18n: Dumb message, avoid any markup or scripting. 8124 #: kdecore/klocale_kde.cpp:1371 8125 #, kde-format 8126 msgctxt "size in 1024 bytes" 8127 msgid "%1 KiB" 8128 msgstr "%1 KiB" 8129 8130 #. i18n: Dumb message, avoid any markup or scripting. 8131 #: kdecore/klocale_kde.cpp:1373 8132 #, kde-format 8133 msgctxt "size in 2^20 bytes" 8134 msgid "%1 MiB" 8135 msgstr "%1 MiB" 8136 8137 #. i18n: Dumb message, avoid any markup or scripting. 8138 #: kdecore/klocale_kde.cpp:1375 8139 #, fuzzy, kde-format 8140 #| msgid "%1 GiB" 8141 msgctxt "size in 2^30 bytes" 8142 msgid "%1 GiB" 8143 msgstr "گیبیبایت" 8144 8145 #. i18n: Dumb message, avoid any markup or scripting. 8146 #: kdecore/klocale_kde.cpp:1377 8147 #, kde-format 8148 msgctxt "size in 2^40 bytes" 8149 msgid "%1 TiB" 8150 msgstr "%1 TiB" 8151 8152 #. i18n: Dumb message, avoid any markup or scripting. 8153 #: kdecore/klocale_kde.cpp:1379 8154 #, kde-format 8155 msgctxt "size in 2^50 bytes" 8156 msgid "%1 PiB" 8157 msgstr "%1 PiB" 8158 8159 #. i18n: Dumb message, avoid any markup or scripting. 8160 #: kdecore/klocale_kde.cpp:1381 8161 #, kde-format 8162 msgctxt "size in 2^60 bytes" 8163 msgid "%1 EiB" 8164 msgstr "%1 EiB" 8165 8166 #. i18n: Dumb message, avoid any markup or scripting. 8167 #: kdecore/klocale_kde.cpp:1383 8168 #, kde-format 8169 msgctxt "size in 2^70 bytes" 8170 msgid "%1 ZiB" 8171 msgstr "%1 ZiB" 8172 8173 #. i18n: Dumb message, avoid any markup or scripting. 8174 #: kdecore/klocale_kde.cpp:1385 8175 #, kde-format 8176 msgctxt "size in 2^80 bytes" 8177 msgid "%1 YiB" 8178 msgstr "%1 YiB" 8179 8180 #: kdecore/klocale_kde.cpp:1472 8181 #, kde-format 8182 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8183 msgid "%1 days" 8184 msgstr "%1 روز" 8185 8186 #: kdecore/klocale_kde.cpp:1475 8187 #, kde-format 8188 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8189 msgid "%1 hours" 8190 msgstr "%1 ساعت" 8191 8192 #: kdecore/klocale_kde.cpp:1478 8193 #, kde-format 8194 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8195 msgid "%1 minutes" 8196 msgstr "%1 دقیقه" 8197 8198 #: kdecore/klocale_kde.cpp:1481 8199 #, kde-format 8200 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8201 msgid "%1 seconds" 8202 msgstr "%1 ثانیه" 8203 8204 #: kdecore/klocale_kde.cpp:1484 8205 #, fuzzy, kde-format 8206 msgctxt "@item:intext" 8207 msgid "%1 millisecond" 8208 msgid_plural "%1 milliseconds" 8209 msgstr[0] "%1 میلیثانیه" 8210 msgstr[1] "" 8211 8212 #: kdecore/klocale_kde.cpp:1491 8213 #, fuzzy, kde-format 8214 msgctxt "@item:intext" 8215 msgid "1 day" 8216 msgid_plural "%1 days" 8217 msgstr[0] "%1 روز" 8218 msgstr[1] "" 8219 8220 #: kdecore/klocale_kde.cpp:1493 8221 #, fuzzy, kde-format 8222 msgctxt "@item:intext" 8223 msgid "1 hour" 8224 msgid_plural "%1 hours" 8225 msgstr[0] "%1 ساعت" 8226 msgstr[1] "" 8227 8228 #: kdecore/klocale_kde.cpp:1495 8229 #, fuzzy, kde-format 8230 msgctxt "@item:intext" 8231 msgid "1 minute" 8232 msgid_plural "%1 minutes" 8233 msgstr[0] "%1 دقیقه" 8234 msgstr[1] "" 8235 8236 #: kdecore/klocale_kde.cpp:1497 8237 #, fuzzy, kde-format 8238 msgctxt "@item:intext" 8239 msgid "1 second" 8240 msgid_plural "%1 seconds" 8241 msgstr[0] "%1 ثانیه" 8242 msgstr[1] "" 8243 8244 # %1 %2 8245 #: kdecore/klocale_kde.cpp:1521 8246 #, kde-format 8247 msgctxt "" 8248 "@item:intext days and hours. This uses the previous item:intext messages. If " 8249 "this does not fit the grammar of your language please contact the i18n team " 8250 "to solve the problem" 8251 msgid "%1 and %2" 8252 msgstr "%1 و %2" 8253 8254 # %1 %2 8255 #: kdecore/klocale_kde.cpp:1527 8256 #, kde-format 8257 msgctxt "" 8258 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8259 "If this does not fit the grammar of your language please contact the i18n " 8260 "team to solve the problem" 8261 msgid "%1 and %2" 8262 msgstr "%1 و %2" 8263 8264 # %1 %2 8265 #: kdecore/klocale_kde.cpp:1534 8266 #, kde-format 8267 msgctxt "" 8268 "@item:intext minutes and seconds. This uses the previous item:intext " 8269 "messages. If this does not fit the grammar of your language please contact " 8270 "the i18n team to solve the problem" 8271 msgid "%1 and %2" 8272 msgstr "%1 و %2" 8273 8274 #: kdecore/klocale_kde.cpp:2153 8275 #, kde-format 8276 msgctxt "Before Noon KLocale::LongName" 8277 msgid "Ante Meridiem" 8278 msgstr "پیش از ظهر" 8279 8280 #: kdecore/klocale_kde.cpp:2154 8281 #, kde-format 8282 msgctxt "Before Noon KLocale::ShortName" 8283 msgid "AM" 8284 msgstr "AM" 8285 8286 # AC 8287 #: kdecore/klocale_kde.cpp:2155 8288 #, kde-format 8289 msgctxt "Before Noon KLocale::NarrowName" 8290 msgid "A" 8291 msgstr "ض" 8292 8293 #: kdecore/klocale_kde.cpp:2158 8294 #, kde-format 8295 msgctxt "After Noon KLocale::LongName" 8296 msgid "Post Meridiem" 8297 msgstr "بعد از ظهر" 8298 8299 #: kdecore/klocale_kde.cpp:2159 8300 #, kde-format 8301 msgctxt "After Noon KLocale::ShortName" 8302 msgid "PM" 8303 msgstr "PM" 8304 8305 #: kdecore/klocale_kde.cpp:2160 8306 #, kde-format 8307 msgctxt "After Noon KLocale::NarrowName" 8308 msgid "P" 8309 msgstr "P" 8310 8311 # %1 %2 8312 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8313 #, kde-format 8314 msgctxt "concatenation of dates and time" 8315 msgid "%1 %2" 8316 msgstr "%1 %2" 8317 8318 # %1 %2 8319 #: kdecore/klocale_kde.cpp:2267 8320 #, kde-format 8321 msgctxt "concatenation of date/time and time zone" 8322 msgid "%1 %2" 8323 msgstr "%1 %2" 8324 8325 #: kdecore/ksavefile.cpp:99 8326 #, kde-format 8327 msgid "No target filename has been given." 8328 msgstr "" 8329 8330 #: kdecore/ksavefile.cpp:106 8331 #, kde-format 8332 msgid "Already opened." 8333 msgstr "" 8334 8335 #: kdecore/ksavefile.cpp:135 8336 #, kde-format 8337 msgid "Insufficient permissions in target directory." 8338 msgstr "" 8339 8340 #: kdecore/ksavefile.cpp:139 8341 #, kde-format 8342 msgid "Unable to open temporary file." 8343 msgstr "" 8344 8345 #: kdecore/ksavefile.cpp:249 8346 #, kde-format 8347 msgid "Synchronization to disk failed" 8348 msgstr "" 8349 8350 #: kdecore/ksavefile.cpp:280 8351 #, kde-format 8352 msgid "Error during rename." 8353 msgstr "" 8354 8355 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8356 #, kde-format 8357 msgid "Timed out trying to connect to remote host" 8358 msgstr "سعی اتمام وقت برای اتصال به میزبان دور" 8359 8360 #: kdecore/netsupp.cpp:866 8361 #, kde-format 8362 msgid "address family for nodename not supported" 8363 msgstr "خانواده نشانی برای نام گره پشتیبانی نمیشود" 8364 8365 #: kdecore/netsupp.cpp:868 8366 #, kde-format 8367 msgid "invalid value for 'ai_flags'" 8368 msgstr "مقدار نامعتبر برای »ai_flags«" 8369 8370 #: kdecore/netsupp.cpp:870 8371 #, kde-format 8372 msgid "'ai_family' not supported" 8373 msgstr "«ai_family»پشتیبانی نمیشود." 8374 8375 #: kdecore/netsupp.cpp:872 8376 #, kde-format 8377 msgid "no address associated with nodename" 8378 msgstr "هیچ نشانی با نام گره مشترک نیست" 8379 8380 #: kdecore/netsupp.cpp:874 8381 #, kde-format 8382 msgid "servname not supported for ai_socktype" 8383 msgstr "نام کارساز برای ai_socktype پشتیبانی نمیشود" 8384 8385 #: kdecore/netsupp.cpp:875 8386 #, kde-format 8387 msgid "'ai_socktype' not supported" 8388 msgstr "«ai_socktype» پشتیبانی نمیشود" 8389 8390 #: kdecore/netsupp.cpp:876 8391 #, kde-format 8392 msgid "system error" 8393 msgstr "خطای سیستم" 8394 8395 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8396 #, kde-format 8397 msgid "KDE Test Program" 8398 msgstr "برنامه تست KDE" 8399 8400 #: kdecore/TIMEZONES:1 8401 #, kde-format 8402 msgid "Africa/Abidjan" 8403 msgstr "آفریقا/آبیجان" 8404 8405 #: kdecore/TIMEZONES:2 8406 #, kde-format 8407 msgid "Africa/Accra" 8408 msgstr "آفریقا/آکرا" 8409 8410 #: kdecore/TIMEZONES:3 8411 #, kde-format 8412 msgid "Africa/Addis_Ababa" 8413 msgstr "آفریقا/آدیس آبابا" 8414 8415 #: kdecore/TIMEZONES:4 8416 #, kde-format 8417 msgid "Africa/Algiers" 8418 msgstr "آفریقا/الجزیره" 8419 8420 #: kdecore/TIMEZONES:5 8421 #, kde-format 8422 msgid "Africa/Asmara" 8423 msgstr "آفریقا/آسمارا" 8424 8425 #: kdecore/TIMEZONES:6 8426 #, kde-format 8427 msgid "Africa/Asmera" 8428 msgstr "آفریقا/آسمرا" 8429 8430 #: kdecore/TIMEZONES:7 8431 #, kde-format 8432 msgid "Africa/Bamako" 8433 msgstr "آفریقا/باماکو" 8434 8435 #: kdecore/TIMEZONES:8 8436 #, kde-format 8437 msgid "Africa/Bangui" 8438 msgstr "آفریقا/بانگوئی" 8439 8440 #: kdecore/TIMEZONES:9 8441 #, kde-format 8442 msgid "Africa/Banjul" 8443 msgstr "آفریقا/بانجول" 8444 8445 #: kdecore/TIMEZONES:10 8446 #, kde-format 8447 msgid "Africa/Bissau" 8448 msgstr "آفریقا/بیسائو" 8449 8450 #: kdecore/TIMEZONES:11 8451 #, kde-format 8452 msgid "Africa/Blantyre" 8453 msgstr "آفریقا/بلنتایر" 8454 8455 #: kdecore/TIMEZONES:12 8456 #, kde-format 8457 msgid "Africa/Brazzaville" 8458 msgstr "آفریقا/برازاویل" 8459 8460 #: kdecore/TIMEZONES:13 8461 #, kde-format 8462 msgid "Africa/Bujumbura" 8463 msgstr "آفریقا/بوجومبورا" 8464 8465 #: kdecore/TIMEZONES:14 8466 #, kde-format 8467 msgid "Africa/Cairo" 8468 msgstr "آفریقا/کایرو" 8469 8470 #: kdecore/TIMEZONES:15 8471 #, kde-format 8472 msgid "Africa/Casablanca" 8473 msgstr "آفریقا/کازابلانکا" 8474 8475 #: kdecore/TIMEZONES:16 8476 #, kde-format 8477 msgid "Africa/Ceuta" 8478 msgstr "آفریقا/سئوتا" 8479 8480 #. i18n: comment to the previous timezone 8481 #: kdecore/TIMEZONES:18 8482 #, kde-format 8483 msgid "Ceuta & Melilla" 8484 msgstr "" 8485 8486 #. i18n: comment to the previous timezone 8487 #: kdecore/TIMEZONES:20 8488 #, kde-format 8489 msgid "Ceuta, Melilla" 8490 msgstr "" 8491 8492 #: kdecore/TIMEZONES:21 8493 #, kde-format 8494 msgid "Africa/Conakry" 8495 msgstr "آفریقا/کوناکری" 8496 8497 #: kdecore/TIMEZONES:22 8498 #, kde-format 8499 msgid "Africa/Dakar" 8500 msgstr "آفریقا/داکار" 8501 8502 #: kdecore/TIMEZONES:23 8503 #, kde-format 8504 msgid "Africa/Dar_es_Salaam" 8505 msgstr "آفریقا/دارالسلام" 8506 8507 #: kdecore/TIMEZONES:24 8508 #, kde-format 8509 msgid "Africa/Djibouti" 8510 msgstr "آفریقا/جیبوتی" 8511 8512 #: kdecore/TIMEZONES:25 8513 #, kde-format 8514 msgid "Africa/Douala" 8515 msgstr "آفریقا/دوآلا" 8516 8517 #: kdecore/TIMEZONES:26 8518 #, kde-format 8519 msgid "Africa/El_Aaiun" 8520 msgstr "آفریقا/العیون" 8521 8522 #: kdecore/TIMEZONES:27 8523 #, kde-format 8524 msgid "Africa/Freetown" 8525 msgstr "آفریقا/فریتاون" 8526 8527 #: kdecore/TIMEZONES:28 8528 #, kde-format 8529 msgid "Africa/Gaborone" 8530 msgstr "آفریقا/گابورونی" 8531 8532 #: kdecore/TIMEZONES:29 8533 #, kde-format 8534 msgid "Africa/Harare" 8535 msgstr "آفریقا/هراره" 8536 8537 #: kdecore/TIMEZONES:30 8538 #, kde-format 8539 msgid "Africa/Johannesburg" 8540 msgstr "آفریقا/یوهانسبورگ" 8541 8542 #: kdecore/TIMEZONES:31 8543 #, fuzzy, kde-format 8544 #| msgid "Africa/Ceuta" 8545 msgid "Africa/Juba" 8546 msgstr "آفریقا/سئوتا" 8547 8548 #: kdecore/TIMEZONES:32 8549 #, kde-format 8550 msgid "Africa/Kampala" 8551 msgstr "آفریقا/کامپالا" 8552 8553 #: kdecore/TIMEZONES:33 8554 #, kde-format 8555 msgid "Africa/Khartoum" 8556 msgstr "آفریقا/خارطوم" 8557 8558 #: kdecore/TIMEZONES:34 8559 #, kde-format 8560 msgid "Africa/Kigali" 8561 msgstr "آفریقا/کیگالی" 8562 8563 #: kdecore/TIMEZONES:35 8564 #, kde-format 8565 msgid "Africa/Kinshasa" 8566 msgstr "آفریقا/کین ساشا" 8567 8568 #. i18n: comment to the previous timezone 8569 #: kdecore/TIMEZONES:37 8570 #, kde-format 8571 msgid "west Dem. Rep. of Congo" 8572 msgstr "" 8573 8574 #. i18n: comment to the previous timezone 8575 #: kdecore/TIMEZONES:39 8576 #, kde-format 8577 msgid "Dem. Rep. of Congo (west)" 8578 msgstr "" 8579 8580 #: kdecore/TIMEZONES:40 8581 #, kde-format 8582 msgid "Africa/Lagos" 8583 msgstr "آفریقا/لاگوس" 8584 8585 #: kdecore/TIMEZONES:41 8586 #, kde-format 8587 msgid "Africa/Libreville" 8588 msgstr "آفریقا/لیبرویل" 8589 8590 #: kdecore/TIMEZONES:42 8591 #, kde-format 8592 msgid "Africa/Lome" 8593 msgstr "آفریقا/لومه" 8594 8595 #: kdecore/TIMEZONES:43 8596 #, kde-format 8597 msgid "Africa/Luanda" 8598 msgstr "آفریقا/لواندا" 8599 8600 #: kdecore/TIMEZONES:44 8601 #, kde-format 8602 msgid "Africa/Lubumbashi" 8603 msgstr "آفریقا/لوبومباشی" 8604 8605 #. i18n: comment to the previous timezone 8606 #: kdecore/TIMEZONES:46 8607 #, kde-format 8608 msgid "east Dem. Rep. of Congo" 8609 msgstr "" 8610 8611 #. i18n: comment to the previous timezone 8612 #: kdecore/TIMEZONES:48 8613 #, kde-format 8614 msgid "Dem. Rep. of Congo (east)" 8615 msgstr "" 8616 8617 #: kdecore/TIMEZONES:49 8618 #, kde-format 8619 msgid "Africa/Lusaka" 8620 msgstr "آفریقا/لوزاکا" 8621 8622 #: kdecore/TIMEZONES:50 8623 #, kde-format 8624 msgid "Africa/Malabo" 8625 msgstr "آفریقا/مالابو" 8626 8627 #: kdecore/TIMEZONES:51 8628 #, kde-format 8629 msgid "Africa/Maputo" 8630 msgstr "آفریقا/ماپوتو" 8631 8632 #: kdecore/TIMEZONES:52 8633 #, kde-format 8634 msgid "Africa/Maseru" 8635 msgstr "آفریقا/مزرو" 8636 8637 #: kdecore/TIMEZONES:53 8638 #, kde-format 8639 msgid "Africa/Mbabane" 8640 msgstr "آفریقا/مبابان" 8641 8642 #: kdecore/TIMEZONES:54 8643 #, kde-format 8644 msgid "Africa/Mogadishu" 8645 msgstr "آفریقا/موگادیشو" 8646 8647 #: kdecore/TIMEZONES:55 8648 #, kde-format 8649 msgid "Africa/Monrovia" 8650 msgstr "آفریقا/مونروویا" 8651 8652 #: kdecore/TIMEZONES:56 8653 #, kde-format 8654 msgid "Africa/Nairobi" 8655 msgstr "آفریقا/نایروبی" 8656 8657 #: kdecore/TIMEZONES:57 8658 #, kde-format 8659 msgid "Africa/Ndjamena" 8660 msgstr "آفریقا/نجامنا" 8661 8662 #: kdecore/TIMEZONES:58 8663 #, kde-format 8664 msgid "Africa/Niamey" 8665 msgstr "آفریقا/نیامه" 8666 8667 #: kdecore/TIMEZONES:59 8668 #, kde-format 8669 msgid "Africa/Nouakchott" 8670 msgstr "آفریقا/نواکشوت" 8671 8672 #: kdecore/TIMEZONES:60 8673 #, kde-format 8674 msgid "Africa/Ouagadougou" 8675 msgstr "آفریقا/واگادوگو" 8676 8677 #: kdecore/TIMEZONES:61 8678 #, kde-format 8679 msgid "Africa/Porto-Novo" 8680 msgstr "آفریقا/پورتونوو" 8681 8682 #: kdecore/TIMEZONES:62 8683 #, fuzzy, kde-format 8684 #| msgid "Africa/Ceuta" 8685 msgid "Africa/Pretoria" 8686 msgstr "آفریقا/سئوتا" 8687 8688 #: kdecore/TIMEZONES:63 8689 #, kde-format 8690 msgid "Africa/Sao_Tome" 8691 msgstr "آفریقا/سائو تومه" 8692 8693 #: kdecore/TIMEZONES:64 8694 #, kde-format 8695 msgid "Africa/Timbuktu" 8696 msgstr "آفریقا/تیمبوکتو" 8697 8698 #: kdecore/TIMEZONES:65 8699 #, kde-format 8700 msgid "Africa/Tripoli" 8701 msgstr "آفریقا/طرابلس" 8702 8703 #: kdecore/TIMEZONES:66 8704 #, kde-format 8705 msgid "Africa/Tunis" 8706 msgstr "آفریقا/تونس" 8707 8708 #: kdecore/TIMEZONES:67 8709 #, kde-format 8710 msgid "Africa/Windhoek" 8711 msgstr "آفریقا/ویندهوک" 8712 8713 #: kdecore/TIMEZONES:68 8714 #, kde-format 8715 msgid "America/Adak" 8716 msgstr "آمریکا/ایدک" 8717 8718 #. i18n: comment to the previous timezone 8719 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8720 #, kde-format 8721 msgid "Aleutian Islands" 8722 msgstr "" 8723 8724 #: kdecore/TIMEZONES:71 8725 #, kde-format 8726 msgid "America/Anchorage" 8727 msgstr "آمریکا/آنکریج" 8728 8729 #. i18n: comment to the previous timezone 8730 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8731 #, kde-format 8732 msgid "Alaska Time" 8733 msgstr "" 8734 8735 #. i18n: comment to the previous timezone 8736 #: kdecore/TIMEZONES:75 8737 #, kde-format 8738 msgid "Alaska (most areas)" 8739 msgstr "" 8740 8741 #: kdecore/TIMEZONES:76 8742 #, kde-format 8743 msgid "America/Anguilla" 8744 msgstr "آمریکا/آنگویلا" 8745 8746 #: kdecore/TIMEZONES:77 8747 #, kde-format 8748 msgid "America/Antigua" 8749 msgstr "آمریکا/آنتیگا" 8750 8751 #: kdecore/TIMEZONES:78 8752 #, kde-format 8753 msgid "America/Araguaina" 8754 msgstr "آمریکا/آراگواینا" 8755 8756 #. i18n: comment to the previous timezone 8757 #: kdecore/TIMEZONES:80 8758 #, kde-format 8759 msgid "Tocantins" 8760 msgstr "" 8761 8762 #: kdecore/TIMEZONES:81 8763 #, kde-format 8764 msgid "America/Argentina/Buenos_Aires" 8765 msgstr "آمریکا/آرژانتین/بوینس آیرس" 8766 8767 #. i18n: comment to the previous timezone 8768 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8769 #, kde-format 8770 msgid "Buenos Aires (BA, CF)" 8771 msgstr "" 8772 8773 #: kdecore/TIMEZONES:84 8774 #, kde-format 8775 msgid "America/Argentina/Catamarca" 8776 msgstr "آمریکا/آرژانتین/کاتامارکا" 8777 8778 #. i18n: comment to the previous timezone 8779 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8780 #, kde-format 8781 msgid "Catamarca (CT), Chubut (CH)" 8782 msgstr "" 8783 8784 #. i18n: comment to the previous timezone 8785 #: kdecore/TIMEZONES:88 8786 #, kde-format 8787 msgid "Catamarca (CT); Chubut (CH)" 8788 msgstr "" 8789 8790 #: kdecore/TIMEZONES:89 8791 #, kde-format 8792 msgid "America/Argentina/ComodRivadavia" 8793 msgstr "آمریکا/آرژانتین/کومودریوادیویا" 8794 8795 #: kdecore/TIMEZONES:92 8796 #, kde-format 8797 msgid "America/Argentina/Cordoba" 8798 msgstr "آمریکا/آرژانتین/کوردابا" 8799 8800 #. i18n: comment to the previous timezone 8801 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8802 #, kde-format 8803 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8804 msgstr "" 8805 8806 #. i18n: comment to the previous timezone 8807 #: kdecore/TIMEZONES:96 8808 #, kde-format 8809 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8810 msgstr "" 8811 8812 #. i18n: comment to the previous timezone 8813 #: kdecore/TIMEZONES:98 8814 #, kde-format 8815 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8816 msgstr "" 8817 8818 #: kdecore/TIMEZONES:99 8819 #, kde-format 8820 msgid "America/Argentina/Jujuy" 8821 msgstr "آمریکا/آرژانتین/خوخوئی" 8822 8823 #. i18n: comment to the previous timezone 8824 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8825 #, kde-format 8826 msgid "Jujuy (JY)" 8827 msgstr "" 8828 8829 #: kdecore/TIMEZONES:102 8830 #, kde-format 8831 msgid "America/Argentina/La_Rioja" 8832 msgstr "آمریکا/آرژانتین/لاریوجا" 8833 8834 #. i18n: comment to the previous timezone 8835 #: kdecore/TIMEZONES:104 8836 #, kde-format 8837 msgid "La Rioja (LR)" 8838 msgstr "" 8839 8840 #: kdecore/TIMEZONES:105 8841 #, kde-format 8842 msgid "America/Argentina/Mendoza" 8843 msgstr "آمریکا/آرژانتین/مندوزا" 8844 8845 #. i18n: comment to the previous timezone 8846 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8847 #, kde-format 8848 msgid "Mendoza (MZ)" 8849 msgstr "" 8850 8851 #: kdecore/TIMEZONES:108 8852 #, kde-format 8853 msgid "America/Argentina/Rio_Gallegos" 8854 msgstr "آمریکا/آرژانتین/ریوگالئوس" 8855 8856 #. i18n: comment to the previous timezone 8857 #: kdecore/TIMEZONES:110 8858 #, kde-format 8859 msgid "Santa Cruz (SC)" 8860 msgstr "" 8861 8862 #: kdecore/TIMEZONES:111 8863 #, fuzzy, kde-format 8864 #| msgid "America/Argentina/San_Juan" 8865 msgid "America/Argentina/Salta" 8866 msgstr "آمریکا/آرژانتین/سن ژوئن" 8867 8868 #. i18n: comment to the previous timezone 8869 #: kdecore/TIMEZONES:113 8870 #, kde-format 8871 msgid "(SA, LP, NQ, RN)" 8872 msgstr "" 8873 8874 #. i18n: comment to the previous timezone 8875 #: kdecore/TIMEZONES:115 8876 #, kde-format 8877 msgid "Salta (SA, LP, NQ, RN)" 8878 msgstr "" 8879 8880 #: kdecore/TIMEZONES:116 8881 #, kde-format 8882 msgid "America/Argentina/San_Juan" 8883 msgstr "آمریکا/آرژانتین/سن ژوئن" 8884 8885 #. i18n: comment to the previous timezone 8886 #: kdecore/TIMEZONES:118 8887 #, kde-format 8888 msgid "San Juan (SJ)" 8889 msgstr "" 8890 8891 #: kdecore/TIMEZONES:119 8892 #, fuzzy, kde-format 8893 #| msgid "America/Argentina/San_Juan" 8894 msgid "America/Argentina/San_Luis" 8895 msgstr "آمریکا/آرژانتین/سن ژوئن" 8896 8897 #. i18n: comment to the previous timezone 8898 #: kdecore/TIMEZONES:121 8899 #, kde-format 8900 msgid "San Luis (SL)" 8901 msgstr "" 8902 8903 #: kdecore/TIMEZONES:122 8904 #, kde-format 8905 msgid "America/Argentina/Tucuman" 8906 msgstr "آمریکا/آرژانتین/توکمن" 8907 8908 #. i18n: comment to the previous timezone 8909 #: kdecore/TIMEZONES:124 8910 #, kde-format 8911 msgid "Tucuman (TM)" 8912 msgstr "" 8913 8914 #: kdecore/TIMEZONES:125 8915 #, kde-format 8916 msgid "America/Argentina/Ushuaia" 8917 msgstr "آمریکا/آرژانتین/آشوایا" 8918 8919 #. i18n: comment to the previous timezone 8920 #: kdecore/TIMEZONES:127 8921 #, kde-format 8922 msgid "Tierra del Fuego (TF)" 8923 msgstr "" 8924 8925 #: kdecore/TIMEZONES:128 8926 #, kde-format 8927 msgid "America/Aruba" 8928 msgstr "آمریکا/آروبا" 8929 8930 #: kdecore/TIMEZONES:129 8931 #, kde-format 8932 msgid "America/Asuncion" 8933 msgstr "آمریکا/آسونسیون" 8934 8935 #: kdecore/TIMEZONES:130 8936 #, kde-format 8937 msgid "America/Atikokan" 8938 msgstr "آمریکا/آتیکُکان" 8939 8940 #. i18n: comment to the previous timezone 8941 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8942 #, kde-format 8943 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8944 msgstr "" 8945 8946 #. i18n: comment to the previous timezone 8947 #: kdecore/TIMEZONES:134 8948 #, kde-format 8949 msgid "EST - ON (Atikokan); NU (Coral H)" 8950 msgstr "" 8951 8952 #: kdecore/TIMEZONES:135 8953 #, fuzzy, kde-format 8954 #| msgid "America/Atikokan" 8955 msgid "America/Atka" 8956 msgstr "آمریکا/آتیکُکان" 8957 8958 #: kdecore/TIMEZONES:138 8959 #, kde-format 8960 msgid "America/Bahia" 8961 msgstr "آمریکا/باهیا" 8962 8963 #. i18n: comment to the previous timezone 8964 #: kdecore/TIMEZONES:140 8965 #, kde-format 8966 msgid "Bahia" 8967 msgstr "" 8968 8969 #: kdecore/TIMEZONES:141 8970 #, fuzzy, kde-format 8971 #| msgid "America/Bahia" 8972 msgid "America/Bahia_Banderas" 8973 msgstr "آمریکا/باهیا" 8974 8975 #. i18n: comment to the previous timezone 8976 #: kdecore/TIMEZONES:143 8977 #, kde-format 8978 msgid "Mexican Central Time - Bahia de Banderas" 8979 msgstr "" 8980 8981 #. i18n: comment to the previous timezone 8982 #: kdecore/TIMEZONES:145 8983 #, kde-format 8984 msgid "Central Time - Bahia de Banderas" 8985 msgstr "" 8986 8987 #: kdecore/TIMEZONES:146 8988 #, kde-format 8989 msgid "America/Barbados" 8990 msgstr "آمریکا/باربادوس" 8991 8992 #: kdecore/TIMEZONES:147 8993 #, kde-format 8994 msgid "America/Belem" 8995 msgstr "آمریکا/بلئین" 8996 8997 #. i18n: comment to the previous timezone 8998 #: kdecore/TIMEZONES:149 8999 #, kde-format 9000 msgid "Amapa, E Para" 9001 msgstr "" 9002 9003 #. i18n: comment to the previous timezone 9004 #: kdecore/TIMEZONES:151 9005 #, kde-format 9006 msgid "Para (east); Amapa" 9007 msgstr "" 9008 9009 #: kdecore/TIMEZONES:152 9010 #, kde-format 9011 msgid "America/Belize" 9012 msgstr "آمریکا/بلیز" 9013 9014 #: kdecore/TIMEZONES:153 9015 #, kde-format 9016 msgid "America/Blanc-Sablon" 9017 msgstr "آمریکا/بلانک-سابلُن" 9018 9019 #. i18n: comment to the previous timezone 9020 #: kdecore/TIMEZONES:155 9021 #, kde-format 9022 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9023 msgstr "" 9024 9025 #. i18n: comment to the previous timezone 9026 #: kdecore/TIMEZONES:157 9027 #, kde-format 9028 msgid "AST - QC (Lower North Shore)" 9029 msgstr "" 9030 9031 #: kdecore/TIMEZONES:158 9032 #, kde-format 9033 msgid "America/Boa_Vista" 9034 msgstr "آمریکا/بوئاویشتا" 9035 9036 #. i18n: comment to the previous timezone 9037 #: kdecore/TIMEZONES:160 9038 #, kde-format 9039 msgid "Roraima" 9040 msgstr "" 9041 9042 #: kdecore/TIMEZONES:161 9043 #, kde-format 9044 msgid "America/Bogota" 9045 msgstr "آمریکا/بوگوتا" 9046 9047 #: kdecore/TIMEZONES:162 9048 #, kde-format 9049 msgid "America/Boise" 9050 msgstr "آمریکا/بویسی" 9051 9052 #. i18n: comment to the previous timezone 9053 #: kdecore/TIMEZONES:164 9054 #, kde-format 9055 msgid "Mountain Time - south Idaho & east Oregon" 9056 msgstr "" 9057 9058 #. i18n: comment to the previous timezone 9059 #: kdecore/TIMEZONES:166 9060 #, kde-format 9061 msgid "Mountain - ID (south); OR (east)" 9062 msgstr "" 9063 9064 #: kdecore/TIMEZONES:167 9065 #, kde-format 9066 msgid "America/Buenos_Aires" 9067 msgstr "آمریکا/بوینوس آیرس" 9068 9069 #: kdecore/TIMEZONES:170 9070 #, fuzzy, kde-format 9071 #| msgid "America/Cayman" 9072 msgid "America/Calgary" 9073 msgstr "آمریکا/کیمن" 9074 9075 #. i18n: comment to the previous timezone 9076 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9077 #, kde-format 9078 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9079 msgstr "" 9080 9081 #: kdecore/TIMEZONES:173 9082 #, kde-format 9083 msgid "America/Cambridge_Bay" 9084 msgstr "آمریکا/خلیج کمبریج" 9085 9086 #. i18n: comment to the previous timezone 9087 #: kdecore/TIMEZONES:175 9088 #, kde-format 9089 msgid "Mountain Time - west Nunavut" 9090 msgstr "" 9091 9092 #. i18n: comment to the previous timezone 9093 #: kdecore/TIMEZONES:177 9094 #, kde-format 9095 msgid "Mountain - NU (west)" 9096 msgstr "" 9097 9098 #: kdecore/TIMEZONES:178 9099 #, kde-format 9100 msgid "America/Campo_Grande" 9101 msgstr "آمریکا/کامپوگراند" 9102 9103 #. i18n: comment to the previous timezone 9104 #: kdecore/TIMEZONES:180 9105 #, kde-format 9106 msgid "Mato Grosso do Sul" 9107 msgstr "" 9108 9109 #: kdecore/TIMEZONES:181 9110 #, kde-format 9111 msgid "America/Cancun" 9112 msgstr "آمریکا/کانکون" 9113 9114 #. i18n: comment to the previous timezone 9115 #: kdecore/TIMEZONES:183 9116 #, kde-format 9117 msgid "Central Time - Quintana Roo" 9118 msgstr "" 9119 9120 #. i18n: comment to the previous timezone 9121 #: kdecore/TIMEZONES:185 9122 #, kde-format 9123 msgid "Eastern Standard Time - Quintana Roo" 9124 msgstr "" 9125 9126 #: kdecore/TIMEZONES:186 9127 #, kde-format 9128 msgid "America/Caracas" 9129 msgstr "آمریکا/کاراکاس" 9130 9131 #: kdecore/TIMEZONES:187 9132 #, kde-format 9133 msgid "America/Catamarca" 9134 msgstr "آمریکا/کاتامارکا" 9135 9136 #: kdecore/TIMEZONES:190 9137 #, kde-format 9138 msgid "America/Cayenne" 9139 msgstr "آمریکا/کاین" 9140 9141 #: kdecore/TIMEZONES:191 9142 #, kde-format 9143 msgid "America/Cayman" 9144 msgstr "آمریکا/کیمن" 9145 9146 #: kdecore/TIMEZONES:192 9147 #, kde-format 9148 msgid "America/Chicago" 9149 msgstr "آمریکا/شیکاگو" 9150 9151 #. i18n: comment to the previous timezone 9152 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9153 #, kde-format 9154 msgid "Central Time" 9155 msgstr "" 9156 9157 #. i18n: comment to the previous timezone 9158 #: kdecore/TIMEZONES:196 9159 #, kde-format 9160 msgid "Central (most areas)" 9161 msgstr "" 9162 9163 #: kdecore/TIMEZONES:197 9164 #, kde-format 9165 msgid "America/Chihuahua" 9166 msgstr "آمریکا/چیئوائوا" 9167 9168 #. i18n: comment to the previous timezone 9169 #: kdecore/TIMEZONES:199 9170 #, kde-format 9171 msgid "Mountain Time - Chihuahua" 9172 msgstr "" 9173 9174 #. i18n: comment to the previous timezone 9175 #: kdecore/TIMEZONES:201 9176 #, kde-format 9177 msgid "Mexican Mountain Time - Chihuahua away from US border" 9178 msgstr "" 9179 9180 #. i18n: comment to the previous timezone 9181 #: kdecore/TIMEZONES:203 9182 #, kde-format 9183 msgid "Mountain Time - Chihuahua (most areas)" 9184 msgstr "" 9185 9186 #: kdecore/TIMEZONES:204 9187 #, fuzzy, kde-format 9188 #| msgid "America/Curacao" 9189 msgid "America/Coral_Harbour" 9190 msgstr "آمریکا/کوراسائو" 9191 9192 #: kdecore/TIMEZONES:207 9193 #, kde-format 9194 msgid "America/Cordoba" 9195 msgstr "آمریکا/کوردووا" 9196 9197 #: kdecore/TIMEZONES:210 9198 #, kde-format 9199 msgid "America/Costa_Rica" 9200 msgstr "آمریکا/کاستاریکا" 9201 9202 #: kdecore/TIMEZONES:211 9203 #, fuzzy, kde-format 9204 #| msgid "Africa/Freetown" 9205 msgid "America/Creston" 9206 msgstr "آفریقا/فریتاون" 9207 9208 #. i18n: comment to the previous timezone 9209 #: kdecore/TIMEZONES:213 9210 #, kde-format 9211 msgid "Mountain Standard Time - Creston, British Columbia" 9212 msgstr "" 9213 9214 #. i18n: comment to the previous timezone 9215 #: kdecore/TIMEZONES:215 9216 #, kde-format 9217 msgid "MST - BC (Creston)" 9218 msgstr "" 9219 9220 #: kdecore/TIMEZONES:216 9221 #, kde-format 9222 msgid "America/Cuiaba" 9223 msgstr "آمریکا/کویاوا" 9224 9225 #. i18n: comment to the previous timezone 9226 #: kdecore/TIMEZONES:218 9227 #, kde-format 9228 msgid "Mato Grosso" 9229 msgstr "" 9230 9231 #: kdecore/TIMEZONES:219 9232 #, kde-format 9233 msgid "America/Curacao" 9234 msgstr "آمریکا/کوراسائو" 9235 9236 #: kdecore/TIMEZONES:220 9237 #, kde-format 9238 msgid "America/Danmarkshavn" 9239 msgstr "آمریکا/دانمارکشاون" 9240 9241 #. i18n: comment to the previous timezone 9242 #: kdecore/TIMEZONES:222 9243 #, kde-format 9244 msgid "east coast, north of Scoresbysund" 9245 msgstr "" 9246 9247 #. i18n: comment to the previous timezone 9248 #: kdecore/TIMEZONES:224 9249 #, kde-format 9250 msgid "National Park (east coast)" 9251 msgstr "" 9252 9253 #: kdecore/TIMEZONES:225 9254 #, kde-format 9255 msgid "America/Dawson" 9256 msgstr "آمریکا/داوسن" 9257 9258 #. i18n: comment to the previous timezone 9259 #: kdecore/TIMEZONES:227 9260 #, kde-format 9261 msgid "Pacific Time - north Yukon" 9262 msgstr "" 9263 9264 #. i18n: comment to the previous timezone 9265 #: kdecore/TIMEZONES:229 9266 #, kde-format 9267 msgid "MST - Yukon (west)" 9268 msgstr "" 9269 9270 #: kdecore/TIMEZONES:230 9271 #, kde-format 9272 msgid "America/Dawson_Creek" 9273 msgstr "آمریکا/داوسن کریک" 9274 9275 #. i18n: comment to the previous timezone 9276 #: kdecore/TIMEZONES:232 9277 #, kde-format 9278 msgid "" 9279 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9280 msgstr "" 9281 9282 #. i18n: comment to the previous timezone 9283 #: kdecore/TIMEZONES:234 9284 #, kde-format 9285 msgid "MST - BC (Dawson Cr, Ft St John)" 9286 msgstr "" 9287 9288 #: kdecore/TIMEZONES:235 9289 #, kde-format 9290 msgid "America/Denver" 9291 msgstr "آمریکا/دنور" 9292 9293 #. i18n: comment to the previous timezone 9294 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9295 #, kde-format 9296 msgid "Mountain Time" 9297 msgstr "" 9298 9299 #. i18n: comment to the previous timezone 9300 #: kdecore/TIMEZONES:239 9301 #, kde-format 9302 msgid "Mountain (most areas)" 9303 msgstr "" 9304 9305 #: kdecore/TIMEZONES:240 9306 #, kde-format 9307 msgid "America/Detroit" 9308 msgstr "آمریکا/دترویت" 9309 9310 #. i18n: comment to the previous timezone 9311 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9312 #, kde-format 9313 msgid "Eastern Time - Michigan - most locations" 9314 msgstr "" 9315 9316 #. i18n: comment to the previous timezone 9317 #: kdecore/TIMEZONES:244 9318 #, kde-format 9319 msgid "Eastern - MI (most areas)" 9320 msgstr "" 9321 9322 #: kdecore/TIMEZONES:245 9323 #, kde-format 9324 msgid "America/Dominica" 9325 msgstr "آمریکا/دومینیکا" 9326 9327 #: kdecore/TIMEZONES:246 9328 #, kde-format 9329 msgid "America/Edmonton" 9330 msgstr "آمریکا/ادمونتون" 9331 9332 #. i18n: comment to the previous timezone 9333 #: kdecore/TIMEZONES:250 9334 #, kde-format 9335 msgid "Mountain - AB; BC (E); SK (W)" 9336 msgstr "" 9337 9338 #: kdecore/TIMEZONES:251 9339 #, kde-format 9340 msgid "America/Eirunepe" 9341 msgstr "آمریکا/یورونیپ" 9342 9343 #. i18n: comment to the previous timezone 9344 #: kdecore/TIMEZONES:253 9345 #, kde-format 9346 msgid "W Amazonas" 9347 msgstr "" 9348 9349 #. i18n: comment to the previous timezone 9350 #: kdecore/TIMEZONES:255 9351 #, kde-format 9352 msgid "Amazonas (west)" 9353 msgstr "" 9354 9355 #: kdecore/TIMEZONES:256 9356 #, kde-format 9357 msgid "America/El_Salvador" 9358 msgstr "آمریکا/السالوادور" 9359 9360 #: kdecore/TIMEZONES:257 9361 #, fuzzy, kde-format 9362 #| msgid "America/Grenada" 9363 msgid "America/Ensenada" 9364 msgstr "آمریکا/گرنیدا" 9365 9366 #. i18n: comment to the previous timezone 9367 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9368 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9369 #, fuzzy, kde-format 9370 #| msgid "Pacific/Niue" 9371 msgid "Pacific Time" 9372 msgstr "اقیانوس آرام/نیوئه" 9373 9374 #: kdecore/TIMEZONES:260 9375 #, fuzzy, kde-format 9376 #| msgid "America/Porto_Velho" 9377 msgid "America/Fort_Nelson" 9378 msgstr "آمریکا/پورترولیو" 9379 9380 #. i18n: comment to the previous timezone 9381 #: kdecore/TIMEZONES:262 9382 #, kde-format 9383 msgid "MST - BC (Ft Nelson)" 9384 msgstr "" 9385 9386 #: kdecore/TIMEZONES:263 9387 #, fuzzy, kde-format 9388 #| msgid "America/Fortaleza" 9389 msgid "America/Fort_Wayne" 9390 msgstr "آمریکا/فورتالزا" 9391 9392 #. i18n: comment to the previous timezone 9393 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9394 #: kdecore/TIMEZONES:1419 9395 #, kde-format 9396 msgid "Eastern Time - Indiana - most locations" 9397 msgstr "" 9398 9399 #: kdecore/TIMEZONES:266 9400 #, kde-format 9401 msgid "America/Fortaleza" 9402 msgstr "آمریکا/فورتالزا" 9403 9404 #. i18n: comment to the previous timezone 9405 #: kdecore/TIMEZONES:268 9406 #, kde-format 9407 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9408 msgstr "" 9409 9410 #. i18n: comment to the previous timezone 9411 #: kdecore/TIMEZONES:270 9412 #, kde-format 9413 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9414 msgstr "" 9415 9416 #: kdecore/TIMEZONES:271 9417 #, fuzzy, kde-format 9418 #| msgid "Africa/Freetown" 9419 msgid "America/Fredericton" 9420 msgstr "آفریقا/فریتاون" 9421 9422 #. i18n: comment to the previous timezone 9423 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9424 #, kde-format 9425 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9426 msgstr "" 9427 9428 #: kdecore/TIMEZONES:274 9429 #, kde-format 9430 msgid "America/Glace_Bay" 9431 msgstr "آمریکا/گلیس بی" 9432 9433 #. i18n: comment to the previous timezone 9434 #: kdecore/TIMEZONES:276 9435 #, kde-format 9436 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9437 msgstr "" 9438 9439 #. i18n: comment to the previous timezone 9440 #: kdecore/TIMEZONES:278 9441 #, fuzzy, kde-format 9442 #| msgid "Atlantic/Cape_Verde" 9443 msgid "Atlantic - NS (Cape Breton)" 9444 msgstr "اقیانوس اطلس/کیپ ورد" 9445 9446 #: kdecore/TIMEZONES:279 9447 #, kde-format 9448 msgid "America/Godthab" 9449 msgstr "آمریکا/گودآپ" 9450 9451 #. i18n: comment to the previous timezone 9452 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9453 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9454 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9455 #: kdecore/TIMEZONES:1350 9456 #, kde-format 9457 msgid "most locations" 9458 msgstr "" 9459 9460 #: kdecore/TIMEZONES:282 9461 #, kde-format 9462 msgid "America/Goose_Bay" 9463 msgstr "آمریکا/خلیج گوس" 9464 9465 #. i18n: comment to the previous timezone 9466 #: kdecore/TIMEZONES:284 9467 #, kde-format 9468 msgid "Atlantic Time - Labrador - most locations" 9469 msgstr "" 9470 9471 #. i18n: comment to the previous timezone 9472 #: kdecore/TIMEZONES:286 9473 #, kde-format 9474 msgid "Atlantic - Labrador (most areas)" 9475 msgstr "" 9476 9477 #: kdecore/TIMEZONES:287 9478 #, kde-format 9479 msgid "America/Grand_Turk" 9480 msgstr "آمریکا/گراند تورک" 9481 9482 #: kdecore/TIMEZONES:288 9483 #, kde-format 9484 msgid "America/Grenada" 9485 msgstr "آمریکا/گرنیدا" 9486 9487 #: kdecore/TIMEZONES:289 9488 #, kde-format 9489 msgid "America/Guadeloupe" 9490 msgstr "آمریکا/گوآدلوپ" 9491 9492 #: kdecore/TIMEZONES:290 9493 #, kde-format 9494 msgid "America/Guatemala" 9495 msgstr "آمریکا/گوآتمالا" 9496 9497 #: kdecore/TIMEZONES:291 9498 #, kde-format 9499 msgid "America/Guayaquil" 9500 msgstr "آمریکا/گوایاکیل" 9501 9502 #. i18n: comment to the previous timezone 9503 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9504 #: kdecore/TIMEZONES:1400 9505 #, kde-format 9506 msgid "mainland" 9507 msgstr "" 9508 9509 #. i18n: comment to the previous timezone 9510 #: kdecore/TIMEZONES:295 9511 #, kde-format 9512 msgid "Ecuador (mainland)" 9513 msgstr "" 9514 9515 #: kdecore/TIMEZONES:296 9516 #, kde-format 9517 msgid "America/Guyana" 9518 msgstr "آمریکا/گویانا" 9519 9520 #: kdecore/TIMEZONES:297 9521 #, kde-format 9522 msgid "America/Halifax" 9523 msgstr "آمریکا/هلیفکس" 9524 9525 #. i18n: comment to the previous timezone 9526 #: kdecore/TIMEZONES:301 9527 #, kde-format 9528 msgid "Atlantic - NS (most areas); PE" 9529 msgstr "" 9530 9531 #: kdecore/TIMEZONES:302 9532 #, kde-format 9533 msgid "America/Havana" 9534 msgstr "آمریکا/هاوانا" 9535 9536 #: kdecore/TIMEZONES:303 9537 #, kde-format 9538 msgid "America/Hermosillo" 9539 msgstr "آمریکا/ارموسیلو" 9540 9541 #. i18n: comment to the previous timezone 9542 #: kdecore/TIMEZONES:305 9543 #, kde-format 9544 msgid "Mountain Standard Time - Sonora" 9545 msgstr "" 9546 9547 #: kdecore/TIMEZONES:306 9548 #, kde-format 9549 msgid "America/Indiana/Indianapolis" 9550 msgstr "آمریکا/ایندیانا/ایندیاناپُلیس" 9551 9552 #. i18n: comment to the previous timezone 9553 #: kdecore/TIMEZONES:310 9554 #, kde-format 9555 msgid "Eastern - IN (most areas)" 9556 msgstr "" 9557 9558 #: kdecore/TIMEZONES:311 9559 #, kde-format 9560 msgid "America/Indiana/Knox" 9561 msgstr "آمریکا/ایندیانا/ناکس" 9562 9563 #. i18n: comment to the previous timezone 9564 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9565 #, kde-format 9566 msgid "Eastern Time - Indiana - Starke County" 9567 msgstr "" 9568 9569 #. i18n: comment to the previous timezone 9570 #: kdecore/TIMEZONES:315 9571 #, kde-format 9572 msgid "Central Time - Indiana - Starke County" 9573 msgstr "" 9574 9575 #. i18n: comment to the previous timezone 9576 #: kdecore/TIMEZONES:317 9577 #, kde-format 9578 msgid "Central - IN (Starke)" 9579 msgstr "" 9580 9581 #: kdecore/TIMEZONES:318 9582 #, kde-format 9583 msgid "America/Indiana/Marengo" 9584 msgstr "آمریکا/ایندیانا/مارنگو" 9585 9586 #. i18n: comment to the previous timezone 9587 #: kdecore/TIMEZONES:320 9588 #, kde-format 9589 msgid "Eastern Time - Indiana - Crawford County" 9590 msgstr "" 9591 9592 #. i18n: comment to the previous timezone 9593 #: kdecore/TIMEZONES:322 9594 #, kde-format 9595 msgid "Eastern - IN (Crawford)" 9596 msgstr "" 9597 9598 #: kdecore/TIMEZONES:323 9599 #, kde-format 9600 msgid "America/Indiana/Petersburg" 9601 msgstr "آمریکا/ایندیانا/پترزبُرگ" 9602 9603 #. i18n: comment to the previous timezone 9604 #: kdecore/TIMEZONES:325 9605 #, kde-format 9606 msgid "Central Time - Indiana - Pike County" 9607 msgstr "" 9608 9609 #. i18n: comment to the previous timezone 9610 #: kdecore/TIMEZONES:327 9611 #, kde-format 9612 msgid "Eastern Time - Indiana - Pike County" 9613 msgstr "" 9614 9615 #. i18n: comment to the previous timezone 9616 #: kdecore/TIMEZONES:329 9617 #, kde-format 9618 msgid "Eastern - IN (Pike)" 9619 msgstr "" 9620 9621 #: kdecore/TIMEZONES:330 9622 #, kde-format 9623 msgid "America/Indiana/Tell_City" 9624 msgstr "آمریکا/ایندیانا/تِلسیتی" 9625 9626 #. i18n: comment to the previous timezone 9627 #: kdecore/TIMEZONES:332 9628 #, kde-format 9629 msgid "Central Time - Indiana - Perry County" 9630 msgstr "" 9631 9632 #. i18n: comment to the previous timezone 9633 #: kdecore/TIMEZONES:334 9634 #, kde-format 9635 msgid "Central - IN (Perry)" 9636 msgstr "" 9637 9638 #: kdecore/TIMEZONES:335 9639 #, kde-format 9640 msgid "America/Indiana/Vevay" 9641 msgstr "آمریکا/ایندیانا/ویوی" 9642 9643 #. i18n: comment to the previous timezone 9644 #: kdecore/TIMEZONES:337 9645 #, kde-format 9646 msgid "Eastern Time - Indiana - Switzerland County" 9647 msgstr "" 9648 9649 #. i18n: comment to the previous timezone 9650 #: kdecore/TIMEZONES:339 9651 #, kde-format 9652 msgid "Eastern - IN (Switzerland)" 9653 msgstr "" 9654 9655 #: kdecore/TIMEZONES:340 9656 #, kde-format 9657 msgid "America/Indiana/Vincennes" 9658 msgstr "آمریکا/ایندیانا/وینْسنْس" 9659 9660 #. i18n: comment to the previous timezone 9661 #: kdecore/TIMEZONES:342 9662 #, kde-format 9663 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9664 msgstr "" 9665 9666 #. i18n: comment to the previous timezone 9667 #: kdecore/TIMEZONES:344 9668 #, kde-format 9669 msgid "Eastern - IN (Da, Du, K, Mn)" 9670 msgstr "" 9671 9672 #: kdecore/TIMEZONES:345 9673 #, kde-format 9674 msgid "America/Indiana/Winamac" 9675 msgstr "آمریکا/ایندیانا/ویناماک" 9676 9677 #. i18n: comment to the previous timezone 9678 #: kdecore/TIMEZONES:347 9679 #, kde-format 9680 msgid "Eastern Time - Indiana - Pulaski County" 9681 msgstr "" 9682 9683 #. i18n: comment to the previous timezone 9684 #: kdecore/TIMEZONES:349 9685 #, kde-format 9686 msgid "Eastern - IN (Pulaski)" 9687 msgstr "" 9688 9689 #: kdecore/TIMEZONES:350 9690 #, kde-format 9691 msgid "America/Indianapolis" 9692 msgstr "آمریکا/ایندیاناپولیس" 9693 9694 #: kdecore/TIMEZONES:353 9695 #, kde-format 9696 msgid "America/Inuvik" 9697 msgstr "آمریکا/اینوویک" 9698 9699 #. i18n: comment to the previous timezone 9700 #: kdecore/TIMEZONES:355 9701 #, kde-format 9702 msgid "Mountain Time - west Northwest Territories" 9703 msgstr "" 9704 9705 #. i18n: comment to the previous timezone 9706 #: kdecore/TIMEZONES:357 9707 #, kde-format 9708 msgid "Mountain - NT (west)" 9709 msgstr "" 9710 9711 #: kdecore/TIMEZONES:358 9712 #, kde-format 9713 msgid "America/Iqaluit" 9714 msgstr "آمریکا/ایکلوئت" 9715 9716 #. i18n: comment to the previous timezone 9717 #: kdecore/TIMEZONES:360 9718 #, kde-format 9719 msgid "Eastern Time - east Nunavut - most locations" 9720 msgstr "" 9721 9722 #. i18n: comment to the previous timezone 9723 #: kdecore/TIMEZONES:362 9724 #, kde-format 9725 msgid "Eastern - NU (most east areas)" 9726 msgstr "" 9727 9728 #: kdecore/TIMEZONES:363 9729 #, kde-format 9730 msgid "America/Jamaica" 9731 msgstr "آمریکا/جامائیکا" 9732 9733 #: kdecore/TIMEZONES:364 9734 #, kde-format 9735 msgid "America/Jujuy" 9736 msgstr "آمریکا/خوخوئی" 9737 9738 #: kdecore/TIMEZONES:367 9739 #, kde-format 9740 msgid "America/Juneau" 9741 msgstr "آمریکا/جونو" 9742 9743 #. i18n: comment to the previous timezone 9744 #: kdecore/TIMEZONES:369 9745 #, kde-format 9746 msgid "Alaska Time - Alaska panhandle" 9747 msgstr "" 9748 9749 #. i18n: comment to the previous timezone 9750 #: kdecore/TIMEZONES:371 9751 #, kde-format 9752 msgid "Alaska - Juneau area" 9753 msgstr "" 9754 9755 #: kdecore/TIMEZONES:372 9756 #, kde-format 9757 msgid "America/Kentucky/Louisville" 9758 msgstr "آمریکا/کنتاکی/لوئیزویل" 9759 9760 #. i18n: comment to the previous timezone 9761 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9762 #, fuzzy, kde-format 9763 #| msgid "America/Kentucky/Louisville" 9764 msgid "Eastern Time - Kentucky - Louisville area" 9765 msgstr "آمریکا/کنتاکی/لوئیزویل" 9766 9767 #. i18n: comment to the previous timezone 9768 #: kdecore/TIMEZONES:376 9769 #, fuzzy, kde-format 9770 #| msgid "America/Kentucky/Louisville" 9771 msgid "Eastern - KY (Louisville area)" 9772 msgstr "آمریکا/کنتاکی/لوئیزویل" 9773 9774 #: kdecore/TIMEZONES:377 9775 #, kde-format 9776 msgid "America/Kentucky/Monticello" 9777 msgstr "آمریکا/کنتاکی/مانتیسلو" 9778 9779 #. i18n: comment to the previous timezone 9780 #: kdecore/TIMEZONES:379 9781 #, kde-format 9782 msgid "Eastern Time - Kentucky - Wayne County" 9783 msgstr "" 9784 9785 #. i18n: comment to the previous timezone 9786 #: kdecore/TIMEZONES:381 9787 #, kde-format 9788 msgid "Eastern - KY (Wayne)" 9789 msgstr "" 9790 9791 #: kdecore/TIMEZONES:382 9792 #, fuzzy, kde-format 9793 #| msgid "America/Indiana/Knox" 9794 msgid "America/Knox_IN" 9795 msgstr "آمریکا/ایندیانا/ناکس" 9796 9797 #: kdecore/TIMEZONES:385 9798 #, fuzzy, kde-format 9799 #| msgid "America/Grenada" 9800 msgid "America/Kralendijk" 9801 msgstr "آمریکا/گرنیدا" 9802 9803 #: kdecore/TIMEZONES:386 9804 #, kde-format 9805 msgid "America/La_Paz" 9806 msgstr "آمریکا/لاپاس" 9807 9808 #: kdecore/TIMEZONES:387 9809 #, kde-format 9810 msgid "America/Lima" 9811 msgstr "آمریکا/لیما" 9812 9813 #: kdecore/TIMEZONES:388 9814 #, kde-format 9815 msgid "America/Los_Angeles" 9816 msgstr "آمریکا/لوسآنجلس" 9817 9818 #. i18n: comment to the previous timezone 9819 #: kdecore/TIMEZONES:392 9820 #, fuzzy, kde-format 9821 #| msgid "Pacific/Yap" 9822 msgid "Pacific" 9823 msgstr "اقیانوس آرام/یپ" 9824 9825 #: kdecore/TIMEZONES:393 9826 #, kde-format 9827 msgid "America/Louisville" 9828 msgstr "آمریکا/لوئيزویل" 9829 9830 #: kdecore/TIMEZONES:396 9831 #, fuzzy, kde-format 9832 #| msgid "America/Port-au-Prince" 9833 msgid "America/Lower_Princes" 9834 msgstr "آمریکا/پورتوپرنس" 9835 9836 #: kdecore/TIMEZONES:397 9837 #, kde-format 9838 msgid "America/Maceio" 9839 msgstr "آمریکا/ماسیو" 9840 9841 #. i18n: comment to the previous timezone 9842 #: kdecore/TIMEZONES:399 9843 #, kde-format 9844 msgid "Alagoas, Sergipe" 9845 msgstr "" 9846 9847 #: kdecore/TIMEZONES:400 9848 #, kde-format 9849 msgid "America/Managua" 9850 msgstr "آمریکا/ماناگوئا" 9851 9852 #: kdecore/TIMEZONES:401 9853 #, kde-format 9854 msgid "America/Manaus" 9855 msgstr "آمریکا/مانوس" 9856 9857 #. i18n: comment to the previous timezone 9858 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9859 #, kde-format 9860 msgid "E Amazonas" 9861 msgstr "" 9862 9863 #. i18n: comment to the previous timezone 9864 #: kdecore/TIMEZONES:405 9865 #, kde-format 9866 msgid "Amazonas (east)" 9867 msgstr "" 9868 9869 #: kdecore/TIMEZONES:406 9870 #, fuzzy, kde-format 9871 #| msgid "America/Maceio" 9872 msgid "America/Marigot" 9873 msgstr "آمریکا/ماسیو" 9874 9875 #: kdecore/TIMEZONES:407 9876 #, kde-format 9877 msgid "America/Martinique" 9878 msgstr "آمریکا/مارتینیک" 9879 9880 #: kdecore/TIMEZONES:408 9881 #, fuzzy, kde-format 9882 #| msgid "America/Manaus" 9883 msgid "America/Matamoros" 9884 msgstr "آمریکا/مانوس" 9885 9886 #. i18n: comment to the previous timezone 9887 #: kdecore/TIMEZONES:410 9888 #, kde-format 9889 msgid "" 9890 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9891 msgstr "" 9892 9893 #. i18n: comment to the previous timezone 9894 #: kdecore/TIMEZONES:412 9895 #, kde-format 9896 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9897 msgstr "" 9898 9899 #: kdecore/TIMEZONES:413 9900 #, kde-format 9901 msgid "America/Mazatlan" 9902 msgstr "آمریکا/ماساتلان" 9903 9904 #. i18n: comment to the previous timezone 9905 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9906 #, kde-format 9907 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9908 msgstr "" 9909 9910 #. i18n: comment to the previous timezone 9911 #: kdecore/TIMEZONES:417 9912 #, kde-format 9913 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9914 msgstr "" 9915 9916 #: kdecore/TIMEZONES:418 9917 #, kde-format 9918 msgid "America/Mendoza" 9919 msgstr "آمریکا/مندوسا" 9920 9921 #: kdecore/TIMEZONES:421 9922 #, kde-format 9923 msgid "America/Menominee" 9924 msgstr "آمریکا/منامینی" 9925 9926 #. i18n: comment to the previous timezone 9927 #: kdecore/TIMEZONES:423 9928 #, kde-format 9929 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9930 msgstr "" 9931 9932 #. i18n: comment to the previous timezone 9933 #: kdecore/TIMEZONES:425 9934 #, kde-format 9935 msgid "Central - MI (Wisconsin border)" 9936 msgstr "" 9937 9938 #: kdecore/TIMEZONES:426 9939 #, kde-format 9940 msgid "America/Merida" 9941 msgstr "آمریکا/مریدا" 9942 9943 #. i18n: comment to the previous timezone 9944 #: kdecore/TIMEZONES:428 9945 #, kde-format 9946 msgid "Central Time - Campeche, Yucatan" 9947 msgstr "" 9948 9949 #: kdecore/TIMEZONES:429 9950 #, fuzzy, kde-format 9951 #| msgid "America/Mazatlan" 9952 msgid "America/Metlakatla" 9953 msgstr "آمریکا/ماساتلان" 9954 9955 #. i18n: comment to the previous timezone 9956 #: kdecore/TIMEZONES:431 9957 #, kde-format 9958 msgid "Metlakatla Time - Annette Island" 9959 msgstr "" 9960 9961 #. i18n: comment to the previous timezone 9962 #: kdecore/TIMEZONES:433 9963 #, kde-format 9964 msgid "Alaska - Annette Island" 9965 msgstr "" 9966 9967 #: kdecore/TIMEZONES:434 9968 #, kde-format 9969 msgid "America/Mexico_City" 9970 msgstr "آمریکا/مکزیکو سیتی" 9971 9972 #. i18n: comment to the previous timezone 9973 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9974 #, kde-format 9975 msgid "Central Time - most locations" 9976 msgstr "" 9977 9978 #: kdecore/TIMEZONES:439 9979 #, kde-format 9980 msgid "America/Miquelon" 9981 msgstr "آمریکا/میکلون" 9982 9983 #: kdecore/TIMEZONES:440 9984 #, kde-format 9985 msgid "America/Moncton" 9986 msgstr "آمریکا/مُنکتُن" 9987 9988 #. i18n: comment to the previous timezone 9989 #: kdecore/TIMEZONES:442 9990 #, kde-format 9991 msgid "Atlantic Time - New Brunswick" 9992 msgstr "" 9993 9994 #. i18n: comment to the previous timezone 9995 #: kdecore/TIMEZONES:444 9996 #, kde-format 9997 msgid "Atlantic - New Brunswick" 9998 msgstr "" 9999 10000 #: kdecore/TIMEZONES:445 10001 #, kde-format 10002 msgid "America/Monterrey" 10003 msgstr "آمریکا/مونترئی" 10004 10005 #. i18n: comment to the previous timezone 10006 #: kdecore/TIMEZONES:447 10007 #, kde-format 10008 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 10009 msgstr "" 10010 10011 #. i18n: comment to the previous timezone 10012 #: kdecore/TIMEZONES:449 10013 #, kde-format 10014 msgid "" 10015 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 10016 "US border" 10017 msgstr "" 10018 10019 #. i18n: comment to the previous timezone 10020 #: kdecore/TIMEZONES:451 10021 #, kde-format 10022 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 10023 msgstr "" 10024 10025 #: kdecore/TIMEZONES:452 10026 #, kde-format 10027 msgid "America/Montevideo" 10028 msgstr "آمریکا/مونته ویدیو" 10029 10030 #: kdecore/TIMEZONES:453 10031 #, kde-format 10032 msgid "America/Montreal" 10033 msgstr "آمریکا/مانتریال" 10034 10035 #. i18n: comment to the previous timezone 10036 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10037 #, kde-format 10038 msgid "Eastern Time - Quebec - most locations" 10039 msgstr "" 10040 10041 #: kdecore/TIMEZONES:456 10042 #, kde-format 10043 msgid "America/Montserrat" 10044 msgstr "آمریکا/مانتسرت" 10045 10046 #: kdecore/TIMEZONES:457 10047 #, kde-format 10048 msgid "America/Nassau" 10049 msgstr "آمریکا/ناسائو" 10050 10051 #: kdecore/TIMEZONES:458 10052 #, kde-format 10053 msgid "America/New_York" 10054 msgstr "آمریکا/نیویورک" 10055 10056 #. i18n: comment to the previous timezone 10057 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10058 #, kde-format 10059 msgid "Eastern Time" 10060 msgstr "" 10061 10062 #. i18n: comment to the previous timezone 10063 #: kdecore/TIMEZONES:462 10064 #, kde-format 10065 msgid "Eastern (most areas)" 10066 msgstr "" 10067 10068 #: kdecore/TIMEZONES:463 10069 #, kde-format 10070 msgid "America/Nipigon" 10071 msgstr "آمریکا/نیپیگان" 10072 10073 #. i18n: comment to the previous timezone 10074 #: kdecore/TIMEZONES:465 10075 #, kde-format 10076 msgid "" 10077 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10078 msgstr "" 10079 10080 #. i18n: comment to the previous timezone 10081 #: kdecore/TIMEZONES:467 10082 #, kde-format 10083 msgid "Eastern - ON, QC (no DST 1967-73)" 10084 msgstr "" 10085 10086 #: kdecore/TIMEZONES:468 10087 #, kde-format 10088 msgid "America/Nome" 10089 msgstr "آمریکا/نوم" 10090 10091 #. i18n: comment to the previous timezone 10092 #: kdecore/TIMEZONES:470 10093 #, kde-format 10094 msgid "Alaska Time - west Alaska" 10095 msgstr "" 10096 10097 #. i18n: comment to the previous timezone 10098 #: kdecore/TIMEZONES:472 10099 #, kde-format 10100 msgid "Alaska (west)" 10101 msgstr "" 10102 10103 #: kdecore/TIMEZONES:473 10104 #, kde-format 10105 msgid "America/Noronha" 10106 msgstr "آمریکا/نورونیا" 10107 10108 #. i18n: comment to the previous timezone 10109 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10110 #, fuzzy, kde-format 10111 #| msgid "Atlantic/Canary" 10112 msgid "Atlantic islands" 10113 msgstr "اقیانوس اطلس/قناری" 10114 10115 #: kdecore/TIMEZONES:476 10116 #, fuzzy, kde-format 10117 #| msgid "America/North_Dakota/Center" 10118 msgid "America/North_Dakota/Beulah" 10119 msgstr "آمریکا/داکوتای شمالی/مرکز" 10120 10121 #. i18n: comment to the previous timezone 10122 #: kdecore/TIMEZONES:478 10123 #, kde-format 10124 msgid "Central Time - North Dakota - Mercer County" 10125 msgstr "" 10126 10127 #. i18n: comment to the previous timezone 10128 #: kdecore/TIMEZONES:480 10129 #, kde-format 10130 msgid "Central - ND (Mercer)" 10131 msgstr "" 10132 10133 #: kdecore/TIMEZONES:481 10134 #, kde-format 10135 msgid "America/North_Dakota/Center" 10136 msgstr "آمریکا/داکوتای شمالی/مرکز" 10137 10138 #. i18n: comment to the previous timezone 10139 #: kdecore/TIMEZONES:483 10140 #, kde-format 10141 msgid "Central Time - North Dakota - Oliver County" 10142 msgstr "" 10143 10144 #. i18n: comment to the previous timezone 10145 #: kdecore/TIMEZONES:485 10146 #, kde-format 10147 msgid "Central - ND (Oliver)" 10148 msgstr "" 10149 10150 #: kdecore/TIMEZONES:486 10151 #, kde-format 10152 msgid "America/North_Dakota/New_Salem" 10153 msgstr "آمریکا/داکوتای شمالی/نیوسالم" 10154 10155 #. i18n: comment to the previous timezone 10156 #: kdecore/TIMEZONES:488 10157 #, kde-format 10158 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10159 msgstr "" 10160 10161 #. i18n: comment to the previous timezone 10162 #: kdecore/TIMEZONES:490 10163 #, kde-format 10164 msgid "Central - ND (Morton rural)" 10165 msgstr "" 10166 10167 #: kdecore/TIMEZONES:491 10168 #, fuzzy, kde-format 10169 #| msgid "America/Jujuy" 10170 msgid "America/Nuuk" 10171 msgstr "آمریکا/خوخوئی" 10172 10173 #. i18n: comment to the previous timezone 10174 #: kdecore/TIMEZONES:493 10175 #, kde-format 10176 msgid "Greenland (most areas)" 10177 msgstr "" 10178 10179 #: kdecore/TIMEZONES:494 10180 #, fuzzy, kde-format 10181 #| msgid "America/Managua" 10182 msgid "America/Ojinaga" 10183 msgstr "آمریکا/ماناگوئا" 10184 10185 #. i18n: comment to the previous timezone 10186 #: kdecore/TIMEZONES:496 10187 #, kde-format 10188 msgid "US Mountain Time - Chihuahua near US border" 10189 msgstr "" 10190 10191 #. i18n: comment to the previous timezone 10192 #: kdecore/TIMEZONES:498 10193 #, kde-format 10194 msgid "Mountain Time US - Chihuahua (US border)" 10195 msgstr "" 10196 10197 #: kdecore/TIMEZONES:499 10198 #, fuzzy, kde-format 10199 #| msgid "America/Maceio" 10200 msgid "America/Ontario" 10201 msgstr "آمریکا/ماسیو" 10202 10203 #: kdecore/TIMEZONES:502 10204 #, kde-format 10205 msgid "America/Panama" 10206 msgstr "آمریکا/پاناما" 10207 10208 #: kdecore/TIMEZONES:503 10209 #, kde-format 10210 msgid "America/Pangnirtung" 10211 msgstr "آمریکا/پانگنیرتونگ" 10212 10213 #. i18n: comment to the previous timezone 10214 #: kdecore/TIMEZONES:505 10215 #, kde-format 10216 msgid "Eastern Time - Pangnirtung, Nunavut" 10217 msgstr "" 10218 10219 #. i18n: comment to the previous timezone 10220 #: kdecore/TIMEZONES:507 10221 #, kde-format 10222 msgid "Eastern - NU (Pangnirtung)" 10223 msgstr "" 10224 10225 #: kdecore/TIMEZONES:508 10226 #, kde-format 10227 msgid "America/Paramaribo" 10228 msgstr "آمریکا/پاراماریبو" 10229 10230 #: kdecore/TIMEZONES:509 10231 #, kde-format 10232 msgid "America/Phoenix" 10233 msgstr "آمریکا/فینیکس" 10234 10235 #. i18n: comment to the previous timezone 10236 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10237 #, kde-format 10238 msgid "Mountain Standard Time - Arizona" 10239 msgstr "" 10240 10241 #. i18n: comment to the previous timezone 10242 #: kdecore/TIMEZONES:513 10243 #, kde-format 10244 msgid "MST - Arizona (except Navajo)" 10245 msgstr "" 10246 10247 #: kdecore/TIMEZONES:514 10248 #, kde-format 10249 msgid "America/Port-au-Prince" 10250 msgstr "آمریکا/پورتوپرنس" 10251 10252 #: kdecore/TIMEZONES:515 10253 #, kde-format 10254 msgid "America/Port_of_Spain" 10255 msgstr "آمریکا/پورت آو اسپین" 10256 10257 #: kdecore/TIMEZONES:516 10258 #, fuzzy, kde-format 10259 #| msgid "America/Porto_Velho" 10260 msgid "America/Porto_Acre" 10261 msgstr "آمریکا/پورترولیو" 10262 10263 #. i18n: comment to the previous timezone 10264 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10265 #, kde-format 10266 msgid "Acre" 10267 msgstr "" 10268 10269 #: kdecore/TIMEZONES:519 10270 #, kde-format 10271 msgid "America/Porto_Velho" 10272 msgstr "آمریکا/پورترولیو" 10273 10274 #. i18n: comment to the previous timezone 10275 #: kdecore/TIMEZONES:521 10276 #, kde-format 10277 msgid "Rondonia" 10278 msgstr "" 10279 10280 #: kdecore/TIMEZONES:522 10281 #, kde-format 10282 msgid "America/Puerto_Rico" 10283 msgstr "آمریکا/پورتوریکو" 10284 10285 #: kdecore/TIMEZONES:523 10286 #, fuzzy, kde-format 10287 #| msgid "America/Buenos_Aires" 10288 msgid "America/Punta_Arenas" 10289 msgstr "آمریکا/بوینوس آیرس" 10290 10291 #. i18n: comment to the previous timezone 10292 #: kdecore/TIMEZONES:525 10293 #, kde-format 10294 msgid "Region of Magallanes" 10295 msgstr "" 10296 10297 #: kdecore/TIMEZONES:526 10298 #, kde-format 10299 msgid "America/Rainy_River" 10300 msgstr "آمریکا/رینیریور" 10301 10302 #. i18n: comment to the previous timezone 10303 #: kdecore/TIMEZONES:528 10304 #, kde-format 10305 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10306 msgstr "" 10307 10308 #. i18n: comment to the previous timezone 10309 #: kdecore/TIMEZONES:530 10310 #, kde-format 10311 msgid "Central - ON (Rainy R, Ft Frances)" 10312 msgstr "" 10313 10314 #: kdecore/TIMEZONES:531 10315 #, kde-format 10316 msgid "America/Rankin_Inlet" 10317 msgstr "آمریکا/خلیجک رنکین" 10318 10319 #. i18n: comment to the previous timezone 10320 #: kdecore/TIMEZONES:533 10321 #, kde-format 10322 msgid "Central Time - central Nunavut" 10323 msgstr "" 10324 10325 #. i18n: comment to the previous timezone 10326 #: kdecore/TIMEZONES:535 10327 #, kde-format 10328 msgid "Central - NU (central)" 10329 msgstr "" 10330 10331 #: kdecore/TIMEZONES:536 10332 #, kde-format 10333 msgid "America/Recife" 10334 msgstr "آمریکا/رسیفی" 10335 10336 #. i18n: comment to the previous timezone 10337 #: kdecore/TIMEZONES:538 10338 #, kde-format 10339 msgid "Pernambuco" 10340 msgstr "" 10341 10342 #: kdecore/TIMEZONES:539 10343 #, kde-format 10344 msgid "America/Regina" 10345 msgstr "آمریکا/رجاینا" 10346 10347 #. i18n: comment to the previous timezone 10348 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10349 #: kdecore/TIMEZONES:1123 10350 #, kde-format 10351 msgid "Central Standard Time - Saskatchewan - most locations" 10352 msgstr "" 10353 10354 #. i18n: comment to the previous timezone 10355 #: kdecore/TIMEZONES:543 10356 #, kde-format 10357 msgid "CST - SK (most areas)" 10358 msgstr "" 10359 10360 #: kdecore/TIMEZONES:544 10361 #, kde-format 10362 msgid "America/Resolute" 10363 msgstr "آمریکا/رزُلوت" 10364 10365 #. i18n: comment to the previous timezone 10366 #: kdecore/TIMEZONES:546 10367 #, kde-format 10368 msgid "Eastern Time - Resolute, Nunavut" 10369 msgstr "" 10370 10371 #. i18n: comment to the previous timezone 10372 #: kdecore/TIMEZONES:548 10373 #, kde-format 10374 msgid "Central Standard Time - Resolute, Nunavut" 10375 msgstr "" 10376 10377 #. i18n: comment to the previous timezone 10378 #: kdecore/TIMEZONES:550 10379 #, kde-format 10380 msgid "Central - NU (Resolute)" 10381 msgstr "" 10382 10383 #: kdecore/TIMEZONES:551 10384 #, kde-format 10385 msgid "America/Rio_Branco" 10386 msgstr "آمریکا/ریوبرانکو" 10387 10388 #: kdecore/TIMEZONES:554 10389 #, kde-format 10390 msgid "America/Rosario" 10391 msgstr "آمریکا/روساریو" 10392 10393 #: kdecore/TIMEZONES:557 10394 #, fuzzy, kde-format 10395 #| msgid "America/Santiago" 10396 msgid "America/Santa_Isabel" 10397 msgstr "آمریکا/سانتیاگو" 10398 10399 #. i18n: comment to the previous timezone 10400 #: kdecore/TIMEZONES:559 10401 #, kde-format 10402 msgid "Mexican Pacific Time - Baja California away from US border" 10403 msgstr "" 10404 10405 #: kdecore/TIMEZONES:560 10406 #, fuzzy, kde-format 10407 #| msgid "America/Santiago" 10408 msgid "America/Santarem" 10409 msgstr "آمریکا/سانتیاگو" 10410 10411 #. i18n: comment to the previous timezone 10412 #: kdecore/TIMEZONES:562 10413 #, fuzzy, kde-format 10414 msgid "W Para" 10415 msgstr "مارس" 10416 10417 #. i18n: comment to the previous timezone 10418 #: kdecore/TIMEZONES:564 10419 #, kde-format 10420 msgid "Para (west)" 10421 msgstr "" 10422 10423 #: kdecore/TIMEZONES:565 10424 #, kde-format 10425 msgid "America/Santiago" 10426 msgstr "آمریکا/سانتیاگو" 10427 10428 #. i18n: comment to the previous timezone 10429 #: kdecore/TIMEZONES:569 10430 #, kde-format 10431 msgid "Chile (most areas)" 10432 msgstr "" 10433 10434 #: kdecore/TIMEZONES:570 10435 #, kde-format 10436 msgid "America/Santo_Domingo" 10437 msgstr "آمریکا/سانتو دومینگو" 10438 10439 #: kdecore/TIMEZONES:571 10440 #, kde-format 10441 msgid "America/Sao_Paulo" 10442 msgstr "آمریکا/سائوپائولو" 10443 10444 #. i18n: comment to the previous timezone 10445 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10446 #, kde-format 10447 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10448 msgstr "" 10449 10450 #. i18n: comment to the previous timezone 10451 #: kdecore/TIMEZONES:575 10452 #, kde-format 10453 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10454 msgstr "" 10455 10456 #: kdecore/TIMEZONES:576 10457 #, fuzzy, kde-format 10458 #| msgid "America/Dawson" 10459 msgid "America/Saskatoon" 10460 msgstr "آمریکا/داوسن" 10461 10462 #: kdecore/TIMEZONES:579 10463 #, kde-format 10464 msgid "America/Scoresbysund" 10465 msgstr "آمریکا/اسکورسبیسون" 10466 10467 #. i18n: comment to the previous timezone 10468 #: kdecore/TIMEZONES:581 10469 #, kde-format 10470 msgid "Scoresbysund / Ittoqqortoormiit" 10471 msgstr "" 10472 10473 #. i18n: comment to the previous timezone 10474 #: kdecore/TIMEZONES:583 10475 #, kde-format 10476 msgid "Scoresbysund/Ittoqqortoormiit" 10477 msgstr "" 10478 10479 #: kdecore/TIMEZONES:584 10480 #, kde-format 10481 msgid "America/Shiprock" 10482 msgstr "آمریکا/شیپ راک" 10483 10484 #. i18n: comment to the previous timezone 10485 #: kdecore/TIMEZONES:586 10486 #, kde-format 10487 msgid "Mountain Time - Navajo" 10488 msgstr "" 10489 10490 #: kdecore/TIMEZONES:587 10491 #, fuzzy, kde-format 10492 #| msgid "America/Atikokan" 10493 msgid "America/Sitka" 10494 msgstr "آمریکا/آتیکُکان" 10495 10496 #. i18n: comment to the previous timezone 10497 #: kdecore/TIMEZONES:589 10498 #, kde-format 10499 msgid "Alaska Time - southeast Alaska panhandle" 10500 msgstr "" 10501 10502 #. i18n: comment to the previous timezone 10503 #: kdecore/TIMEZONES:591 10504 #, kde-format 10505 msgid "Alaska - Sitka area" 10506 msgstr "" 10507 10508 #: kdecore/TIMEZONES:592 10509 #, fuzzy, kde-format 10510 #| msgid "America/Belem" 10511 msgid "America/St_Barthelemy" 10512 msgstr "آمریکا/بلئین" 10513 10514 #: kdecore/TIMEZONES:593 10515 #, kde-format 10516 msgid "America/St_Johns" 10517 msgstr "آمریکا/سنتجانز" 10518 10519 #. i18n: comment to the previous timezone 10520 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10521 #, kde-format 10522 msgid "Newfoundland Time, including SE Labrador" 10523 msgstr "" 10524 10525 #. i18n: comment to the previous timezone 10526 #: kdecore/TIMEZONES:597 10527 #, kde-format 10528 msgid "Newfoundland; Labrador (southeast)" 10529 msgstr "" 10530 10531 #: kdecore/TIMEZONES:598 10532 #, kde-format 10533 msgid "America/St_Kitts" 10534 msgstr "آمریکا/سنتکیتس" 10535 10536 #: kdecore/TIMEZONES:599 10537 #, kde-format 10538 msgid "America/St_Lucia" 10539 msgstr "آمریکا/سنت لوشا" 10540 10541 #: kdecore/TIMEZONES:600 10542 #, kde-format 10543 msgid "America/St_Thomas" 10544 msgstr "آمریکا/سنت توماس" 10545 10546 #: kdecore/TIMEZONES:601 10547 #, kde-format 10548 msgid "America/St_Vincent" 10549 msgstr "آمریکا/سنت وینسنت" 10550 10551 #: kdecore/TIMEZONES:602 10552 #, kde-format 10553 msgid "America/Swift_Current" 10554 msgstr "آمریکا/سویفت کارنت" 10555 10556 #. i18n: comment to the previous timezone 10557 #: kdecore/TIMEZONES:604 10558 #, kde-format 10559 msgid "Central Standard Time - Saskatchewan - midwest" 10560 msgstr "" 10561 10562 #. i18n: comment to the previous timezone 10563 #: kdecore/TIMEZONES:606 10564 #, kde-format 10565 msgid "CST - SK (midwest)" 10566 msgstr "" 10567 10568 #: kdecore/TIMEZONES:607 10569 #, kde-format 10570 msgid "America/Tegucigalpa" 10571 msgstr "آمریکا/تگوسیگالپا" 10572 10573 #: kdecore/TIMEZONES:608 10574 #, kde-format 10575 msgid "America/Thule" 10576 msgstr "آمریکا/توله" 10577 10578 #. i18n: comment to the previous timezone 10579 #: kdecore/TIMEZONES:610 10580 #, kde-format 10581 msgid "Thule / Pituffik" 10582 msgstr "" 10583 10584 #. i18n: comment to the previous timezone 10585 #: kdecore/TIMEZONES:612 10586 #, kde-format 10587 msgid "Thule/Pituffik" 10588 msgstr "" 10589 10590 #: kdecore/TIMEZONES:613 10591 #, kde-format 10592 msgid "America/Thunder_Bay" 10593 msgstr "آمریکا/تاندر بی" 10594 10595 #. i18n: comment to the previous timezone 10596 #: kdecore/TIMEZONES:615 10597 #, kde-format 10598 msgid "Eastern Time - Thunder Bay, Ontario" 10599 msgstr "" 10600 10601 #. i18n: comment to the previous timezone 10602 #: kdecore/TIMEZONES:617 10603 #, kde-format 10604 msgid "Eastern - ON (Thunder Bay)" 10605 msgstr "" 10606 10607 #: kdecore/TIMEZONES:618 10608 #, kde-format 10609 msgid "America/Tijuana" 10610 msgstr "آمریکا/تیخوانا" 10611 10612 #. i18n: comment to the previous timezone 10613 #: kdecore/TIMEZONES:622 10614 #, kde-format 10615 msgid "US Pacific Time - Baja California near US border" 10616 msgstr "" 10617 10618 #. i18n: comment to the previous timezone 10619 #: kdecore/TIMEZONES:624 10620 #, kde-format 10621 msgid "Pacific Time US - Baja California" 10622 msgstr "" 10623 10624 #: kdecore/TIMEZONES:625 10625 #, kde-format 10626 msgid "America/Toronto" 10627 msgstr "آمریکا/تورنتو" 10628 10629 #. i18n: comment to the previous timezone 10630 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10631 #, kde-format 10632 msgid "Eastern Time - Ontario - most locations" 10633 msgstr "" 10634 10635 #. i18n: comment to the previous timezone 10636 #: kdecore/TIMEZONES:629 10637 #, kde-format 10638 msgid "Eastern - ON, QC (most areas)" 10639 msgstr "" 10640 10641 #: kdecore/TIMEZONES:630 10642 #, kde-format 10643 msgid "America/Tortola" 10644 msgstr "آمریکا/تورتولا" 10645 10646 #: kdecore/TIMEZONES:631 10647 #, kde-format 10648 msgid "America/Vancouver" 10649 msgstr "آمریکا/ونکوور" 10650 10651 #. i18n: comment to the previous timezone 10652 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10653 #, kde-format 10654 msgid "Pacific Time - west British Columbia" 10655 msgstr "" 10656 10657 #. i18n: comment to the previous timezone 10658 #: kdecore/TIMEZONES:635 10659 #, kde-format 10660 msgid "Pacific - BC (most areas)" 10661 msgstr "" 10662 10663 #: kdecore/TIMEZONES:636 10664 #, fuzzy, kde-format 10665 #| msgid "America/Regina" 10666 msgid "America/Virgin" 10667 msgstr "آمریکا/رجاینا" 10668 10669 #: kdecore/TIMEZONES:637 10670 #, kde-format 10671 msgid "America/Whitehorse" 10672 msgstr "آمریکا/وایتهورس" 10673 10674 #. i18n: comment to the previous timezone 10675 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10676 #, kde-format 10677 msgid "Pacific Time - south Yukon" 10678 msgstr "" 10679 10680 #. i18n: comment to the previous timezone 10681 #: kdecore/TIMEZONES:641 10682 #, kde-format 10683 msgid "MST - Yukon (east)" 10684 msgstr "" 10685 10686 #: kdecore/TIMEZONES:642 10687 #, kde-format 10688 msgid "America/Winnipeg" 10689 msgstr "آمریکا/وینیپگ" 10690 10691 #. i18n: comment to the previous timezone 10692 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10693 #, kde-format 10694 msgid "Central Time - Manitoba & west Ontario" 10695 msgstr "" 10696 10697 #. i18n: comment to the previous timezone 10698 #: kdecore/TIMEZONES:646 10699 #, kde-format 10700 msgid "Central - ON (west); Manitoba" 10701 msgstr "" 10702 10703 #: kdecore/TIMEZONES:647 10704 #, kde-format 10705 msgid "America/Yakutat" 10706 msgstr "آمریکا/یاکوتات" 10707 10708 #. i18n: comment to the previous timezone 10709 #: kdecore/TIMEZONES:649 10710 #, kde-format 10711 msgid "Alaska Time - Alaska panhandle neck" 10712 msgstr "" 10713 10714 #. i18n: comment to the previous timezone 10715 #: kdecore/TIMEZONES:651 10716 #, kde-format 10717 msgid "Alaska - Yakutat" 10718 msgstr "" 10719 10720 #: kdecore/TIMEZONES:652 10721 #, kde-format 10722 msgid "America/Yellowknife" 10723 msgstr "آمریکا/یلونایف" 10724 10725 #. i18n: comment to the previous timezone 10726 #: kdecore/TIMEZONES:654 10727 #, kde-format 10728 msgid "Mountain Time - central Northwest Territories" 10729 msgstr "" 10730 10731 #. i18n: comment to the previous timezone 10732 #: kdecore/TIMEZONES:656 10733 #, kde-format 10734 msgid "Mountain - NT (central)" 10735 msgstr "" 10736 10737 #: kdecore/TIMEZONES:657 10738 #, kde-format 10739 msgid "Antarctica/Casey" 10740 msgstr "جنوبگان/کیسی" 10741 10742 #. i18n: comment to the previous timezone 10743 #: kdecore/TIMEZONES:659 10744 #, kde-format 10745 msgid "Casey Station, Bailey Peninsula" 10746 msgstr "" 10747 10748 #. i18n: comment to the previous timezone 10749 #: kdecore/TIMEZONES:661 10750 #, kde-format 10751 msgid "Casey" 10752 msgstr "" 10753 10754 #: kdecore/TIMEZONES:662 10755 #, kde-format 10756 msgid "Antarctica/Davis" 10757 msgstr "جنوبگان/دیویس" 10758 10759 #. i18n: comment to the previous timezone 10760 #: kdecore/TIMEZONES:664 10761 #, kde-format 10762 msgid "Davis Station, Vestfold Hills" 10763 msgstr "" 10764 10765 #. i18n: comment to the previous timezone 10766 #: kdecore/TIMEZONES:666 10767 #, kde-format 10768 msgid "Davis" 10769 msgstr "" 10770 10771 #: kdecore/TIMEZONES:667 10772 #, kde-format 10773 msgid "Antarctica/DumontDUrville" 10774 msgstr "جنوبگان/دومون دورویل" 10775 10776 #. i18n: comment to the previous timezone 10777 #: kdecore/TIMEZONES:669 10778 #, kde-format 10779 msgid "Dumont-d'Urville Station, Terre Adelie" 10780 msgstr "" 10781 10782 #. i18n: comment to the previous timezone 10783 #: kdecore/TIMEZONES:671 10784 #, fuzzy, kde-format 10785 #| msgid "Antarctica/DumontDUrville" 10786 msgid "Dumont-d'Urville" 10787 msgstr "جنوبگان/دومون دورویل" 10788 10789 #: kdecore/TIMEZONES:672 10790 #, fuzzy, kde-format 10791 #| msgid "Antarctica/McMurdo" 10792 msgid "Antarctica/Macquarie" 10793 msgstr "جنوبگان/مکمردو" 10794 10795 #. i18n: comment to the previous timezone 10796 #: kdecore/TIMEZONES:674 10797 #, kde-format 10798 msgid "Macquarie Island Station, Macquarie Island" 10799 msgstr "" 10800 10801 #. i18n: comment to the previous timezone 10802 #: kdecore/TIMEZONES:676 10803 #, kde-format 10804 msgid "Macquarie Island" 10805 msgstr "" 10806 10807 #: kdecore/TIMEZONES:677 10808 #, kde-format 10809 msgid "Antarctica/Mawson" 10810 msgstr "جنوبگان/موسن" 10811 10812 #. i18n: comment to the previous timezone 10813 #: kdecore/TIMEZONES:679 10814 #, kde-format 10815 msgid "Mawson Station, Holme Bay" 10816 msgstr "" 10817 10818 #. i18n: comment to the previous timezone 10819 #: kdecore/TIMEZONES:681 10820 #, kde-format 10821 msgid "Mawson" 10822 msgstr "" 10823 10824 #: kdecore/TIMEZONES:682 10825 #, kde-format 10826 msgid "Antarctica/McMurdo" 10827 msgstr "جنوبگان/مکمردو" 10828 10829 #. i18n: comment to the previous timezone 10830 #: kdecore/TIMEZONES:684 10831 #, kde-format 10832 msgid "McMurdo Station, Ross Island" 10833 msgstr "" 10834 10835 #. i18n: comment to the previous timezone 10836 #: kdecore/TIMEZONES:686 10837 #, kde-format 10838 msgid "New Zealand time - McMurdo, South Pole" 10839 msgstr "" 10840 10841 #: kdecore/TIMEZONES:687 10842 #, kde-format 10843 msgid "Antarctica/Palmer" 10844 msgstr "جنوبگان/پالمر" 10845 10846 #. i18n: comment to the previous timezone 10847 #: kdecore/TIMEZONES:689 10848 #, kde-format 10849 msgid "Palmer Station, Anvers Island" 10850 msgstr "" 10851 10852 #. i18n: comment to the previous timezone 10853 #: kdecore/TIMEZONES:691 10854 #, kde-format 10855 msgid "Palmer" 10856 msgstr "" 10857 10858 #: kdecore/TIMEZONES:692 10859 #, kde-format 10860 msgid "Antarctica/Rothera" 10861 msgstr "جنوبگان/روترا" 10862 10863 #. i18n: comment to the previous timezone 10864 #: kdecore/TIMEZONES:694 10865 #, kde-format 10866 msgid "Rothera Station, Adelaide Island" 10867 msgstr "" 10868 10869 #. i18n: comment to the previous timezone 10870 #: kdecore/TIMEZONES:696 10871 #, kde-format 10872 msgid "Rothera" 10873 msgstr "" 10874 10875 #: kdecore/TIMEZONES:697 10876 #, kde-format 10877 msgid "Antarctica/South_Pole" 10878 msgstr "جنوبگان/قطب جنوب" 10879 10880 #. i18n: comment to the previous timezone 10881 #: kdecore/TIMEZONES:699 10882 #, kde-format 10883 msgid "Amundsen-Scott Station, South Pole" 10884 msgstr "" 10885 10886 #: kdecore/TIMEZONES:700 10887 #, kde-format 10888 msgid "Antarctica/Syowa" 10889 msgstr "جنوبگان/سیووا" 10890 10891 #. i18n: comment to the previous timezone 10892 #: kdecore/TIMEZONES:702 10893 #, kde-format 10894 msgid "Syowa Station, E Ongul I" 10895 msgstr "" 10896 10897 #. i18n: comment to the previous timezone 10898 #: kdecore/TIMEZONES:704 10899 #, kde-format 10900 msgid "Syowa" 10901 msgstr "" 10902 10903 #: kdecore/TIMEZONES:705 10904 #, fuzzy, kde-format 10905 #| msgid "Antarctica/McMurdo" 10906 msgid "Antarctica/Troll" 10907 msgstr "جنوبگان/مکمردو" 10908 10909 #. i18n: comment to the previous timezone 10910 #: kdecore/TIMEZONES:707 10911 #, kde-format 10912 msgid "Troll" 10913 msgstr "" 10914 10915 #: kdecore/TIMEZONES:708 10916 #, kde-format 10917 msgid "Antarctica/Vostok" 10918 msgstr "جنوبگان/واستوک" 10919 10920 #. i18n: comment to the previous timezone 10921 #: kdecore/TIMEZONES:710 10922 #, kde-format 10923 msgid "Vostok Station, S Magnetic Pole" 10924 msgstr "" 10925 10926 #. i18n: comment to the previous timezone 10927 #: kdecore/TIMEZONES:712 10928 #, kde-format 10929 msgid "Vostok Station, Lake Vostok" 10930 msgstr "" 10931 10932 #. i18n: comment to the previous timezone 10933 #: kdecore/TIMEZONES:714 10934 #, kde-format 10935 msgid "Vostok" 10936 msgstr "" 10937 10938 #: kdecore/TIMEZONES:715 10939 #, kde-format 10940 msgid "Arctic/Longyearbyen" 10941 msgstr "شمالگان/لانگییرباین" 10942 10943 #: kdecore/TIMEZONES:716 10944 #, kde-format 10945 msgid "Asia/Aden" 10946 msgstr "آسیا/عدن" 10947 10948 #: kdecore/TIMEZONES:717 10949 #, kde-format 10950 msgid "Asia/Almaty" 10951 msgstr "آسیا/آلماتی" 10952 10953 #. i18n: comment to the previous timezone 10954 #: kdecore/TIMEZONES:721 10955 #, kde-format 10956 msgid "Kazakhstan (most areas)" 10957 msgstr "" 10958 10959 #: kdecore/TIMEZONES:722 10960 #, kde-format 10961 msgid "Asia/Amman" 10962 msgstr "آسیا/امان" 10963 10964 #: kdecore/TIMEZONES:723 10965 #, kde-format 10966 msgid "Asia/Anadyr" 10967 msgstr "آسیا/آنادیر" 10968 10969 #. i18n: comment to the previous timezone 10970 #: kdecore/TIMEZONES:725 10971 #, kde-format 10972 msgid "Moscow+10 - Bering Sea" 10973 msgstr "" 10974 10975 #. i18n: comment to the previous timezone 10976 #: kdecore/TIMEZONES:727 10977 #, kde-format 10978 msgid "Moscow+08 - Bering Sea" 10979 msgstr "" 10980 10981 #. i18n: comment to the previous timezone 10982 #: kdecore/TIMEZONES:729 10983 #, kde-format 10984 msgid "MSK+09 - Bering Sea" 10985 msgstr "" 10986 10987 #: kdecore/TIMEZONES:730 10988 #, kde-format 10989 msgid "Asia/Aqtau" 10990 msgstr "آسیا/آقتاو" 10991 10992 #. i18n: comment to the previous timezone 10993 #: kdecore/TIMEZONES:732 10994 #, kde-format 10995 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 10996 msgstr "" 10997 10998 #. i18n: comment to the previous timezone 10999 #: kdecore/TIMEZONES:734 11000 #, kde-format 11001 msgid "Mangghystau/Mankistau" 11002 msgstr "" 11003 11004 #: kdecore/TIMEZONES:735 11005 #, kde-format 11006 msgid "Asia/Aqtobe" 11007 msgstr "آسیا/آقتوبه" 11008 11009 #. i18n: comment to the previous timezone 11010 #: kdecore/TIMEZONES:737 11011 #, kde-format 11012 msgid "Aqtobe (Aktobe)" 11013 msgstr "" 11014 11015 #. i18n: comment to the previous timezone 11016 #: kdecore/TIMEZONES:739 11017 #, kde-format 11018 msgid "Aqtobe/Aktobe" 11019 msgstr "" 11020 11021 #: kdecore/TIMEZONES:740 11022 #, kde-format 11023 msgid "Asia/Ashgabat" 11024 msgstr "آسیا/عشقآباد" 11025 11026 #: kdecore/TIMEZONES:741 11027 #, fuzzy, kde-format 11028 #| msgid "Asia/Ashgabat" 11029 msgid "Asia/Ashkhabad" 11030 msgstr "آسیا/عشقآباد" 11031 11032 #: kdecore/TIMEZONES:742 11033 #, fuzzy, kde-format 11034 #| msgid "Asia/Aqtau" 11035 msgid "Asia/Atyrau" 11036 msgstr "آسیا/آقتاو" 11037 11038 #. i18n: comment to the previous timezone 11039 #: kdecore/TIMEZONES:744 11040 #, kde-format 11041 msgid "Atyrau/Atirau/Gur'yev" 11042 msgstr "" 11043 11044 #: kdecore/TIMEZONES:745 11045 #, kde-format 11046 msgid "Asia/Baghdad" 11047 msgstr "آسیا/بغداد" 11048 11049 #: kdecore/TIMEZONES:746 11050 #, kde-format 11051 msgid "Asia/Bahrain" 11052 msgstr "آسیا/بحرین" 11053 11054 #: kdecore/TIMEZONES:747 11055 #, kde-format 11056 msgid "Asia/Baku" 11057 msgstr "آسیا/باکو" 11058 11059 #: kdecore/TIMEZONES:748 11060 #, kde-format 11061 msgid "Asia/Bangkok" 11062 msgstr "آسیا/بانکوک" 11063 11064 #: kdecore/TIMEZONES:749 11065 #, fuzzy, kde-format 11066 #| msgid "Asia/Baku" 11067 msgid "Asia/Barnaul" 11068 msgstr "آسیا/باکو" 11069 11070 #. i18n: comment to the previous timezone 11071 #: kdecore/TIMEZONES:751 11072 #, kde-format 11073 msgid "MSK+04 - Altai" 11074 msgstr "" 11075 11076 #: kdecore/TIMEZONES:752 11077 #, fuzzy, kde-format 11078 #| msgid "Asia/Beirut" 11079 msgid "Asia/Beijing" 11080 msgstr "آسیا/بیروت" 11081 11082 #. i18n: comment to the previous timezone 11083 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11084 #, kde-format 11085 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11086 msgstr "" 11087 11088 #. i18n: comment to the previous timezone 11089 #: kdecore/TIMEZONES:756 11090 #, kde-format 11091 msgid "China Standard Time" 11092 msgstr "" 11093 11094 #: kdecore/TIMEZONES:757 11095 #, kde-format 11096 msgid "Asia/Beirut" 11097 msgstr "آسیا/بیروت" 11098 11099 #: kdecore/TIMEZONES:758 11100 #, kde-format 11101 msgid "Asia/Bishkek" 11102 msgstr "آسیا/بیشکک" 11103 11104 #: kdecore/TIMEZONES:759 11105 #, kde-format 11106 msgid "Asia/Brunei" 11107 msgstr "آسیا/برونئی" 11108 11109 #: kdecore/TIMEZONES:760 11110 #, kde-format 11111 msgid "Asia/Calcutta" 11112 msgstr "آسیا/کلکته" 11113 11114 #: kdecore/TIMEZONES:761 11115 #, fuzzy, kde-format 11116 #| msgid "Asia/Choibalsan" 11117 msgid "Asia/Chita" 11118 msgstr "آسیا/چویبالسان" 11119 11120 #. i18n: comment to the previous timezone 11121 #: kdecore/TIMEZONES:763 11122 #, kde-format 11123 msgid "MSK+06 - Zabaykalsky" 11124 msgstr "" 11125 11126 #: kdecore/TIMEZONES:764 11127 #, kde-format 11128 msgid "Asia/Choibalsan" 11129 msgstr "آسیا/چویبالسان" 11130 11131 #. i18n: comment to the previous timezone 11132 #: kdecore/TIMEZONES:766 11133 #, kde-format 11134 msgid "Dornod, Sukhbaatar" 11135 msgstr "" 11136 11137 #: kdecore/TIMEZONES:767 11138 #, kde-format 11139 msgid "Asia/Chongqing" 11140 msgstr "آسیا/چونگکینگ" 11141 11142 #. i18n: comment to the previous timezone 11143 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11144 #, kde-format 11145 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11146 msgstr "" 11147 11148 #. i18n: comment to the previous timezone 11149 #: kdecore/TIMEZONES:771 11150 #, kde-format 11151 msgid "China mountains" 11152 msgstr "" 11153 11154 #: kdecore/TIMEZONES:772 11155 #, fuzzy, kde-format 11156 #| msgid "Asia/Chongqing" 11157 msgid "Asia/Chungking" 11158 msgstr "آسیا/چونگکینگ" 11159 11160 #: kdecore/TIMEZONES:775 11161 #, kde-format 11162 msgid "Asia/Colombo" 11163 msgstr "آسیا/کلمبو" 11164 11165 #: kdecore/TIMEZONES:776 11166 #, fuzzy, kde-format 11167 #| msgid "Asia/Dhaka" 11168 msgid "Asia/Dacca" 11169 msgstr "آسیا/داکا" 11170 11171 #: kdecore/TIMEZONES:777 11172 #, kde-format 11173 msgid "Asia/Damascus" 11174 msgstr "آسیا/دمشق" 11175 11176 #: kdecore/TIMEZONES:778 11177 #, kde-format 11178 msgid "Asia/Dhaka" 11179 msgstr "آسیا/داکا" 11180 11181 #: kdecore/TIMEZONES:779 11182 #, kde-format 11183 msgid "Asia/Dili" 11184 msgstr "آسیا/دیلی" 11185 11186 #: kdecore/TIMEZONES:780 11187 #, kde-format 11188 msgid "Asia/Dubai" 11189 msgstr "آسیا/دوبی" 11190 11191 #: kdecore/TIMEZONES:781 11192 #, fuzzy, kde-format 11193 #| msgid "Do shanbe" 11194 msgid "Asia/Dushanbe" 11195 msgstr "دوشنبه" 11196 11197 #: kdecore/TIMEZONES:782 11198 #, fuzzy, kde-format 11199 #| msgid "Asia/Damascus" 11200 msgid "Asia/Famagusta" 11201 msgstr "آسیا/دمشق" 11202 11203 #. i18n: comment to the previous timezone 11204 #: kdecore/TIMEZONES:784 11205 #, kde-format 11206 msgid "Northern Cyprus" 11207 msgstr "" 11208 11209 #: kdecore/TIMEZONES:785 11210 #, kde-format 11211 msgid "Asia/Gaza" 11212 msgstr "آسیا/غزه" 11213 11214 #. i18n: comment to the previous timezone 11215 #: kdecore/TIMEZONES:787 11216 #, kde-format 11217 msgid "Gaza Strip" 11218 msgstr "" 11219 11220 #: kdecore/TIMEZONES:788 11221 #, kde-format 11222 msgid "Asia/Harbin" 11223 msgstr "آسیا/هاربن" 11224 11225 #. i18n: comment to the previous timezone 11226 #: kdecore/TIMEZONES:790 11227 #, kde-format 11228 msgid "Heilongjiang (except Mohe), Jilin" 11229 msgstr "" 11230 11231 #. i18n: comment to the previous timezone 11232 #: kdecore/TIMEZONES:792 11233 #, kde-format 11234 msgid "China north" 11235 msgstr "" 11236 11237 #: kdecore/TIMEZONES:793 11238 #, fuzzy, kde-format 11239 #| msgid "Asia/Harbin" 11240 msgid "Asia/Hebron" 11241 msgstr "آسیا/هاربن" 11242 11243 #. i18n: comment to the previous timezone 11244 #: kdecore/TIMEZONES:795 11245 #, kde-format 11246 msgid "West Bank" 11247 msgstr "" 11248 11249 #: kdecore/TIMEZONES:796 11250 #, fuzzy, kde-format 11251 #| msgid "Asia/Chongqing" 11252 msgid "Asia/Ho_Chi_Minh" 11253 msgstr "آسیا/چونگکینگ" 11254 11255 #: kdecore/TIMEZONES:797 11256 #, kde-format 11257 msgid "Asia/Hong_Kong" 11258 msgstr "آسیا/هنگکنگ" 11259 11260 #: kdecore/TIMEZONES:798 11261 #, kde-format 11262 msgid "Asia/Hovd" 11263 msgstr "آسیا/هوود" 11264 11265 #. i18n: comment to the previous timezone 11266 #: kdecore/TIMEZONES:800 11267 #, kde-format 11268 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11269 msgstr "" 11270 11271 #: kdecore/TIMEZONES:801 11272 #, kde-format 11273 msgid "Asia/Irkutsk" 11274 msgstr "آسیا/ایرکوتسک" 11275 11276 #. i18n: comment to the previous timezone 11277 #: kdecore/TIMEZONES:803 11278 #, kde-format 11279 msgid "Moscow+05 - Lake Baikal" 11280 msgstr "" 11281 11282 #. i18n: comment to the previous timezone 11283 #: kdecore/TIMEZONES:805 11284 #, kde-format 11285 msgid "MSK+05 - Irkutsk, Buryatia" 11286 msgstr "" 11287 11288 #: kdecore/TIMEZONES:806 11289 #, kde-format 11290 msgid "Asia/Jakarta" 11291 msgstr "آسیا/جاکارتا" 11292 11293 #. i18n: comment to the previous timezone 11294 #: kdecore/TIMEZONES:808 11295 #, kde-format 11296 msgid "Java & Sumatra" 11297 msgstr "" 11298 11299 #. i18n: comment to the previous timezone 11300 #: kdecore/TIMEZONES:810 11301 #, kde-format 11302 msgid "Java, Sumatra" 11303 msgstr "" 11304 11305 #: kdecore/TIMEZONES:811 11306 #, kde-format 11307 msgid "Asia/Jayapura" 11308 msgstr "آسیا/جایاپورا" 11309 11310 #. i18n: comment to the previous timezone 11311 #: kdecore/TIMEZONES:813 11312 #, kde-format 11313 msgid "Irian Jaya & the Moluccas" 11314 msgstr "" 11315 11316 #. i18n: comment to the previous timezone 11317 #: kdecore/TIMEZONES:815 11318 #, kde-format 11319 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11320 msgstr "" 11321 11322 #. i18n: comment to the previous timezone 11323 #: kdecore/TIMEZONES:817 11324 #, kde-format 11325 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11326 msgstr "" 11327 11328 #: kdecore/TIMEZONES:818 11329 #, kde-format 11330 msgid "Asia/Jerusalem" 11331 msgstr "آسیا/دارالسلام" 11332 11333 #: kdecore/TIMEZONES:819 11334 #, kde-format 11335 msgid "Asia/Kabul" 11336 msgstr "آسیا/کابل" 11337 11338 #: kdecore/TIMEZONES:820 11339 #, kde-format 11340 msgid "Asia/Kamchatka" 11341 msgstr "آسیا/کامچاتکا" 11342 11343 #. i18n: comment to the previous timezone 11344 #: kdecore/TIMEZONES:822 11345 #, kde-format 11346 msgid "Moscow+09 - Kamchatka" 11347 msgstr "" 11348 11349 #. i18n: comment to the previous timezone 11350 #: kdecore/TIMEZONES:824 11351 #, kde-format 11352 msgid "Moscow+08 - Kamchatka" 11353 msgstr "" 11354 11355 #. i18n: comment to the previous timezone 11356 #: kdecore/TIMEZONES:826 11357 #, kde-format 11358 msgid "MSK+09 - Kamchatka" 11359 msgstr "" 11360 11361 #: kdecore/TIMEZONES:827 11362 #, kde-format 11363 msgid "Asia/Karachi" 11364 msgstr "آسیا/کراچی" 11365 11366 #: kdecore/TIMEZONES:828 11367 #, kde-format 11368 msgid "Asia/Kashgar" 11369 msgstr "آسیا/کاشغر" 11370 11371 #. i18n: comment to the previous timezone 11372 #: kdecore/TIMEZONES:830 11373 #, kde-format 11374 msgid "west Tibet & Xinjiang" 11375 msgstr "" 11376 11377 #. i18n: comment to the previous timezone 11378 #: kdecore/TIMEZONES:832 11379 #, kde-format 11380 msgid "China west Xinjiang" 11381 msgstr "" 11382 11383 #: kdecore/TIMEZONES:833 11384 #, fuzzy, kde-format 11385 #| msgid "Asia/Katmandu" 11386 msgid "Asia/Kathmandu" 11387 msgstr "آسیا/کاتماندو" 11388 11389 #: kdecore/TIMEZONES:834 11390 #, kde-format 11391 msgid "Asia/Katmandu" 11392 msgstr "آسیا/کاتماندو" 11393 11394 #: kdecore/TIMEZONES:835 11395 #, fuzzy, kde-format 11396 #| msgid "Asia/Shanghai" 11397 msgid "Asia/Khandyga" 11398 msgstr "آسیا/شانگهای" 11399 11400 #. i18n: comment to the previous timezone 11401 #: kdecore/TIMEZONES:837 11402 #, kde-format 11403 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11404 msgstr "" 11405 11406 #: kdecore/TIMEZONES:838 11407 #, fuzzy, kde-format 11408 #| msgid "Asia/Jakarta" 11409 msgid "Asia/Kolkata" 11410 msgstr "آسیا/جاکارتا" 11411 11412 #: kdecore/TIMEZONES:839 11413 #, kde-format 11414 msgid "Asia/Krasnoyarsk" 11415 msgstr "آسیا/کرسنایارسک" 11416 11417 #. i18n: comment to the previous timezone 11418 #: kdecore/TIMEZONES:841 11419 #, kde-format 11420 msgid "Moscow+04 - Yenisei River" 11421 msgstr "" 11422 11423 #. i18n: comment to the previous timezone 11424 #: kdecore/TIMEZONES:843 11425 #, kde-format 11426 msgid "MSK+04 - Krasnoyarsk area" 11427 msgstr "" 11428 11429 #: kdecore/TIMEZONES:844 11430 #, kde-format 11431 msgid "Asia/Kuala_Lumpur" 11432 msgstr "آسیا/کوآلالامپور" 11433 11434 #. i18n: comment to the previous timezone 11435 #: kdecore/TIMEZONES:846 11436 #, kde-format 11437 msgid "peninsular Malaysia" 11438 msgstr "" 11439 11440 #. i18n: comment to the previous timezone 11441 #: kdecore/TIMEZONES:848 11442 #, kde-format 11443 msgid "Malaysia (peninsula)" 11444 msgstr "" 11445 11446 #: kdecore/TIMEZONES:849 11447 #, kde-format 11448 msgid "Asia/Kuching" 11449 msgstr "آسیا/کوچینگ" 11450 11451 #. i18n: comment to the previous timezone 11452 #: kdecore/TIMEZONES:851 11453 #, kde-format 11454 msgid "Sabah & Sarawak" 11455 msgstr "" 11456 11457 #. i18n: comment to the previous timezone 11458 #: kdecore/TIMEZONES:853 11459 #, kde-format 11460 msgid "Sabah, Sarawak" 11461 msgstr "" 11462 11463 #: kdecore/TIMEZONES:854 11464 #, kde-format 11465 msgid "Asia/Kuwait" 11466 msgstr "آسیا/کویت" 11467 11468 #: kdecore/TIMEZONES:855 11469 #, fuzzy, kde-format 11470 #| msgid "Asia/Macau" 11471 msgid "Asia/Macao" 11472 msgstr "آسیا/ماکائو" 11473 11474 #: kdecore/TIMEZONES:856 11475 #, kde-format 11476 msgid "Asia/Macau" 11477 msgstr "آسیا/ماکائو" 11478 11479 #: kdecore/TIMEZONES:857 11480 #, kde-format 11481 msgid "Asia/Magadan" 11482 msgstr "آسیا/مگادان" 11483 11484 #. i18n: comment to the previous timezone 11485 #: kdecore/TIMEZONES:859 11486 #, kde-format 11487 msgid "Moscow+08 - Magadan" 11488 msgstr "" 11489 11490 #. i18n: comment to the previous timezone 11491 #: kdecore/TIMEZONES:861 11492 #, kde-format 11493 msgid "MSK+08 - Magadan" 11494 msgstr "" 11495 11496 #: kdecore/TIMEZONES:862 11497 #, kde-format 11498 msgid "Asia/Makassar" 11499 msgstr "آسیا/ماکاسار" 11500 11501 #. i18n: comment to the previous timezone 11502 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11503 #, kde-format 11504 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11505 msgstr "" 11506 11507 #. i18n: comment to the previous timezone 11508 #: kdecore/TIMEZONES:866 11509 #, kde-format 11510 msgid "" 11511 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11512 msgstr "" 11513 11514 #. i18n: comment to the previous timezone 11515 #: kdecore/TIMEZONES:868 11516 #, kde-format 11517 msgid "" 11518 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11519 msgstr "" 11520 11521 #: kdecore/TIMEZONES:869 11522 #, kde-format 11523 msgid "Asia/Manila" 11524 msgstr "آسیا/مانیل" 11525 11526 #: kdecore/TIMEZONES:870 11527 #, kde-format 11528 msgid "Asia/Muscat" 11529 msgstr "آسیا/مسقط" 11530 11531 #: kdecore/TIMEZONES:871 11532 #, kde-format 11533 msgid "Asia/Nicosia" 11534 msgstr "آسیا/نیکوزیا" 11535 11536 #. i18n: comment to the previous timezone 11537 #: kdecore/TIMEZONES:873 11538 #, kde-format 11539 msgid "Cyprus (most areas)" 11540 msgstr "" 11541 11542 #: kdecore/TIMEZONES:874 11543 #, fuzzy, kde-format 11544 #| msgid "Asia/Irkutsk" 11545 msgid "Asia/Novokuznetsk" 11546 msgstr "آسیا/ایرکوتسک" 11547 11548 #. i18n: comment to the previous timezone 11549 #: kdecore/TIMEZONES:876 11550 #, fuzzy, kde-format 11551 #| msgid "Asia/Novosibirsk" 11552 msgid "Moscow+03 - Novokuznetsk" 11553 msgstr "آسیا/نووسیبریسک" 11554 11555 #. i18n: comment to the previous timezone 11556 #: kdecore/TIMEZONES:878 11557 #, kde-format 11558 msgid "MSK+04 - Kemerovo" 11559 msgstr "" 11560 11561 #: kdecore/TIMEZONES:879 11562 #, kde-format 11563 msgid "Asia/Novosibirsk" 11564 msgstr "آسیا/نووسیبریسک" 11565 11566 #. i18n: comment to the previous timezone 11567 #: kdecore/TIMEZONES:881 11568 #, fuzzy, kde-format 11569 #| msgid "Asia/Novosibirsk" 11570 msgid "Moscow+03 - Novosibirsk" 11571 msgstr "آسیا/نووسیبریسک" 11572 11573 #. i18n: comment to the previous timezone 11574 #: kdecore/TIMEZONES:883 11575 #, fuzzy, kde-format 11576 #| msgid "Asia/Novosibirsk" 11577 msgid "MSK+04 - Novosibirsk" 11578 msgstr "آسیا/نووسیبریسک" 11579 11580 #: kdecore/TIMEZONES:884 11581 #, kde-format 11582 msgid "Asia/Omsk" 11583 msgstr "آسیا/اومسک" 11584 11585 #. i18n: comment to the previous timezone 11586 #: kdecore/TIMEZONES:886 11587 #, kde-format 11588 msgid "Moscow+03 - west Siberia" 11589 msgstr "" 11590 11591 #. i18n: comment to the previous timezone 11592 #: kdecore/TIMEZONES:888 11593 #, kde-format 11594 msgid "MSK+03 - Omsk" 11595 msgstr "" 11596 11597 #: kdecore/TIMEZONES:889 11598 #, kde-format 11599 msgid "Asia/Oral" 11600 msgstr "آسیا/اورال" 11601 11602 #. i18n: comment to the previous timezone 11603 #: kdecore/TIMEZONES:891 11604 #, kde-format 11605 msgid "West Kazakhstan" 11606 msgstr "" 11607 11608 #: kdecore/TIMEZONES:892 11609 #, kde-format 11610 msgid "Asia/Phnom_Penh" 11611 msgstr "آسیا/پنومپن" 11612 11613 #: kdecore/TIMEZONES:893 11614 #, kde-format 11615 msgid "Asia/Pontianak" 11616 msgstr "آسیا/پونتیاناک" 11617 11618 #. i18n: comment to the previous timezone 11619 #: kdecore/TIMEZONES:895 11620 #, kde-format 11621 msgid "west & central Borneo" 11622 msgstr "" 11623 11624 #. i18n: comment to the previous timezone 11625 #: kdecore/TIMEZONES:897 11626 #, kde-format 11627 msgid "Borneo (west, central)" 11628 msgstr "" 11629 11630 #: kdecore/TIMEZONES:898 11631 #, kde-format 11632 msgid "Asia/Pyongyang" 11633 msgstr "آسیا/پیونگیانگ" 11634 11635 #: kdecore/TIMEZONES:899 11636 #, kde-format 11637 msgid "Asia/Qatar" 11638 msgstr "آسیا/قطر" 11639 11640 #: kdecore/TIMEZONES:900 11641 #, fuzzy, kde-format 11642 #| msgid "Asia/Pontianak" 11643 msgid "Asia/Qostanay" 11644 msgstr "آسیا/پونتیاناک" 11645 11646 #. i18n: comment to the previous timezone 11647 #: kdecore/TIMEZONES:902 11648 #, kde-format 11649 msgid "Qostanay/Kostanay/Kustanay" 11650 msgstr "" 11651 11652 #: kdecore/TIMEZONES:903 11653 #, kde-format 11654 msgid "Asia/Qyzylorda" 11655 msgstr "آسیا/قزلاوردا" 11656 11657 #. i18n: comment to the previous timezone 11658 #: kdecore/TIMEZONES:905 11659 #, kde-format 11660 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11661 msgstr "" 11662 11663 #. i18n: comment to the previous timezone 11664 #: kdecore/TIMEZONES:907 11665 #, kde-format 11666 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11667 msgstr "" 11668 11669 #: kdecore/TIMEZONES:908 11670 #, kde-format 11671 msgid "Asia/Rangoon" 11672 msgstr "آسیا/رانگون" 11673 11674 #: kdecore/TIMEZONES:909 11675 #, kde-format 11676 msgid "Asia/Riyadh" 11677 msgstr "آسیا/ریاض" 11678 11679 #: kdecore/TIMEZONES:910 11680 #, kde-format 11681 msgid "Asia/Saigon" 11682 msgstr "آسیا/سایگون" 11683 11684 #: kdecore/TIMEZONES:911 11685 #, kde-format 11686 msgid "Asia/Sakhalin" 11687 msgstr "آسیا/ساخالین" 11688 11689 #. i18n: comment to the previous timezone 11690 #: kdecore/TIMEZONES:913 11691 #, kde-format 11692 msgid "Moscow+07 - Sakhalin Island" 11693 msgstr "" 11694 11695 #. i18n: comment to the previous timezone 11696 #: kdecore/TIMEZONES:915 11697 #, kde-format 11698 msgid "MSK+08 - Sakhalin Island" 11699 msgstr "" 11700 11701 #: kdecore/TIMEZONES:916 11702 #, kde-format 11703 msgid "Asia/Samarkand" 11704 msgstr "آسیا/سمرقند" 11705 11706 #. i18n: comment to the previous timezone 11707 #: kdecore/TIMEZONES:918 11708 #, kde-format 11709 msgid "west Uzbekistan" 11710 msgstr "" 11711 11712 #. i18n: comment to the previous timezone 11713 #: kdecore/TIMEZONES:920 11714 #, kde-format 11715 msgid "Uzbekistan (west)" 11716 msgstr "" 11717 11718 #: kdecore/TIMEZONES:921 11719 #, kde-format 11720 msgid "Asia/Seoul" 11721 msgstr "آسیا/سئول" 11722 11723 #: kdecore/TIMEZONES:922 11724 #, kde-format 11725 msgid "Asia/Shanghai" 11726 msgstr "آسیا/شانگهای" 11727 11728 #. i18n: comment to the previous timezone 11729 #: kdecore/TIMEZONES:926 11730 #, kde-format 11731 msgid "China east" 11732 msgstr "" 11733 11734 #. i18n: comment to the previous timezone 11735 #: kdecore/TIMEZONES:928 11736 #, kde-format 11737 msgid "Beijing Time" 11738 msgstr "" 11739 11740 #: kdecore/TIMEZONES:929 11741 #, kde-format 11742 msgid "Asia/Singapore" 11743 msgstr "آسیا/سنگاپور" 11744 11745 #: kdecore/TIMEZONES:930 11746 #, fuzzy, kde-format 11747 #| msgid "Asia/Krasnoyarsk" 11748 msgid "Asia/Srednekolymsk" 11749 msgstr "آسیا/کرسنایارسک" 11750 11751 #. i18n: comment to the previous timezone 11752 #: kdecore/TIMEZONES:932 11753 #, kde-format 11754 msgid "MSK+08 - Sakha (E); North Kuril Is" 11755 msgstr "" 11756 11757 #: kdecore/TIMEZONES:933 11758 #, kde-format 11759 msgid "Asia/Taipei" 11760 msgstr "آسیا/تایپه" 11761 11762 #: kdecore/TIMEZONES:934 11763 #, kde-format 11764 msgid "Asia/Tashkent" 11765 msgstr "آسیا/تاشکند" 11766 11767 #. i18n: comment to the previous timezone 11768 #: kdecore/TIMEZONES:936 11769 #, kde-format 11770 msgid "east Uzbekistan" 11771 msgstr "" 11772 11773 #. i18n: comment to the previous timezone 11774 #: kdecore/TIMEZONES:938 11775 #, kde-format 11776 msgid "Uzbekistan (east)" 11777 msgstr "" 11778 11779 #: kdecore/TIMEZONES:939 11780 #, kde-format 11781 msgid "Asia/Tbilisi" 11782 msgstr "آسیا/تفلیس" 11783 11784 #: kdecore/TIMEZONES:940 11785 #, kde-format 11786 msgid "Asia/Tehran" 11787 msgstr "آسیا/تهران" 11788 11789 #: kdecore/TIMEZONES:941 11790 #, fuzzy, kde-format 11791 #| msgid "Asia/Taipei" 11792 msgid "Asia/Tel_Aviv" 11793 msgstr "آسیا/تایپه" 11794 11795 #: kdecore/TIMEZONES:942 11796 #, fuzzy, kde-format 11797 #| msgid "Asia/Thimphu" 11798 msgid "Asia/Thimbu" 11799 msgstr "آسیا/تیمپو" 11800 11801 #: kdecore/TIMEZONES:943 11802 #, kde-format 11803 msgid "Asia/Thimphu" 11804 msgstr "آسیا/تیمپو" 11805 11806 #: kdecore/TIMEZONES:944 11807 #, kde-format 11808 msgid "Asia/Tokyo" 11809 msgstr "آسیا/توکیو" 11810 11811 #: kdecore/TIMEZONES:945 11812 #, fuzzy, kde-format 11813 #| msgid "Asia/Omsk" 11814 msgid "Asia/Tomsk" 11815 msgstr "آسیا/اومسک" 11816 11817 #. i18n: comment to the previous timezone 11818 #: kdecore/TIMEZONES:947 11819 #, kde-format 11820 msgid "MSK+04 - Tomsk" 11821 msgstr "" 11822 11823 #: kdecore/TIMEZONES:948 11824 #, kde-format 11825 msgid "Asia/Ujung_Pandang" 11826 msgstr "آسیا/اوجونگ پاندانگ" 11827 11828 #: kdecore/TIMEZONES:951 11829 #, kde-format 11830 msgid "Asia/Ulaanbaatar" 11831 msgstr "آسیا/اولانباتور" 11832 11833 #. i18n: comment to the previous timezone 11834 #: kdecore/TIMEZONES:955 11835 #, kde-format 11836 msgid "Mongolia (most areas)" 11837 msgstr "" 11838 11839 #: kdecore/TIMEZONES:956 11840 #, fuzzy, kde-format 11841 #| msgid "Asia/Ulaanbaatar" 11842 msgid "Asia/Ulan_Bator" 11843 msgstr "آسیا/اولانباتور" 11844 11845 #: kdecore/TIMEZONES:959 11846 #, kde-format 11847 msgid "Asia/Urumqi" 11848 msgstr "آسیا/اورومچی" 11849 11850 #. i18n: comment to the previous timezone 11851 #: kdecore/TIMEZONES:961 11852 #, kde-format 11853 msgid "most of Tibet & Xinjiang" 11854 msgstr "" 11855 11856 #. i18n: comment to the previous timezone 11857 #: kdecore/TIMEZONES:963 11858 #, kde-format 11859 msgid "China Xinjiang-Tibet" 11860 msgstr "" 11861 11862 #. i18n: comment to the previous timezone 11863 #: kdecore/TIMEZONES:965 11864 #, kde-format 11865 msgid "Xinjiang Time" 11866 msgstr "" 11867 11868 #: kdecore/TIMEZONES:966 11869 #, fuzzy, kde-format 11870 #| msgid "Asia/Tehran" 11871 msgid "Asia/Ust-Nera" 11872 msgstr "آسیا/تهران" 11873 11874 #. i18n: comment to the previous timezone 11875 #: kdecore/TIMEZONES:968 11876 #, kde-format 11877 msgid "MSK+07 - Oymyakonsky" 11878 msgstr "" 11879 11880 #: kdecore/TIMEZONES:969 11881 #, kde-format 11882 msgid "Asia/Vientiane" 11883 msgstr "آسیا/وینتیان" 11884 11885 #: kdecore/TIMEZONES:970 11886 #, kde-format 11887 msgid "Asia/Vladivostok" 11888 msgstr "آسیا/ولادیواستوک" 11889 11890 #. i18n: comment to the previous timezone 11891 #: kdecore/TIMEZONES:972 11892 #, kde-format 11893 msgid "Moscow+07 - Amur River" 11894 msgstr "" 11895 11896 #. i18n: comment to the previous timezone 11897 #: kdecore/TIMEZONES:974 11898 #, kde-format 11899 msgid "MSK+07 - Amur River" 11900 msgstr "" 11901 11902 #: kdecore/TIMEZONES:975 11903 #, kde-format 11904 msgid "Asia/Yakutsk" 11905 msgstr "آسیا/باکوتسک" 11906 11907 #. i18n: comment to the previous timezone 11908 #: kdecore/TIMEZONES:977 11909 #, kde-format 11910 msgid "Moscow+06 - Lena River" 11911 msgstr "" 11912 11913 #. i18n: comment to the previous timezone 11914 #: kdecore/TIMEZONES:979 11915 #, kde-format 11916 msgid "MSK+06 - Lena River" 11917 msgstr "" 11918 11919 #: kdecore/TIMEZONES:980 11920 #, fuzzy, kde-format 11921 #| msgid "Asia/Rangoon" 11922 msgid "Asia/Yangon" 11923 msgstr "آسیا/رانگون" 11924 11925 #: kdecore/TIMEZONES:981 11926 #, kde-format 11927 msgid "Asia/Yekaterinburg" 11928 msgstr "آسیا/یکاترینبورگ" 11929 11930 #. i18n: comment to the previous timezone 11931 #: kdecore/TIMEZONES:983 11932 #, kde-format 11933 msgid "Moscow+02 - Urals" 11934 msgstr "" 11935 11936 #. i18n: comment to the previous timezone 11937 #: kdecore/TIMEZONES:985 11938 #, kde-format 11939 msgid "MSK+02 - Urals" 11940 msgstr "" 11941 11942 #: kdecore/TIMEZONES:986 11943 #, kde-format 11944 msgid "Asia/Yerevan" 11945 msgstr "آسیا/ایروان" 11946 11947 #: kdecore/TIMEZONES:987 11948 #, kde-format 11949 msgid "Atlantic/Azores" 11950 msgstr "اقیانوس اطلس/آسور" 11951 11952 #. i18n: comment to the previous timezone 11953 #: kdecore/TIMEZONES:989 11954 #, kde-format 11955 msgid "Azores" 11956 msgstr "" 11957 11958 #: kdecore/TIMEZONES:990 11959 #, kde-format 11960 msgid "Atlantic/Bermuda" 11961 msgstr "اقیانوس اطلس/برمودا" 11962 11963 #: kdecore/TIMEZONES:991 11964 #, kde-format 11965 msgid "Atlantic/Canary" 11966 msgstr "اقیانوس اطلس/قناری" 11967 11968 #. i18n: comment to the previous timezone 11969 #: kdecore/TIMEZONES:993 11970 #, kde-format 11971 msgid "Canary Islands" 11972 msgstr "" 11973 11974 #: kdecore/TIMEZONES:994 11975 #, kde-format 11976 msgid "Atlantic/Cape_Verde" 11977 msgstr "اقیانوس اطلس/کیپ ورد" 11978 11979 #: kdecore/TIMEZONES:995 11980 #, kde-format 11981 msgid "Atlantic/Faeroe" 11982 msgstr "اقیانوس اطلس/فارو" 11983 11984 #: kdecore/TIMEZONES:996 11985 #, kde-format 11986 msgid "Atlantic/Faroe" 11987 msgstr "اقیانوس اطلس/فارو" 11988 11989 #: kdecore/TIMEZONES:997 11990 #, kde-format 11991 msgid "Atlantic/Jan_Mayen" 11992 msgstr "اقیانوس اطلس/یان ماین" 11993 11994 #: kdecore/TIMEZONES:998 11995 #, kde-format 11996 msgid "Atlantic/Madeira" 11997 msgstr "اقیانوس اطلس/مادئیرا" 11998 11999 #. i18n: comment to the previous timezone 12000 #: kdecore/TIMEZONES:1000 12001 #, kde-format 12002 msgid "Madeira Islands" 12003 msgstr "" 12004 12005 #: kdecore/TIMEZONES:1001 12006 #, kde-format 12007 msgid "Atlantic/Reykjavik" 12008 msgstr "اقیانوس اطلس/ریکیاویک" 12009 12010 #: kdecore/TIMEZONES:1002 12011 #, kde-format 12012 msgid "Atlantic/South_Georgia" 12013 msgstr "اقیانوس اطلس/جورجیای جنوبی" 12014 12015 #: kdecore/TIMEZONES:1003 12016 #, kde-format 12017 msgid "Atlantic/St_Helena" 12018 msgstr "اقیانوس اطلس/سنتهلنا" 12019 12020 #: kdecore/TIMEZONES:1004 12021 #, kde-format 12022 msgid "Atlantic/Stanley" 12023 msgstr "اقیانوس اطلس/استنلی" 12024 12025 #: kdecore/TIMEZONES:1005 12026 #, fuzzy, kde-format 12027 #| msgid "Australia/Currie" 12028 msgid "Australia/ACT" 12029 msgstr "استرالیا/کِری" 12030 12031 #. i18n: comment to the previous timezone 12032 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 12033 #: kdecore/TIMEZONES:1073 12034 #, kde-format 12035 msgid "New South Wales - most locations" 12036 msgstr "" 12037 12038 #: kdecore/TIMEZONES:1008 12039 #, kde-format 12040 msgid "Australia/Adelaide" 12041 msgstr "استرالیا/آدلاید" 12042 12043 #. i18n: comment to the previous timezone 12044 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 12045 #, fuzzy, kde-format 12046 #| msgid "Australia/Eucla" 12047 msgid "South Australia" 12048 msgstr "استرالیا/اوکلا" 12049 12050 #: kdecore/TIMEZONES:1011 12051 #, kde-format 12052 msgid "Australia/Brisbane" 12053 msgstr "استرالیا/بریزین" 12054 12055 #. i18n: comment to the previous timezone 12056 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12057 #, kde-format 12058 msgid "Queensland - most locations" 12059 msgstr "" 12060 12061 #. i18n: comment to the previous timezone 12062 #: kdecore/TIMEZONES:1015 12063 #, kde-format 12064 msgid "Queensland (most areas)" 12065 msgstr "" 12066 12067 #: kdecore/TIMEZONES:1016 12068 #, kde-format 12069 msgid "Australia/Broken_Hill" 12070 msgstr "استرالیا/بروکن هیل" 12071 12072 #. i18n: comment to the previous timezone 12073 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12074 #, kde-format 12075 msgid "New South Wales - Yancowinna" 12076 msgstr "" 12077 12078 #. i18n: comment to the previous timezone 12079 #: kdecore/TIMEZONES:1020 12080 #, kde-format 12081 msgid "New South Wales (Yancowinna)" 12082 msgstr "" 12083 12084 #: kdecore/TIMEZONES:1021 12085 #, fuzzy, kde-format 12086 #| msgid "Australia/Currie" 12087 msgid "Australia/Canberra" 12088 msgstr "استرالیا/کِری" 12089 12090 #: kdecore/TIMEZONES:1024 12091 #, kde-format 12092 msgid "Australia/Currie" 12093 msgstr "استرالیا/کِری" 12094 12095 #. i18n: comment to the previous timezone 12096 #: kdecore/TIMEZONES:1026 12097 #, kde-format 12098 msgid "Tasmania - King Island" 12099 msgstr "" 12100 12101 #: kdecore/TIMEZONES:1027 12102 #, kde-format 12103 msgid "Australia/Darwin" 12104 msgstr "استرالیا/داروین" 12105 12106 #. i18n: comment to the previous timezone 12107 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12108 #, kde-format 12109 msgid "Northern Territory" 12110 msgstr "" 12111 12112 #: kdecore/TIMEZONES:1030 12113 #, kde-format 12114 msgid "Australia/Eucla" 12115 msgstr "استرالیا/اوکلا" 12116 12117 #. i18n: comment to the previous timezone 12118 #: kdecore/TIMEZONES:1032 12119 #, fuzzy, kde-format 12120 #| msgid "Australia/Eucla" 12121 msgid "Western Australia - Eucla area" 12122 msgstr "استرالیا/اوکلا" 12123 12124 #. i18n: comment to the previous timezone 12125 #: kdecore/TIMEZONES:1034 12126 #, fuzzy, kde-format 12127 #| msgid "Australia/Eucla" 12128 msgid "Western Australia (Eucla)" 12129 msgstr "استرالیا/اوکلا" 12130 12131 #: kdecore/TIMEZONES:1035 12132 #, kde-format 12133 msgid "Australia/Hobart" 12134 msgstr "استرالیا/هوبارت" 12135 12136 #. i18n: comment to the previous timezone 12137 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12138 #, kde-format 12139 msgid "Tasmania - most locations" 12140 msgstr "" 12141 12142 #. i18n: comment to the previous timezone 12143 #: kdecore/TIMEZONES:1039 12144 #, fuzzy, kde-format 12145 #| msgid "Australia/Brisbane" 12146 msgid "Tasmania" 12147 msgstr "استرالیا/بریزین" 12148 12149 #: kdecore/TIMEZONES:1040 12150 #, fuzzy, kde-format 12151 #| msgid "Australia/Hobart" 12152 msgid "Australia/LHI" 12153 msgstr "استرالیا/هوبارت" 12154 12155 #. i18n: comment to the previous timezone 12156 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12157 #, kde-format 12158 msgid "Lord Howe Island" 12159 msgstr "" 12160 12161 #: kdecore/TIMEZONES:1043 12162 #, kde-format 12163 msgid "Australia/Lindeman" 12164 msgstr "استرالیا/لیندمن" 12165 12166 #. i18n: comment to the previous timezone 12167 #: kdecore/TIMEZONES:1045 12168 #, kde-format 12169 msgid "Queensland - Holiday Islands" 12170 msgstr "" 12171 12172 #. i18n: comment to the previous timezone 12173 #: kdecore/TIMEZONES:1047 12174 #, kde-format 12175 msgid "Queensland (Whitsunday Islands)" 12176 msgstr "" 12177 12178 #: kdecore/TIMEZONES:1048 12179 #, kde-format 12180 msgid "Australia/Lord_Howe" 12181 msgstr "استرالیا/لرد هاو" 12182 12183 #: kdecore/TIMEZONES:1051 12184 #, kde-format 12185 msgid "Australia/Melbourne" 12186 msgstr "استرالیا/ملبورن" 12187 12188 #. i18n: comment to the previous timezone 12189 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12190 #, kde-format 12191 msgid "Victoria" 12192 msgstr "" 12193 12194 #: kdecore/TIMEZONES:1054 12195 #, fuzzy, kde-format 12196 #| msgid "Australia/Sydney" 12197 msgid "Australia/NSW" 12198 msgstr "استرالیا/سیدنی" 12199 12200 #: kdecore/TIMEZONES:1057 12201 #, fuzzy, kde-format 12202 #| msgid "Australia/Perth" 12203 msgid "Australia/North" 12204 msgstr "استرالیا/پرت" 12205 12206 #: kdecore/TIMEZONES:1060 12207 #, kde-format 12208 msgid "Australia/Perth" 12209 msgstr "استرالیا/پرت" 12210 12211 #. i18n: comment to the previous timezone 12212 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12213 #, kde-format 12214 msgid "Western Australia - most locations" 12215 msgstr "" 12216 12217 #. i18n: comment to the previous timezone 12218 #: kdecore/TIMEZONES:1064 12219 #, fuzzy, kde-format 12220 #| msgid "Australia/Eucla" 12221 msgid "Western Australia (most areas)" 12222 msgstr "استرالیا/اوکلا" 12223 12224 #: kdecore/TIMEZONES:1065 12225 #, fuzzy, kde-format 12226 #| msgid "Australia/Eucla" 12227 msgid "Australia/Queensland" 12228 msgstr "استرالیا/اوکلا" 12229 12230 #: kdecore/TIMEZONES:1068 12231 #, fuzzy, kde-format 12232 #| msgid "Australia/Perth" 12233 msgid "Australia/South" 12234 msgstr "استرالیا/پرت" 12235 12236 #: kdecore/TIMEZONES:1071 12237 #, kde-format 12238 msgid "Australia/Sydney" 12239 msgstr "استرالیا/سیدنی" 12240 12241 #. i18n: comment to the previous timezone 12242 #: kdecore/TIMEZONES:1075 12243 #, kde-format 12244 msgid "New South Wales (most areas)" 12245 msgstr "" 12246 12247 #: kdecore/TIMEZONES:1076 12248 #, fuzzy, kde-format 12249 #| msgid "Australia/Brisbane" 12250 msgid "Australia/Tasmania" 12251 msgstr "استرالیا/بریزین" 12252 12253 #: kdecore/TIMEZONES:1079 12254 #, fuzzy, kde-format 12255 #| msgid "Australia/Eucla" 12256 msgid "Australia/Victoria" 12257 msgstr "استرالیا/اوکلا" 12258 12259 #: kdecore/TIMEZONES:1082 12260 #, fuzzy, kde-format 12261 #| msgid "Australia/Perth" 12262 msgid "Australia/West" 12263 msgstr "استرالیا/پرت" 12264 12265 #: kdecore/TIMEZONES:1085 12266 #, fuzzy, kde-format 12267 #| msgid "Australia/Darwin" 12268 msgid "Australia/Yancowinna" 12269 msgstr "استرالیا/داروین" 12270 12271 #: kdecore/TIMEZONES:1088 12272 #, kde-format 12273 msgid "Brazil/Acre" 12274 msgstr "" 12275 12276 #: kdecore/TIMEZONES:1091 12277 #, fuzzy, kde-format 12278 #| msgid "America/Noronha" 12279 msgid "Brazil/DeNoronha" 12280 msgstr "آمریکا/نورونیا" 12281 12282 #: kdecore/TIMEZONES:1094 12283 #, kde-format 12284 msgid "Brazil/East" 12285 msgstr "" 12286 12287 #: kdecore/TIMEZONES:1097 12288 #, kde-format 12289 msgid "Brazil/West" 12290 msgstr "" 12291 12292 #: kdecore/TIMEZONES:1100 12293 #, kde-format 12294 msgid "Canada/Atlantic" 12295 msgstr "" 12296 12297 #: kdecore/TIMEZONES:1103 12298 #, kde-format 12299 msgid "Canada/Central" 12300 msgstr "" 12301 12302 #: kdecore/TIMEZONES:1106 12303 #, kde-format 12304 msgid "Canada/East-Saskatchewan" 12305 msgstr "" 12306 12307 #: kdecore/TIMEZONES:1109 12308 #, kde-format 12309 msgid "Canada/Eastern" 12310 msgstr "" 12311 12312 #: kdecore/TIMEZONES:1112 12313 #, kde-format 12314 msgid "Canada/Mountain" 12315 msgstr "" 12316 12317 #: kdecore/TIMEZONES:1115 12318 #, kde-format 12319 msgid "Canada/Newfoundland" 12320 msgstr "" 12321 12322 #: kdecore/TIMEZONES:1118 12323 #, kde-format 12324 msgid "Canada/Pacific" 12325 msgstr "" 12326 12327 #: kdecore/TIMEZONES:1121 12328 #, kde-format 12329 msgid "Canada/Saskatchewan" 12330 msgstr "" 12331 12332 #: kdecore/TIMEZONES:1124 12333 #, kde-format 12334 msgid "Canada/Yukon" 12335 msgstr "" 12336 12337 #: kdecore/TIMEZONES:1127 12338 #, kde-format 12339 msgid "Chile/Continental" 12340 msgstr "" 12341 12342 #: kdecore/TIMEZONES:1130 12343 #, kde-format 12344 msgid "Chile/EasterIsland" 12345 msgstr "" 12346 12347 #. i18n: comment to the previous timezone 12348 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12349 #, kde-format 12350 msgid "Easter Island & Sala y Gomez" 12351 msgstr "" 12352 12353 #: kdecore/TIMEZONES:1133 12354 #, kde-format 12355 msgid "Cuba" 12356 msgstr "" 12357 12358 #: kdecore/TIMEZONES:1134 12359 #, kde-format 12360 msgid "Egypt" 12361 msgstr "" 12362 12363 #: kdecore/TIMEZONES:1135 12364 #, kde-format 12365 msgid "Eire" 12366 msgstr "" 12367 12368 #: kdecore/TIMEZONES:1136 12369 #, kde-format 12370 msgid "Europe/Amsterdam" 12371 msgstr "اروپا/آمستردام" 12372 12373 #: kdecore/TIMEZONES:1137 12374 #, kde-format 12375 msgid "Europe/Andorra" 12376 msgstr "اروپا/آندورا" 12377 12378 #: kdecore/TIMEZONES:1138 12379 #, fuzzy, kde-format 12380 #| msgid "Europe/Athens" 12381 msgid "Europe/Astrakhan" 12382 msgstr "اروپا/آتن" 12383 12384 #. i18n: comment to the previous timezone 12385 #: kdecore/TIMEZONES:1140 12386 #, kde-format 12387 msgid "MSK+01 - Astrakhan" 12388 msgstr "" 12389 12390 #: kdecore/TIMEZONES:1141 12391 #, kde-format 12392 msgid "Europe/Athens" 12393 msgstr "اروپا/آتن" 12394 12395 #: kdecore/TIMEZONES:1142 12396 #, kde-format 12397 msgid "Europe/Belfast" 12398 msgstr "اروپا/بلفاست" 12399 12400 #: kdecore/TIMEZONES:1143 12401 #, kde-format 12402 msgid "Europe/Belgrade" 12403 msgstr "اروپا/بلگراد" 12404 12405 #: kdecore/TIMEZONES:1144 12406 #, kde-format 12407 msgid "Europe/Berlin" 12408 msgstr "اروپا/برلین" 12409 12410 #. i18n: comment to the previous timezone 12411 #: kdecore/TIMEZONES:1146 12412 #, kde-format 12413 msgid "Germany (most areas)" 12414 msgstr "" 12415 12416 #: kdecore/TIMEZONES:1147 12417 #, kde-format 12418 msgid "Europe/Bratislava" 12419 msgstr "اروپا/براتیسلاوا" 12420 12421 #: kdecore/TIMEZONES:1148 12422 #, kde-format 12423 msgid "Europe/Brussels" 12424 msgstr "اروپا/بروکسل" 12425 12426 #: kdecore/TIMEZONES:1149 12427 #, kde-format 12428 msgid "Europe/Bucharest" 12429 msgstr "اروپا/بخارست" 12430 12431 #: kdecore/TIMEZONES:1150 12432 #, kde-format 12433 msgid "Europe/Budapest" 12434 msgstr "اروپا/بوداپست" 12435 12436 #: kdecore/TIMEZONES:1151 12437 #, fuzzy, kde-format 12438 #| msgid "Europe/Brussels" 12439 msgid "Europe/Busingen" 12440 msgstr "اروپا/بروکسل" 12441 12442 #. i18n: comment to the previous timezone 12443 #: kdecore/TIMEZONES:1153 12444 #, kde-format 12445 msgid "Busingen" 12446 msgstr "" 12447 12448 #: kdecore/TIMEZONES:1154 12449 #, kde-format 12450 msgid "Europe/Chisinau" 12451 msgstr "اروپا/کیشینئو" 12452 12453 #: kdecore/TIMEZONES:1155 12454 #, kde-format 12455 msgid "Europe/Copenhagen" 12456 msgstr "اروپا/کپنهاگ" 12457 12458 #: kdecore/TIMEZONES:1156 12459 #, kde-format 12460 msgid "Europe/Dublin" 12461 msgstr "اروپا/دوبلین" 12462 12463 #: kdecore/TIMEZONES:1157 12464 #, kde-format 12465 msgid "Europe/Gibraltar" 12466 msgstr "اروپا/خیورالتار" 12467 12468 #: kdecore/TIMEZONES:1158 12469 #, fuzzy, kde-format 12470 msgid "Europe/Guernsey" 12471 msgstr "اروپا/آتن" 12472 12473 #: kdecore/TIMEZONES:1159 12474 #, kde-format 12475 msgid "Europe/Helsinki" 12476 msgstr "اروپا/هلسینکی" 12477 12478 #: kdecore/TIMEZONES:1160 12479 #, kde-format 12480 msgid "Europe/Isle_of_Man" 12481 msgstr "اروپا/ایزل-آو-من" 12482 12483 #: kdecore/TIMEZONES:1161 12484 #, kde-format 12485 msgid "Europe/Istanbul" 12486 msgstr "اروپا/استانبول" 12487 12488 #: kdecore/TIMEZONES:1162 12489 #, kde-format 12490 msgid "Europe/Jersey" 12491 msgstr "اروپا/جرسی" 12492 12493 #: kdecore/TIMEZONES:1163 12494 #, kde-format 12495 msgid "Europe/Kaliningrad" 12496 msgstr "اروپا/کالینینگراد" 12497 12498 #. i18n: comment to the previous timezone 12499 #: kdecore/TIMEZONES:1165 12500 #, kde-format 12501 msgid "Moscow-01 - Kaliningrad" 12502 msgstr "" 12503 12504 #. i18n: comment to the previous timezone 12505 #: kdecore/TIMEZONES:1167 12506 #, kde-format 12507 msgid "MSK-01 - Kaliningrad" 12508 msgstr "" 12509 12510 #: kdecore/TIMEZONES:1168 12511 #, kde-format 12512 msgid "Europe/Kiev" 12513 msgstr "اروپا/کیف" 12514 12515 #. i18n: comment to the previous timezone 12516 #: kdecore/TIMEZONES:1172 12517 #, kde-format 12518 msgid "Ukraine (most areas)" 12519 msgstr "" 12520 12521 #: kdecore/TIMEZONES:1173 12522 #, fuzzy, kde-format 12523 #| msgid "Europe/Kiev" 12524 msgid "Europe/Kirov" 12525 msgstr "اروپا/کیف" 12526 12527 #. i18n: comment to the previous timezone 12528 #: kdecore/TIMEZONES:1175 12529 #, kde-format 12530 msgid "MSK+00 - Kirov" 12531 msgstr "" 12532 12533 #: kdecore/TIMEZONES:1176 12534 #, kde-format 12535 msgid "Europe/Lisbon" 12536 msgstr "اروپا/لیسبون" 12537 12538 #. i18n: comment to the previous timezone 12539 #: kdecore/TIMEZONES:1180 12540 #, kde-format 12541 msgid "Portugal (mainland)" 12542 msgstr "" 12543 12544 #: kdecore/TIMEZONES:1181 12545 #, kde-format 12546 msgid "Europe/Ljubljana" 12547 msgstr "اروپا/لیوبلیانا" 12548 12549 #: kdecore/TIMEZONES:1182 12550 #, kde-format 12551 msgid "Europe/London" 12552 msgstr "اروپا/لندن" 12553 12554 #: kdecore/TIMEZONES:1183 12555 #, kde-format 12556 msgid "Europe/Luxembourg" 12557 msgstr "اروپا/لوکزامبورگ" 12558 12559 #: kdecore/TIMEZONES:1184 12560 #, kde-format 12561 msgid "Europe/Madrid" 12562 msgstr "اروپا/مادرید" 12563 12564 #. i18n: comment to the previous timezone 12565 #: kdecore/TIMEZONES:1188 12566 #, kde-format 12567 msgid "Spain (mainland)" 12568 msgstr "" 12569 12570 #: kdecore/TIMEZONES:1189 12571 #, kde-format 12572 msgid "Europe/Malta" 12573 msgstr "اروپا/مالت" 12574 12575 #: kdecore/TIMEZONES:1190 12576 #, kde-format 12577 msgid "Europe/Mariehamn" 12578 msgstr "اروپا/ماریام" 12579 12580 #: kdecore/TIMEZONES:1191 12581 #, kde-format 12582 msgid "Europe/Minsk" 12583 msgstr "اروپا/مینسک" 12584 12585 #: kdecore/TIMEZONES:1192 12586 #, kde-format 12587 msgid "Europe/Monaco" 12588 msgstr "اروپا/موناکو" 12589 12590 #: kdecore/TIMEZONES:1193 12591 #, kde-format 12592 msgid "Europe/Moscow" 12593 msgstr "اروپا/موسکو" 12594 12595 #. i18n: comment to the previous timezone 12596 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12597 #, kde-format 12598 msgid "Moscow+00 - west Russia" 12599 msgstr "" 12600 12601 #. i18n: comment to the previous timezone 12602 #: kdecore/TIMEZONES:1197 12603 #, kde-format 12604 msgid "MSK+00 - Moscow area" 12605 msgstr "" 12606 12607 #: kdecore/TIMEZONES:1198 12608 #, kde-format 12609 msgid "Europe/Oslo" 12610 msgstr "اروپا/اوسلو" 12611 12612 #: kdecore/TIMEZONES:1199 12613 #, kde-format 12614 msgid "Europe/Paris" 12615 msgstr "اروپا/پاریس" 12616 12617 #: kdecore/TIMEZONES:1200 12618 #, kde-format 12619 msgid "Europe/Podgorica" 12620 msgstr "اروپا/پُدگُریکا" 12621 12622 #: kdecore/TIMEZONES:1201 12623 #, kde-format 12624 msgid "Europe/Prague" 12625 msgstr "اروپا/پراگ" 12626 12627 #: kdecore/TIMEZONES:1202 12628 #, kde-format 12629 msgid "Europe/Riga" 12630 msgstr "اروپا/ریگا" 12631 12632 #: kdecore/TIMEZONES:1203 12633 #, kde-format 12634 msgid "Europe/Rome" 12635 msgstr "اروپا/رم" 12636 12637 #: kdecore/TIMEZONES:1204 12638 #, kde-format 12639 msgid "Europe/Samara" 12640 msgstr "اروپا/سامارا" 12641 12642 #. i18n: comment to the previous timezone 12643 #: kdecore/TIMEZONES:1206 12644 #, kde-format 12645 msgid "Moscow+01 - Samara, Udmurtia" 12646 msgstr "" 12647 12648 #. i18n: comment to the previous timezone 12649 #: kdecore/TIMEZONES:1208 12650 #, kde-format 12651 msgid "Moscow+00 - Samara, Udmurtia" 12652 msgstr "" 12653 12654 #. i18n: comment to the previous timezone 12655 #: kdecore/TIMEZONES:1210 12656 #, kde-format 12657 msgid "MSK+01 - Samara, Udmurtia" 12658 msgstr "" 12659 12660 #: kdecore/TIMEZONES:1211 12661 #, kde-format 12662 msgid "Europe/San_Marino" 12663 msgstr "اروپا/سانمارینو" 12664 12665 #: kdecore/TIMEZONES:1212 12666 #, kde-format 12667 msgid "Europe/Sarajevo" 12668 msgstr "اروپا/سارایوو" 12669 12670 #: kdecore/TIMEZONES:1213 12671 #, fuzzy, kde-format 12672 #| msgid "Europe/Sarajevo" 12673 msgid "Europe/Saratov" 12674 msgstr "اروپا/سارایوو" 12675 12676 #. i18n: comment to the previous timezone 12677 #: kdecore/TIMEZONES:1215 12678 #, kde-format 12679 msgid "MSK+01 - Saratov" 12680 msgstr "" 12681 12682 #: kdecore/TIMEZONES:1216 12683 #, kde-format 12684 msgid "Europe/Simferopol" 12685 msgstr "اروپا/سیمفروپل" 12686 12687 #. i18n: comment to the previous timezone 12688 #: kdecore/TIMEZONES:1218 12689 #, kde-format 12690 msgid "central Crimea" 12691 msgstr "" 12692 12693 #. i18n: comment to the previous timezone 12694 #: kdecore/TIMEZONES:1220 12695 #, fuzzy, kde-format 12696 #| msgid "Prime: " 12697 msgid "Crimea" 12698 msgstr "اولیه:" 12699 12700 #: kdecore/TIMEZONES:1221 12701 #, kde-format 12702 msgid "Europe/Skopje" 12703 msgstr "اروپا/اسکوپیه" 12704 12705 #: kdecore/TIMEZONES:1222 12706 #, kde-format 12707 msgid "Europe/Sofia" 12708 msgstr "اروپا/صوفیه" 12709 12710 #: kdecore/TIMEZONES:1223 12711 #, kde-format 12712 msgid "Europe/Stockholm" 12713 msgstr "اروپا/استوکهلم" 12714 12715 #: kdecore/TIMEZONES:1224 12716 #, kde-format 12717 msgid "Europe/Tallinn" 12718 msgstr "اروپا/تالین" 12719 12720 #: kdecore/TIMEZONES:1225 12721 #, kde-format 12722 msgid "Europe/Tirane" 12723 msgstr "اروپا/تیرانا" 12724 12725 #: kdecore/TIMEZONES:1226 12726 #, fuzzy, kde-format 12727 #| msgid "Europe/Tirane" 12728 msgid "Europe/Tiraspol" 12729 msgstr "اروپا/تیرانا" 12730 12731 #: kdecore/TIMEZONES:1227 12732 #, fuzzy, kde-format 12733 #| msgid "Europe/Minsk" 12734 msgid "Europe/Ulyanovsk" 12735 msgstr "اروپا/مینسک" 12736 12737 #. i18n: comment to the previous timezone 12738 #: kdecore/TIMEZONES:1229 12739 #, kde-format 12740 msgid "MSK+01 - Ulyanovsk" 12741 msgstr "" 12742 12743 #: kdecore/TIMEZONES:1230 12744 #, kde-format 12745 msgid "Europe/Uzhgorod" 12746 msgstr "اروپا/اوژگرت" 12747 12748 #. i18n: comment to the previous timezone 12749 #: kdecore/TIMEZONES:1232 12750 #, kde-format 12751 msgid "Ruthenia" 12752 msgstr "" 12753 12754 #. i18n: comment to the previous timezone 12755 #: kdecore/TIMEZONES:1234 12756 #, kde-format 12757 msgid "Transcarpathia" 12758 msgstr "" 12759 12760 #: kdecore/TIMEZONES:1235 12761 #, kde-format 12762 msgid "Europe/Vaduz" 12763 msgstr "اروپا/فادوتس" 12764 12765 #: kdecore/TIMEZONES:1236 12766 #, kde-format 12767 msgid "Europe/Vatican" 12768 msgstr "اروپا/واتیکان" 12769 12770 #: kdecore/TIMEZONES:1237 12771 #, kde-format 12772 msgid "Europe/Vienna" 12773 msgstr "اروپا/وین" 12774 12775 #: kdecore/TIMEZONES:1238 12776 #, kde-format 12777 msgid "Europe/Vilnius" 12778 msgstr "اروپا/ویلنیوس" 12779 12780 #: kdecore/TIMEZONES:1239 12781 #, kde-format 12782 msgid "Europe/Volgograd" 12783 msgstr "اروپا/وُلگُگراد" 12784 12785 #. i18n: comment to the previous timezone 12786 #: kdecore/TIMEZONES:1241 12787 #, kde-format 12788 msgid "Moscow+00 - Caspian Sea" 12789 msgstr "" 12790 12791 #. i18n: comment to the previous timezone 12792 #: kdecore/TIMEZONES:1243 12793 #, kde-format 12794 msgid "MSK+00 - Volgograd" 12795 msgstr "" 12796 12797 #: kdecore/TIMEZONES:1244 12798 #, kde-format 12799 msgid "Europe/Warsaw" 12800 msgstr "اروپا/ورشو" 12801 12802 #: kdecore/TIMEZONES:1245 12803 #, kde-format 12804 msgid "Europe/Zagreb" 12805 msgstr "اروپا/زاگرب" 12806 12807 #: kdecore/TIMEZONES:1246 12808 #, kde-format 12809 msgid "Europe/Zaporozhye" 12810 msgstr "اروپا/زاپاروژیه" 12811 12812 #. i18n: comment to the previous timezone 12813 #: kdecore/TIMEZONES:1248 12814 #, kde-format 12815 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12816 msgstr "" 12817 12818 #. i18n: comment to the previous timezone 12819 #: kdecore/TIMEZONES:1250 12820 #, kde-format 12821 msgid "Zaporozhye and east Lugansk" 12822 msgstr "" 12823 12824 #: kdecore/TIMEZONES:1251 12825 #, kde-format 12826 msgid "Europe/Zurich" 12827 msgstr "اروپا/زوریخ" 12828 12829 #: kdecore/TIMEZONES:1252 12830 #, kde-format 12831 msgid "GB" 12832 msgstr "" 12833 12834 #: kdecore/TIMEZONES:1253 12835 #, kde-format 12836 msgid "GB-Eire" 12837 msgstr "" 12838 12839 #: kdecore/TIMEZONES:1254 12840 #, fuzzy, kde-format 12841 #| msgid "Asia/Hong_Kong" 12842 msgid "Hongkong" 12843 msgstr "آسیا/هنگکنگ" 12844 12845 #: kdecore/TIMEZONES:1255 12846 #, kde-format 12847 msgid "Iceland" 12848 msgstr "" 12849 12850 #: kdecore/TIMEZONES:1256 12851 #, kde-format 12852 msgid "Indian/Antananarivo" 12853 msgstr "اقیانوس هند/آنتاناناریوو" 12854 12855 #: kdecore/TIMEZONES:1257 12856 #, kde-format 12857 msgid "Indian/Chagos" 12858 msgstr "اقیانوس هند/چاگوس" 12859 12860 #: kdecore/TIMEZONES:1258 12861 #, kde-format 12862 msgid "Indian/Christmas" 12863 msgstr "اقیانوس هند/کریسمس" 12864 12865 #: kdecore/TIMEZONES:1259 12866 #, kde-format 12867 msgid "Indian/Cocos" 12868 msgstr "اقیانوس هند/کوکوس" 12869 12870 #: kdecore/TIMEZONES:1260 12871 #, kde-format 12872 msgid "Indian/Comoro" 12873 msgstr "اقیانوس هند/کومور" 12874 12875 #: kdecore/TIMEZONES:1261 12876 #, kde-format 12877 msgid "Indian/Kerguelen" 12878 msgstr "اقیانوس هند/کرگلن" 12879 12880 #: kdecore/TIMEZONES:1262 12881 #, kde-format 12882 msgid "Indian/Mahe" 12883 msgstr "اقیانوس هند/مائه" 12884 12885 #: kdecore/TIMEZONES:1263 12886 #, kde-format 12887 msgid "Indian/Maldives" 12888 msgstr "اقیانوس هند/مالدیو" 12889 12890 #: kdecore/TIMEZONES:1264 12891 #, kde-format 12892 msgid "Indian/Mauritius" 12893 msgstr "اقیانوس هند/موریس" 12894 12895 #: kdecore/TIMEZONES:1265 12896 #, kde-format 12897 msgid "Indian/Mayotte" 12898 msgstr "اقیانوس هند/مایوت" 12899 12900 #: kdecore/TIMEZONES:1266 12901 #, kde-format 12902 msgid "Indian/Reunion" 12903 msgstr "اقیانوس هند/رئونیون" 12904 12905 #: kdecore/TIMEZONES:1267 12906 #, kde-format 12907 msgid "Iran" 12908 msgstr "" 12909 12910 #: kdecore/TIMEZONES:1268 12911 #, fuzzy, kde-format 12912 #| msgid "Pacific/Kosrae" 12913 msgid "Israel" 12914 msgstr "اقیانوس آرام/کوسرای" 12915 12916 #: kdecore/TIMEZONES:1269 12917 #, fuzzy, kde-format 12918 #| msgid "America/Jamaica" 12919 msgid "Jamaica" 12920 msgstr "آمریکا/جامائیکا" 12921 12922 #: kdecore/TIMEZONES:1270 12923 #, kde-format 12924 msgid "Japan" 12925 msgstr "" 12926 12927 #. i18n: comment to the previous timezone 12928 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12929 #, fuzzy, kde-format 12930 #| msgid "Pacific/Kwajalein" 12931 msgid "Kwajalein" 12932 msgstr "اقیانوس آرام/کواجالین" 12933 12934 #: kdecore/TIMEZONES:1274 12935 #, kde-format 12936 msgid "Libya" 12937 msgstr "" 12938 12939 #: kdecore/TIMEZONES:1275 12940 #, kde-format 12941 msgid "Mexico/BajaNorte" 12942 msgstr "" 12943 12944 #: kdecore/TIMEZONES:1278 12945 #, kde-format 12946 msgid "Mexico/BajaSur" 12947 msgstr "" 12948 12949 #: kdecore/TIMEZONES:1281 12950 #, kde-format 12951 msgid "Mexico/General" 12952 msgstr "" 12953 12954 #: kdecore/TIMEZONES:1284 12955 #, kde-format 12956 msgid "NZ" 12957 msgstr "" 12958 12959 #: kdecore/TIMEZONES:1287 12960 #, kde-format 12961 msgid "NZ-CHAT" 12962 msgstr "" 12963 12964 #. i18n: comment to the previous timezone 12965 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12966 #, kde-format 12967 msgid "Chatham Islands" 12968 msgstr "" 12969 12970 #: kdecore/TIMEZONES:1290 12971 #, kde-format 12972 msgid "Navajo" 12973 msgstr "" 12974 12975 #: kdecore/TIMEZONES:1293 12976 #, kde-format 12977 msgid "PRC" 12978 msgstr "" 12979 12980 #: kdecore/TIMEZONES:1296 12981 #, kde-format 12982 msgid "Pacific/Apia" 12983 msgstr "اقیانوس آرام/آپیا" 12984 12985 #: kdecore/TIMEZONES:1297 12986 #, kde-format 12987 msgid "Pacific/Auckland" 12988 msgstr "اقیانوس آرام/اوکلند" 12989 12990 #. i18n: comment to the previous timezone 12991 #: kdecore/TIMEZONES:1301 12992 #, kde-format 12993 msgid "New Zealand (most areas)" 12994 msgstr "" 12995 12996 #: kdecore/TIMEZONES:1302 12997 #, fuzzy, kde-format 12998 #| msgid "Pacific/Honolulu" 12999 msgid "Pacific/Bougainville" 13000 msgstr "اقیانوس آرام/هونولولو" 13001 13002 #. i18n: comment to the previous timezone 13003 #: kdecore/TIMEZONES:1304 13004 #, kde-format 13005 msgid "Bougainville" 13006 msgstr "" 13007 13008 #: kdecore/TIMEZONES:1305 13009 #, kde-format 13010 msgid "Pacific/Chatham" 13011 msgstr "اقیانوس آرام/چتم" 13012 13013 #: kdecore/TIMEZONES:1308 13014 #, fuzzy, kde-format 13015 #| msgid "Pacific/Truk" 13016 msgid "Pacific/Chuuk" 13017 msgstr "اقیانوس آرام/تروک" 13018 13019 #. i18n: comment to the previous timezone 13020 #: kdecore/TIMEZONES:1310 13021 #, kde-format 13022 msgid "Chuuk (Truk) and Yap" 13023 msgstr "" 13024 13025 #. i18n: comment to the previous timezone 13026 #: kdecore/TIMEZONES:1312 13027 #, kde-format 13028 msgid "Chuuk/Truk, Yap" 13029 msgstr "" 13030 13031 #: kdecore/TIMEZONES:1313 13032 #, kde-format 13033 msgid "Pacific/Easter" 13034 msgstr "اقیانوس آرام/ایستر" 13035 13036 #. i18n: comment to the previous timezone 13037 #: kdecore/TIMEZONES:1317 13038 #, fuzzy, kde-format 13039 #| msgctxt "digit set" 13040 #| msgid "Eastern Arabic-Indic" 13041 msgid "Easter Island" 13042 msgstr "عربی-هندی شرقی" 13043 13044 #: kdecore/TIMEZONES:1318 13045 #, kde-format 13046 msgid "Pacific/Efate" 13047 msgstr "اقیانوس آرام/افاته" 13048 13049 #: kdecore/TIMEZONES:1319 13050 #, kde-format 13051 msgid "Pacific/Enderbury" 13052 msgstr "اقیانوس آرام/اندربری" 13053 13054 #. i18n: comment to the previous timezone 13055 #: kdecore/TIMEZONES:1321 13056 #, kde-format 13057 msgid "Phoenix Islands" 13058 msgstr "" 13059 13060 #: kdecore/TIMEZONES:1322 13061 #, kde-format 13062 msgid "Pacific/Fakaofo" 13063 msgstr "اقیانوس آرام/فاکائوفو" 13064 13065 #: kdecore/TIMEZONES:1323 13066 #, kde-format 13067 msgid "Pacific/Fiji" 13068 msgstr "اقیانوس آرام/فیجی" 13069 13070 #: kdecore/TIMEZONES:1324 13071 #, kde-format 13072 msgid "Pacific/Funafuti" 13073 msgstr "اقیانوس آرام/فونافوتی" 13074 13075 #: kdecore/TIMEZONES:1325 13076 #, kde-format 13077 msgid "Pacific/Galapagos" 13078 msgstr "اقیانوس آرام/گالاپاگوس" 13079 13080 #. i18n: comment to the previous timezone 13081 #: kdecore/TIMEZONES:1327 13082 #, kde-format 13083 msgid "Galapagos Islands" 13084 msgstr "" 13085 13086 #: kdecore/TIMEZONES:1328 13087 #, kde-format 13088 msgid "Pacific/Gambier" 13089 msgstr "اقیانوس آرام/گامبیه" 13090 13091 #. i18n: comment to the previous timezone 13092 #: kdecore/TIMEZONES:1330 13093 #, kde-format 13094 msgid "Gambier Islands" 13095 msgstr "" 13096 13097 #: kdecore/TIMEZONES:1331 13098 #, kde-format 13099 msgid "Pacific/Guadalcanal" 13100 msgstr "اقیانوس آرام/گوادالکانال" 13101 13102 #: kdecore/TIMEZONES:1332 13103 #, kde-format 13104 msgid "Pacific/Guam" 13105 msgstr "اقیانوس آرام/گوام" 13106 13107 #: kdecore/TIMEZONES:1333 13108 #, kde-format 13109 msgid "Pacific/Honolulu" 13110 msgstr "اقیانوس آرام/هونولولو" 13111 13112 #. i18n: comment to the previous timezone 13113 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13114 #, kde-format 13115 msgid "Hawaii" 13116 msgstr "" 13117 13118 #: kdecore/TIMEZONES:1336 13119 #, kde-format 13120 msgid "Pacific/Johnston" 13121 msgstr "اقیانوس آرام/جانستون" 13122 13123 #. i18n: comment to the previous timezone 13124 #: kdecore/TIMEZONES:1338 13125 #, kde-format 13126 msgid "Johnston Atoll" 13127 msgstr "" 13128 13129 #: kdecore/TIMEZONES:1339 13130 #, kde-format 13131 msgid "Pacific/Kiritimati" 13132 msgstr "اقیانوس آرام/کریسمس" 13133 13134 #. i18n: comment to the previous timezone 13135 #: kdecore/TIMEZONES:1341 13136 #, kde-format 13137 msgid "Line Islands" 13138 msgstr "" 13139 13140 #: kdecore/TIMEZONES:1342 13141 #, kde-format 13142 msgid "Pacific/Kosrae" 13143 msgstr "اقیانوس آرام/کوسرای" 13144 13145 #. i18n: comment to the previous timezone 13146 #: kdecore/TIMEZONES:1344 13147 #, fuzzy, kde-format 13148 #| msgid "Pacific/Kosrae" 13149 msgid "Kosrae" 13150 msgstr "اقیانوس آرام/کوسرای" 13151 13152 #: kdecore/TIMEZONES:1345 13153 #, kde-format 13154 msgid "Pacific/Kwajalein" 13155 msgstr "اقیانوس آرام/کواجالین" 13156 13157 #: kdecore/TIMEZONES:1348 13158 #, kde-format 13159 msgid "Pacific/Majuro" 13160 msgstr "اقیانوس آرام/مجورو" 13161 13162 #. i18n: comment to the previous timezone 13163 #: kdecore/TIMEZONES:1352 13164 #, kde-format 13165 msgid "Marshall Islands (most areas)" 13166 msgstr "" 13167 13168 #: kdecore/TIMEZONES:1353 13169 #, kde-format 13170 msgid "Pacific/Marquesas" 13171 msgstr "اقیانوس آرام/مارکیزاس" 13172 13173 #. i18n: comment to the previous timezone 13174 #: kdecore/TIMEZONES:1355 13175 #, kde-format 13176 msgid "Marquesas Islands" 13177 msgstr "" 13178 13179 #: kdecore/TIMEZONES:1356 13180 #, kde-format 13181 msgid "Pacific/Midway" 13182 msgstr "اقیانوس آرام/میدوی" 13183 13184 #. i18n: comment to the previous timezone 13185 #: kdecore/TIMEZONES:1358 13186 #, kde-format 13187 msgid "Midway Islands" 13188 msgstr "" 13189 13190 #: kdecore/TIMEZONES:1359 13191 #, kde-format 13192 msgid "Pacific/Nauru" 13193 msgstr "اقیانوس آرام/نائور" 13194 13195 #: kdecore/TIMEZONES:1360 13196 #, kde-format 13197 msgid "Pacific/Niue" 13198 msgstr "اقیانوس آرام/نیوئه" 13199 13200 #: kdecore/TIMEZONES:1361 13201 #, kde-format 13202 msgid "Pacific/Norfolk" 13203 msgstr "اقیانوس آرام/نورفولک" 13204 13205 #: kdecore/TIMEZONES:1362 13206 #, kde-format 13207 msgid "Pacific/Noumea" 13208 msgstr "اقیانوس آرام/نومئا" 13209 13210 #: kdecore/TIMEZONES:1363 13211 #, kde-format 13212 msgid "Pacific/Pago_Pago" 13213 msgstr "اقیانوس آرام/پاگو پاگو" 13214 13215 #: kdecore/TIMEZONES:1364 13216 #, kde-format 13217 msgid "Pacific/Palau" 13218 msgstr "اقیانوس آرام/پالاو" 13219 13220 #: kdecore/TIMEZONES:1365 13221 #, kde-format 13222 msgid "Pacific/Pitcairn" 13223 msgstr "اقیانوس آرام/پیتکرن" 13224 13225 #: kdecore/TIMEZONES:1366 13226 #, fuzzy, kde-format 13227 #| msgid "Pacific/Ponape" 13228 msgid "Pacific/Pohnpei" 13229 msgstr "اقیانوس آرام/پوناپی" 13230 13231 #. i18n: comment to the previous timezone 13232 #: kdecore/TIMEZONES:1368 13233 #, kde-format 13234 msgid "Pohnpei (Ponape)" 13235 msgstr "" 13236 13237 #. i18n: comment to the previous timezone 13238 #: kdecore/TIMEZONES:1370 13239 #, fuzzy, kde-format 13240 #| msgid "Pacific/Ponape" 13241 msgid "Pohnpei/Ponape" 13242 msgstr "اقیانوس آرام/پوناپی" 13243 13244 #: kdecore/TIMEZONES:1371 13245 #, kde-format 13246 msgid "Pacific/Ponape" 13247 msgstr "اقیانوس آرام/پوناپی" 13248 13249 #. i18n: comment to the previous timezone 13250 #: kdecore/TIMEZONES:1373 13251 #, kde-format 13252 msgid "Ponape (Pohnpei)" 13253 msgstr "" 13254 13255 #: kdecore/TIMEZONES:1374 13256 #, kde-format 13257 msgid "Pacific/Port_Moresby" 13258 msgstr "اقیانوس آرام/پورت مورزبی" 13259 13260 #. i18n: comment to the previous timezone 13261 #: kdecore/TIMEZONES:1376 13262 #, kde-format 13263 msgid "Papua New Guinea (most areas)" 13264 msgstr "" 13265 13266 #: kdecore/TIMEZONES:1377 13267 #, kde-format 13268 msgid "Pacific/Rarotonga" 13269 msgstr "اقیانوس آرام/راروتونگا" 13270 13271 #: kdecore/TIMEZONES:1378 13272 #, kde-format 13273 msgid "Pacific/Saipan" 13274 msgstr "اقیانوس آرام/سایپان" 13275 13276 #: kdecore/TIMEZONES:1379 13277 #, fuzzy, kde-format 13278 #| msgid "Pacific/Saipan" 13279 msgid "Pacific/Samoa" 13280 msgstr "اقیانوس آرام/سایپان" 13281 13282 #: kdecore/TIMEZONES:1380 13283 #, kde-format 13284 msgid "Pacific/Tahiti" 13285 msgstr "اقیانوس آرام/تاهیتی" 13286 13287 #. i18n: comment to the previous timezone 13288 #: kdecore/TIMEZONES:1382 13289 #, kde-format 13290 msgid "Society Islands" 13291 msgstr "" 13292 13293 #: kdecore/TIMEZONES:1383 13294 #, kde-format 13295 msgid "Pacific/Tarawa" 13296 msgstr "اقیانوس آرام/تاراوا" 13297 13298 #. i18n: comment to the previous timezone 13299 #: kdecore/TIMEZONES:1385 13300 #, kde-format 13301 msgid "Gilbert Islands" 13302 msgstr "" 13303 13304 #: kdecore/TIMEZONES:1386 13305 #, kde-format 13306 msgid "Pacific/Tongatapu" 13307 msgstr "اقیانوس آرام/تونگاتاپو" 13308 13309 #: kdecore/TIMEZONES:1387 13310 #, kde-format 13311 msgid "Pacific/Truk" 13312 msgstr "اقیانوس آرام/تروک" 13313 13314 #. i18n: comment to the previous timezone 13315 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13316 #, kde-format 13317 msgid "Truk (Chuuk) and Yap" 13318 msgstr "" 13319 13320 #: kdecore/TIMEZONES:1390 13321 #, kde-format 13322 msgid "Pacific/Wake" 13323 msgstr "اقیانوس آرام/ویک" 13324 13325 #. i18n: comment to the previous timezone 13326 #: kdecore/TIMEZONES:1392 13327 #, kde-format 13328 msgid "Wake Island" 13329 msgstr "" 13330 13331 #: kdecore/TIMEZONES:1393 13332 #, kde-format 13333 msgid "Pacific/Wallis" 13334 msgstr "اقیانوس آرام/والیس" 13335 13336 #: kdecore/TIMEZONES:1394 13337 #, kde-format 13338 msgid "Pacific/Yap" 13339 msgstr "اقیانوس آرام/یپ" 13340 13341 #: kdecore/TIMEZONES:1397 13342 #, kde-format 13343 msgid "Poland" 13344 msgstr "" 13345 13346 #: kdecore/TIMEZONES:1398 13347 #, kde-format 13348 msgid "Portugal" 13349 msgstr "" 13350 13351 #: kdecore/TIMEZONES:1401 13352 #, kde-format 13353 msgid "ROC" 13354 msgstr "" 13355 13356 #: kdecore/TIMEZONES:1402 13357 #, kde-format 13358 msgid "ROK" 13359 msgstr "" 13360 13361 #: kdecore/TIMEZONES:1403 13362 #, fuzzy, kde-format 13363 #| msgid "Asia/Singapore" 13364 msgid "Singapore" 13365 msgstr "آسیا/سنگاپور" 13366 13367 #: kdecore/TIMEZONES:1404 13368 #, kde-format 13369 msgid "Turkey" 13370 msgstr "" 13371 13372 #: kdecore/TIMEZONES:1405 13373 #, kde-format 13374 msgid "US/Alaska" 13375 msgstr "" 13376 13377 #: kdecore/TIMEZONES:1408 13378 #, kde-format 13379 msgid "US/Aleutian" 13380 msgstr "" 13381 13382 #: kdecore/TIMEZONES:1411 13383 #, kde-format 13384 msgid "US/Arizona" 13385 msgstr "" 13386 13387 #: kdecore/TIMEZONES:1414 13388 #, kde-format 13389 msgid "US/Central" 13390 msgstr "" 13391 13392 #: kdecore/TIMEZONES:1417 13393 #, kde-format 13394 msgid "US/East-Indiana" 13395 msgstr "" 13396 13397 #: kdecore/TIMEZONES:1420 13398 #, kde-format 13399 msgid "US/Eastern" 13400 msgstr "" 13401 13402 #: kdecore/TIMEZONES:1423 13403 #, kde-format 13404 msgid "US/Hawaii" 13405 msgstr "" 13406 13407 #: kdecore/TIMEZONES:1426 13408 #, kde-format 13409 msgid "US/Indiana-Starke" 13410 msgstr "" 13411 13412 #: kdecore/TIMEZONES:1429 13413 #, kde-format 13414 msgid "US/Michigan" 13415 msgstr "" 13416 13417 #: kdecore/TIMEZONES:1432 13418 #, kde-format 13419 msgid "US/Mountain" 13420 msgstr "" 13421 13422 #: kdecore/TIMEZONES:1435 13423 #, fuzzy, kde-format 13424 #| msgid "Pacific/Yap" 13425 msgid "US/Pacific" 13426 msgstr "اقیانوس آرام/یپ" 13427 13428 #: kdecore/TIMEZONES:1438 13429 #, kde-format 13430 msgid "US/Samoa" 13431 msgstr "" 13432 13433 #: kdecore/TIMEZONES:1439 13434 #, kde-format 13435 msgid "W-SU" 13436 msgstr "" 13437 13438 #. i18n: Generic sans serif font presented in font choosers. When selected, 13439 #. the system will choose a real font, mandated by distro settings. 13440 #: kdeui/fonthelpers.cpp:29 13441 #, kde-format 13442 msgctxt "@item Font name" 13443 msgid "Sans Serif" 13444 msgstr "Sans Serif" 13445 13446 #. i18n: Generic serif font presented in font choosers. When selected, 13447 #. the system will choose a real font, mandated by distro settings. 13448 #: kdeui/fonthelpers.cpp:32 13449 #, kde-format 13450 msgctxt "@item Font name" 13451 msgid "Serif" 13452 msgstr "Serif" 13453 13454 #. i18n: Generic monospace font presented in font choosers. When selected, 13455 #. the system will choose a real font, mandated by distro settings. 13456 #: kdeui/fonthelpers.cpp:35 13457 #, kde-format 13458 msgctxt "@item Font name" 13459 msgid "Monospace" 13460 msgstr "Monospace" 13461 13462 #: kdeui/k4timezonewidget.cpp:62 13463 #, kde-format 13464 msgctxt "Define an area in the time zone, like a town area" 13465 msgid "Area" 13466 msgstr "ناحیه" 13467 13468 #: kdeui/k4timezonewidget.cpp:62 13469 #, kde-format 13470 msgctxt "Time zone" 13471 msgid "Region" 13472 msgstr "منطقه" 13473 13474 #: kdeui/k4timezonewidget.cpp:62 13475 #, fuzzy, kde-format 13476 msgid "Comment" 13477 msgstr "توضیح" 13478 13479 #: kdeui/kapplication.cpp:741 13480 #, kde-format 13481 msgid "The style '%1' was not found" 13482 msgstr "سبک »%1« یافت نشد" 13483 13484 #: kdeui/kcolordialog.cpp:102 13485 #, kde-format 13486 msgctxt "palette name" 13487 msgid "* Recent Colors *" 13488 msgstr "* رنگهای اخیر *" 13489 13490 #: kdeui/kcolordialog.cpp:103 13491 #, kde-format 13492 msgctxt "palette name" 13493 msgid "* Custom Colors *" 13494 msgstr "* رنگهای سفارشی *" 13495 13496 # Forty Colors 13497 #: kdeui/kcolordialog.cpp:104 13498 #, kde-format 13499 msgctxt "palette name" 13500 msgid "Forty Colors" 13501 msgstr "رنگهای چهلی" 13502 13503 # Oxygen Colors 13504 #: kdeui/kcolordialog.cpp:105 13505 #, kde-format 13506 msgctxt "palette name" 13507 msgid "Oxygen Colors" 13508 msgstr "رنگهای اکسیژن" 13509 13510 #: kdeui/kcolordialog.cpp:106 13511 #, kde-format 13512 msgctxt "palette name" 13513 msgid "Rainbow Colors" 13514 msgstr "دنگهای رنگین کمان" 13515 13516 # Royal Colors 13517 #: kdeui/kcolordialog.cpp:107 13518 #, kde-format 13519 msgctxt "palette name" 13520 msgid "Royal Colors" 13521 msgstr "رنگهای سلطنتی" 13522 13523 #: kdeui/kcolordialog.cpp:108 13524 #, kde-format 13525 msgctxt "palette name" 13526 msgid "Web Colors" 13527 msgstr "رنگهای وب" 13528 13529 #: kdeui/kcolordialog.cpp:572 13530 #, kde-format 13531 msgid "Named Colors" 13532 msgstr "رنگهای نامدار" 13533 13534 #: kdeui/kcolordialog.cpp:746 13535 #, fuzzy, kde-format 13536 #| msgid "" 13537 #| "Unable to read X11 RGB color strings. The following file location(s) were " 13538 #| "examined:\n" 13539 msgctxt "" 13540 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13541 "them)" 13542 msgid "" 13543 "Unable to read X11 RGB color strings. The following file location was " 13544 "examined:\n" 13545 "%2" 13546 msgid_plural "" 13547 "Unable to read X11 RGB color strings. The following file locations were " 13548 "examined:\n" 13549 "%2" 13550 msgstr[0] "" 13551 "قادر به خواندن رشتههای رنگ X11 RGB نیست. محل)های( پرونده زیر امتحان شدند:\n" 13552 msgstr[1] "" 13553 13554 #: kdeui/kcolordialog.cpp:997 13555 #, kde-format 13556 msgid "Select Color" 13557 msgstr "برگزیدن رنگ" 13558 13559 #: kdeui/kcolordialog.cpp:1077 13560 #, kde-format 13561 msgid "Hue:" 13562 msgstr "رنگ:" 13563 13564 #: kdeui/kcolordialog.cpp:1083 13565 #, kde-format 13566 msgctxt "The angular degree unit (for hue)" 13567 msgid "°" 13568 msgstr "°" 13569 13570 #: kdeui/kcolordialog.cpp:1088 13571 #, fuzzy, kde-format 13572 #| msgid "Saturday" 13573 msgid "Saturation:" 13574 msgstr "شنبه" 13575 13576 #: kdeui/kcolordialog.cpp:1098 13577 #, kde-format 13578 msgctxt "This is the V of HSV" 13579 msgid "Value:" 13580 msgstr "مقدار:" 13581 13582 #: kdeui/kcolordialog.cpp:1111 13583 #, kde-format 13584 msgid "Red:" 13585 msgstr "قرمز:" 13586 13587 #: kdeui/kcolordialog.cpp:1121 13588 #, kde-format 13589 msgid "Green:" 13590 msgstr "سبز:" 13591 13592 #: kdeui/kcolordialog.cpp:1131 13593 #, kde-format 13594 msgid "Blue:" 13595 msgstr "آبی:" 13596 13597 #: kdeui/kcolordialog.cpp:1152 13598 #, kde-format 13599 msgid "Alpha:" 13600 msgstr "آلفا:" 13601 13602 #: kdeui/kcolordialog.cpp:1206 13603 #, kde-format 13604 msgid "&Add to Custom Colors" 13605 msgstr "&افزودن به رنگهای سفارشی" 13606 13607 #: kdeui/kcolordialog.cpp:1234 13608 #, kde-format 13609 msgid "Name:" 13610 msgstr "نام:" 13611 13612 # HTML: 13613 #: kdeui/kcolordialog.cpp:1241 13614 #, kde-format 13615 msgid "HTML:" 13616 msgstr "HTML:" 13617 13618 #: kdeui/kcolordialog.cpp:1328 13619 #, kde-format 13620 msgid "Default color" 13621 msgstr "رنگ پیشفرض" 13622 13623 #: kdeui/kcolordialog.cpp:1393 13624 #, kde-format 13625 msgid "-default-" 13626 msgstr "-پیشفرض-" 13627 13628 #: kdeui/kcolordialog.cpp:1668 13629 #, kde-format 13630 msgid "-unnamed-" 13631 msgstr "-بینام-" 13632 13633 #: kdeui/kdeprintdialog.cpp:40 13634 #, kde-format 13635 msgctxt "@title:window" 13636 msgid "Print" 13637 msgstr "چاپ" 13638 13639 #: kdeui/kdialog.cpp:271 13640 #, kde-format 13641 msgid "&Try" 13642 msgstr "&سعی شود" 13643 13644 #: kdeui/kdialog.cpp:484 13645 #, kde-format 13646 msgid "modified" 13647 msgstr "تغییریافته" 13648 13649 #: kdeui/kdialog.cpp:495 13650 #, kde-format 13651 msgctxt "Document/application separator in titlebar" 13652 msgid " – " 13653 msgstr " – " 13654 13655 #: kdeui/kdialog.cpp:896 13656 #, kde-format 13657 msgid "&Details" 13658 msgstr "&جزئیات" 13659 13660 #: kdeui/kdialog.cpp:1054 13661 #, kde-format 13662 msgid "Get help..." 13663 msgstr "کمک گرفتن..." 13664 13665 #: kdeui/keditlistbox.cpp:324 13666 #, kde-format 13667 msgid "&Add" 13668 msgstr "&افزودن" 13669 13670 #: kdeui/keditlistbox.cpp:336 13671 #, kde-format 13672 msgid "&Remove" 13673 msgstr "&حذف" 13674 13675 #: kdeui/keditlistbox.cpp:348 13676 #, kde-format 13677 msgid "Move &Up" 13678 msgstr "حرکت &به بالا" 13679 13680 #: kdeui/keditlistbox.cpp:353 13681 #, kde-format 13682 msgid "Move &Down" 13683 msgstr "حرکت &به پایین" 13684 13685 #. i18n: A shorter version of the alphabet test phrase translated in 13686 #. another message. It is displayed in the dropdown list of font previews 13687 #. (the font selection combo box), so keep it under the length equivalent 13688 #. to 60 or so proportional Latin characters. 13689 #: kdeui/kfontcombobox.cpp:48 13690 #, kde-format 13691 msgctxt "short" 13692 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13693 msgstr "" 13694 "جذبه آسمان ابری ظلمانی را که با غرش و فریادش پرده حریر قلبم را، و با طنازی " 13695 "ژالههایش خرمن گلهای صنوبر و ثعلب را میلرزاند، و چشمم را ضیایی، دوست دارم." 13696 13697 #. i18n: Integer which indicates the script you used in the sample text 13698 #. for font previews in your language. For the possible values, see 13699 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13700 #. If the sample text contains several scripts, their IDs can be given 13701 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13702 #: kdeui/kfontcombobox.cpp:119 13703 #, kde-format 13704 msgctxt "Numeric IDs of scripts for font previews" 13705 msgid "1" 13706 msgstr "1" 13707 13708 #: kdeui/kfontdialog.cpp:51 13709 #, kde-format 13710 msgid "Select Font" 13711 msgstr "برگزیدن قلم" 13712 13713 #: kdeui/kprintpreview.cpp:118 13714 #, kde-format 13715 msgid "Could not load print preview part" 13716 msgstr "ناتوان از بارگذاری جزء پیشنمایش چاپ" 13717 13718 #: kdeui/kprintpreview.cpp:135 13719 #, kde-format 13720 msgid "Print Preview" 13721 msgstr "پیشنمایش چاپ" 13722 13723 #: kdeui/ksystemtrayicon.cpp:153 13724 #, kde-format 13725 msgid "Minimize" 13726 msgstr "کمینهسازی" 13727 13728 #: kdeui/ksystemtrayicon.cpp:205 13729 #, kde-format 13730 msgid "&Minimize" 13731 msgstr "&کمینهسازی" 13732 13733 #: kdeui/ksystemtrayicon.cpp:207 13734 #, kde-format 13735 msgid "&Restore" 13736 msgstr "&بازگرداندن" 13737 13738 #: kdeui/ksystemtrayicon.cpp:226 13739 #, kde-format 13740 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13741 msgstr "<qt> مطمئن هستید که میخواهید از <b>%1</b> خارج شوید؟ </qt>" 13742 13743 #: kdeui/ksystemtrayicon.cpp:229 13744 #, kde-format 13745 msgid "Confirm Quit From System Tray" 13746 msgstr "تأیید خروج از سینی سیستم" 13747 13748 #: kdeui/kundostack.cpp:47 13749 #, kde-format 13750 msgid "Redo" 13751 msgstr "از نو" 13752 13753 #: kdeui/kundostack.cpp:66 13754 #, kde-format 13755 msgid "Undo" 13756 msgstr "واگرد" 13757 13758 #: kdeui/kuniqueapplication.cpp:79 13759 #, kde-format 13760 msgid "Do not run in the background." 13761 msgstr "در زمینه اجرا نشود." 13762 13763 #: kdeui/kuniqueapplication.cpp:81 13764 #, kde-format 13765 msgid "Internally added if launched from Finder" 13766 msgstr "اگر از یابنده راهاندازی شود، به طور داخلی اضافه میشود" 13767 13768 #: kio/kcommentwidget.cpp:68 13769 #, fuzzy, kde-format 13770 #| msgid "Add Entry..." 13771 msgctxt "@label" 13772 msgid "Add Comment..." 13773 msgstr "افزودن توضیح" 13774 13775 #: kio/kcommentwidget.cpp:74 13776 #, kde-format 13777 msgctxt "@label" 13778 msgid "Change..." 13779 msgstr "تغییر..." 13780 13781 #: kio/kcommentwidget.cpp:128 13782 #, fuzzy, kde-format 13783 #| msgid "Comment" 13784 msgctxt "@title:window" 13785 msgid "Change Comment" 13786 msgstr "توضیح" 13787 13788 #: kio/kcommentwidget.cpp:129 13789 #, kde-format 13790 msgctxt "@title:window" 13791 msgid "Add Comment" 13792 msgstr "افزودن توضیح" 13793 13794 #: kio/kdevicelistmodel.cpp:115 13795 #, kde-format 13796 msgid "Device name" 13797 msgstr "نام دستگاه" 13798 13799 #: kio/kdirselectdialog.cpp:136 13800 #, kde-format 13801 msgctxt "folder name" 13802 msgid "New Folder" 13803 msgstr "پوشه جدید" 13804 13805 #: kio/kdirselectdialog.cpp:141 13806 #, fuzzy, kde-format 13807 msgctxt "@title:window" 13808 msgid "New Folder" 13809 msgstr "پوشه جدید" 13810 13811 #: kio/kdirselectdialog.cpp:142 13812 #, fuzzy, kde-format 13813 msgctxt "@label:textbox" 13814 msgid "" 13815 "Create new folder in:\n" 13816 "%1" 13817 msgstr "" 13818 "ایجاد پوشه جدید در:\n" 13819 "%1" 13820 13821 #: kio/kdirselectdialog.cpp:172 13822 #, kde-format 13823 msgid "A file or folder named %1 already exists." 13824 msgstr "پرونده یا پوشه %1 از قبل وجود دارد." 13825 13826 #: kio/kdirselectdialog.cpp:175 13827 #, kde-format 13828 msgid "You do not have permission to create that folder." 13829 msgstr "مجوز ایجاد آن پوشه را ندارید." 13830 13831 #: kio/kdirselectdialog.cpp:290 13832 #, fuzzy, kde-format 13833 msgctxt "@title:window" 13834 msgid "Select Folder" 13835 msgstr "برگزیدن پوشه" 13836 13837 #: kio/kdirselectdialog.cpp:299 13838 #, fuzzy, kde-format 13839 msgctxt "@action:button" 13840 msgid "New Folder..." 13841 msgstr "پوشه جدید..." 13842 13843 #: kio/kdirselectdialog.cpp:345 13844 #, fuzzy, kde-format 13845 msgctxt "@action:inmenu" 13846 msgid "New Folder..." 13847 msgstr "پوشه جدید..." 13848 13849 #: kio/kdirselectdialog.cpp:352 13850 #, fuzzy, kde-format 13851 #| msgid "Move to Trash" 13852 msgctxt "@action:inmenu" 13853 msgid "Move to Trash" 13854 msgstr "حرکت به زباله" 13855 13856 #: kio/kdirselectdialog.cpp:359 13857 #, kde-format 13858 msgctxt "@action:inmenu" 13859 msgid "Delete" 13860 msgstr "حذف" 13861 13862 #: kio/kdirselectdialog.cpp:368 13863 #, fuzzy, kde-format 13864 msgctxt "@option:check" 13865 msgid "Show Hidden Folders" 13866 msgstr "نمایش پوشههای مخفی" 13867 13868 #: kio/kdirselectdialog.cpp:375 13869 #, kde-format 13870 msgctxt "@action:inmenu" 13871 msgid "Properties" 13872 msgstr "ویژگیها" 13873 13874 #: kio/kfiledialog.cpp:132 13875 #, fuzzy, kde-format 13876 #| msgid "*|All Files" 13877 msgid "*|All files" 13878 msgstr "*| تمام پروندهها" 13879 13880 #: kio/kfiledialog.cpp:332 13881 #, kde-format 13882 msgid "All Supported Files" 13883 msgstr "همه پروندههای پشتیبانیشده" 13884 13885 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13886 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13887 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13888 #, kde-format 13889 msgid "Open" 13890 msgstr "باز" 13891 13892 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13893 #: kio/kfiledialog.cpp:838 13894 #, kde-format 13895 msgid "Save As" 13896 msgstr "ذخیره به عنوان" 13897 13898 #: kio/kfilemetadataprovider.cpp:245 13899 #, fuzzy, kde-format 13900 #| msgctxt "Items in a folder" 13901 #| msgid "1 item" 13902 #| msgid_plural "%1 items" 13903 msgctxt "@item:intable" 13904 msgid "%1 item" 13905 msgid_plural "%1 items" 13906 msgstr[0] "%1 فقره" 13907 msgstr[1] "" 13908 13909 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13910 #, fuzzy, kde-format 13911 msgctxt "@label" 13912 msgid "Comment" 13913 msgstr "توضیح" 13914 13915 #: kio/kfilemetadataprovider.cpp:447 13916 #, fuzzy, kde-format 13917 #| msgctxt "@title:column" 13918 #| msgid "Modified" 13919 msgctxt "@label" 13920 msgid "Modified" 13921 msgstr "تغییریافته:" 13922 13923 #: kio/kfilemetadataprovider.cpp:448 13924 #, kde-format 13925 msgctxt "@label" 13926 msgid "Owner" 13927 msgstr "مالک" 13928 13929 #: kio/kfilemetadataprovider.cpp:449 13930 #, kde-format 13931 msgctxt "@label" 13932 msgid "Permissions" 13933 msgstr "مجوزها" 13934 13935 #: kio/kfilemetadataprovider.cpp:450 13936 #, kde-format 13937 msgctxt "@label" 13938 msgid "Rating" 13939 msgstr "درجهبندی" 13940 13941 #: kio/kfilemetadataprovider.cpp:451 13942 #, kde-format 13943 msgctxt "@label" 13944 msgid "Size" 13945 msgstr "اندازه" 13946 13947 #: kio/kfilemetadataprovider.cpp:452 13948 #, kde-format 13949 msgctxt "@label" 13950 msgid "Tags" 13951 msgstr "برچسبها" 13952 13953 #: kio/kfilemetadataprovider.cpp:453 13954 #, fuzzy, kde-format 13955 #| msgid "Size:" 13956 msgctxt "@label" 13957 msgid "Total Size" 13958 msgstr "اندازه:" 13959 13960 #: kio/kfilemetadataprovider.cpp:454 13961 #, kde-format 13962 msgctxt "@label" 13963 msgid "Type" 13964 msgstr "نوع" 13965 13966 #: kio/kfilemetadatareaderprocess.cpp:234 13967 #, kde-format 13968 msgid "KFileMetaDataReader" 13969 msgstr "" 13970 13971 #: kio/kfilemetadatareaderprocess.cpp:236 13972 #, kde-format 13973 msgid "KFileMetaDataReader can be used to read metadata from a file" 13974 msgstr "" 13975 13976 #: kio/kfilemetadatareaderprocess.cpp:238 13977 #, fuzzy, kde-format 13978 msgid "(C) 2011, Peter Penz" 13979 msgstr "(C) 2006-2011 Peter Penz" 13980 13981 #: kio/kfilemetadatareaderprocess.cpp:239 13982 #, kde-format 13983 msgid "Peter Penz" 13984 msgstr "Peter Penz" 13985 13986 #: kio/kfilemetadatareaderprocess.cpp:239 13987 #, kde-format 13988 msgid "Current maintainer" 13989 msgstr "نگهدارنده جاری" 13990 13991 #: kio/kfilemetadatareaderprocess.cpp:244 13992 #, kde-format 13993 msgid "Only the meta data that is part of the file is read" 13994 msgstr "" 13995 13996 #: kio/kfilemetadatareaderprocess.cpp:245 13997 #, kde-format 13998 msgid "List of URLs where the meta-data should be read from" 13999 msgstr "" 14000 14001 #: kio/kfilemetainfowidget.cpp:161 14002 #, kde-format 14003 msgid "<Error>" 14004 msgstr "<خطا>" 14005 14006 #: kio/kfiletreeview.cpp:192 14007 #, kde-format 14008 msgid "Show Hidden Folders" 14009 msgstr "نمایش پوشههای مخفی" 14010 14011 #: kio/kimageio.cpp:46 14012 #, kde-format 14013 msgid "All Pictures" 14014 msgstr "تمام عکسها" 14015 14016 #: kio/kmetaprops.cpp:57 14017 #, kde-format 14018 msgctxt "@title:window" 14019 msgid "Configure Shown Data" 14020 msgstr "پیکربندی اطلاعات نمایش داده شده" 14021 14022 #: kio/kmetaprops.cpp:60 14023 #, kde-format 14024 msgctxt "@label::textbox" 14025 msgid "Select which data should be shown:" 14026 msgstr "انتخاب کنید که چه اطلاعاتی باید نمایش داده شود:" 14027 14028 #: kio/kmetaprops.cpp:123 14029 #, kde-format 14030 msgctxt "@action:button" 14031 msgid "Configure..." 14032 msgstr "پیکربندی..." 14033 14034 #: kio/kmetaprops.cpp:133 14035 #, kde-format 14036 msgctxt "@title:tab" 14037 msgid "Information" 14038 msgstr "اطلاعات" 14039 14040 #: kio/knfotranslator.cpp:40 14041 #, fuzzy, kde-format 14042 #| msgid "Created:" 14043 msgctxt "@label creation date" 14044 msgid "Created" 14045 msgstr "ایجادشده:" 14046 14047 #: kio/knfotranslator.cpp:41 14048 #, kde-format 14049 msgctxt "@label file content size" 14050 msgid "Size" 14051 msgstr "اندازه" 14052 14053 #: kio/knfotranslator.cpp:42 14054 #, kde-format 14055 msgctxt "@label file depends from" 14056 msgid "Depends" 14057 msgstr "" 14058 14059 #: kio/knfotranslator.cpp:43 14060 #, kde-format 14061 msgctxt "@label" 14062 msgid "Description" 14063 msgstr "توصیف" 14064 14065 #: kio/knfotranslator.cpp:44 14066 #, fuzzy, kde-format 14067 #| msgid "&General" 14068 msgctxt "@label Software used to generate content" 14069 msgid "Generator" 14070 msgstr "&عمومی" 14071 14072 #: kio/knfotranslator.cpp:45 14073 #, kde-format 14074 msgctxt "" 14075 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 14076 msgid "Has Part" 14077 msgstr "" 14078 14079 #: kio/knfotranslator.cpp:46 14080 #, kde-format 14081 msgctxt "" 14082 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 14083 "nie#hasLogicalPart" 14084 msgid "Has Logical Part" 14085 msgstr "" 14086 14087 #: kio/knfotranslator.cpp:47 14088 #, fuzzy, kde-format 14089 #| msgid "Parent Folder" 14090 msgctxt "@label parent directory" 14091 msgid "Part of" 14092 msgstr "پوشه پدر" 14093 14094 #: kio/knfotranslator.cpp:48 14095 #, kde-format 14096 msgctxt "@label" 14097 msgid "Keyword" 14098 msgstr "کلیدواژه" 14099 14100 #: kio/knfotranslator.cpp:49 14101 #, fuzzy, kde-format 14102 #| msgctxt "@title:column" 14103 #| msgid "Modified" 14104 msgctxt "@label modified date of file" 14105 msgid "Modified" 14106 msgstr "تغییریافته:" 14107 14108 #: kio/knfotranslator.cpp:50 14109 #, kde-format 14110 msgctxt "@label" 14111 msgid "MIME Type" 14112 msgstr "نوع مایم" 14113 14114 #: kio/knfotranslator.cpp:51 14115 #, kde-format 14116 msgctxt "@label" 14117 msgid "Content" 14118 msgstr "محتوا" 14119 14120 #: kio/knfotranslator.cpp:52 14121 #, fuzzy, kde-format 14122 #| msgid "created on %1" 14123 msgctxt "@label" 14124 msgid "Related To" 14125 msgstr "ایجادشده روی %1" 14126 14127 #: kio/knfotranslator.cpp:53 14128 #, kde-format 14129 msgctxt "@label" 14130 msgid "Subject" 14131 msgstr "موضوع" 14132 14133 #: kio/knfotranslator.cpp:54 14134 #, kde-format 14135 msgctxt "@label music title" 14136 msgid "Title" 14137 msgstr "عنوان" 14138 14139 #: kio/knfotranslator.cpp:55 14140 #, kde-format 14141 msgctxt "@label file URL" 14142 msgid "File Location" 14143 msgstr "" 14144 14145 #: kio/knfotranslator.cpp:56 14146 #, fuzzy, kde-format 14147 #| msgid "Created:" 14148 msgctxt "@label" 14149 msgid "Creator" 14150 msgstr "ایجادکننده:" 14151 14152 #: kio/knfotranslator.cpp:57 14153 #, kde-format 14154 msgctxt "@label" 14155 msgid "Average Bitrate" 14156 msgstr "" 14157 14158 #: kio/knfotranslator.cpp:58 14159 #, kde-format 14160 msgctxt "@label" 14161 msgid "Channels" 14162 msgstr "مجراها" 14163 14164 #: kio/knfotranslator.cpp:59 14165 #, fuzzy, kde-format 14166 #| msgid "Categories" 14167 msgctxt "@label number of characters" 14168 msgid "Characters" 14169 msgstr "دستهها" 14170 14171 #: kio/knfotranslator.cpp:60 14172 #, kde-format 14173 msgctxt "@label" 14174 msgid "Codec" 14175 msgstr "کُدک" 14176 14177 #: kio/knfotranslator.cpp:61 14178 #, kde-format 14179 msgctxt "@label" 14180 msgid "Color Depth" 14181 msgstr "عمق رنگ" 14182 14183 #: kio/knfotranslator.cpp:62 14184 #, fuzzy, kde-format 14185 #| msgid "Destination" 14186 msgctxt "@label" 14187 msgid "Duration" 14188 msgstr "دوام: %1" 14189 14190 #: kio/knfotranslator.cpp:63 14191 #, kde-format 14192 msgctxt "@label" 14193 msgid "Filename" 14194 msgstr "نام پرونده" 14195 14196 #: kio/knfotranslator.cpp:64 14197 #, kde-format 14198 msgctxt "@label" 14199 msgid "Hash" 14200 msgstr "" 14201 14202 #: kio/knfotranslator.cpp:65 14203 #, kde-format 14204 msgctxt "@label" 14205 msgid "Height" 14206 msgstr "ارتفاع" 14207 14208 #: kio/knfotranslator.cpp:66 14209 #, kde-format 14210 msgctxt "@label" 14211 msgid "Interlace Mode" 14212 msgstr "" 14213 14214 #: kio/knfotranslator.cpp:67 14215 #, kde-format 14216 msgctxt "@label number of lines" 14217 msgid "Lines" 14218 msgstr "خطوط" 14219 14220 #: kio/knfotranslator.cpp:68 14221 #, kde-format 14222 msgctxt "@label" 14223 msgid "Programming Language" 14224 msgstr "" 14225 14226 #: kio/knfotranslator.cpp:69 14227 #, kde-format 14228 msgctxt "@label" 14229 msgid "Sample Rate" 14230 msgstr "" 14231 14232 #: kio/knfotranslator.cpp:70 14233 #, kde-format 14234 msgctxt "@label" 14235 msgid "Width" 14236 msgstr "عرض" 14237 14238 #: kio/knfotranslator.cpp:71 14239 #, kde-format 14240 msgctxt "@label number of words" 14241 msgid "Words" 14242 msgstr "" 14243 14244 #: kio/knfotranslator.cpp:72 14245 #, kde-format 14246 msgctxt "@label EXIF aperture value" 14247 msgid "Aperture" 14248 msgstr "روزنه" 14249 14250 #: kio/knfotranslator.cpp:73 14251 #, kde-format 14252 msgctxt "@label EXIF" 14253 msgid "Exposure Bias Value" 14254 msgstr "" 14255 14256 #: kio/knfotranslator.cpp:74 14257 #, fuzzy, kde-format 14258 #| msgid "Exposure:" 14259 msgctxt "@label EXIF" 14260 msgid "Exposure Time" 14261 msgstr "زمان آشکارسازی" 14262 14263 #: kio/knfotranslator.cpp:75 14264 #, kde-format 14265 msgctxt "@label EXIF" 14266 msgid "Flash" 14267 msgstr "درخش" 14268 14269 #: kio/knfotranslator.cpp:76 14270 #, kde-format 14271 msgctxt "@label EXIF" 14272 msgid "Focal Length" 14273 msgstr "" 14274 14275 #: kio/knfotranslator.cpp:77 14276 #, kde-format 14277 msgctxt "@label EXIF" 14278 msgid "Focal Length 35 mm" 14279 msgstr "" 14280 14281 #: kio/knfotranslator.cpp:78 14282 #, kde-format 14283 msgctxt "@label EXIF" 14284 msgid "ISO Speed Ratings" 14285 msgstr "" 14286 14287 #: kio/knfotranslator.cpp:79 14288 #, fuzzy, kde-format 14289 #| msgid "Mask" 14290 msgctxt "@label EXIF" 14291 msgid "Make" 14292 msgstr "نقاب" 14293 14294 #: kio/knfotranslator.cpp:80 14295 #, kde-format 14296 msgctxt "@label EXIF" 14297 msgid "Metering Mode" 14298 msgstr "" 14299 14300 #: kio/knfotranslator.cpp:81 14301 #, kde-format 14302 msgctxt "@label EXIF" 14303 msgid "Model" 14304 msgstr "مدل" 14305 14306 #: kio/knfotranslator.cpp:82 14307 #, kde-format 14308 msgctxt "@label EXIF" 14309 msgid "Orientation" 14310 msgstr "جهت" 14311 14312 #: kio/knfotranslator.cpp:83 14313 #, kde-format 14314 msgctxt "@label EXIF" 14315 msgid "White Balance" 14316 msgstr "توازن سفید" 14317 14318 #: kio/knfotranslator.cpp:84 14319 #, fuzzy, kde-format 14320 #| msgid "Directory" 14321 msgctxt "@label video director" 14322 msgid "Director" 14323 msgstr "فهرست راهنما" 14324 14325 #: kio/knfotranslator.cpp:85 14326 #, fuzzy, kde-format 14327 #| msgid "&General" 14328 msgctxt "@label music genre" 14329 msgid "Genre" 14330 msgstr "&عمومی" 14331 14332 #: kio/knfotranslator.cpp:86 14333 #, kde-format 14334 msgctxt "@label music album" 14335 msgid "Album" 14336 msgstr "آلبوم" 14337 14338 #: kio/knfotranslator.cpp:87 14339 #, kde-format 14340 msgctxt "@label" 14341 msgid "Performer" 14342 msgstr "" 14343 14344 #: kio/knfotranslator.cpp:88 14345 #, fuzzy, kde-format 14346 #| msgid "&Release '%1'" 14347 msgctxt "@label" 14348 msgid "Release Date" 14349 msgstr "&رهاکردن '%1'" 14350 14351 #: kio/knfotranslator.cpp:89 14352 #, kde-format 14353 msgctxt "@label music track number" 14354 msgid "Track" 14355 msgstr "شیار" 14356 14357 #: kio/knfotranslator.cpp:90 14358 #, fuzzy, kde-format 14359 #| msgid "URL Resource Invalid" 14360 msgctxt "@label resource created time" 14361 msgid "Resource Created" 14362 msgstr "منبع نشانی وب نامعتبر" 14363 14364 #: kio/knfotranslator.cpp:91 14365 #, fuzzy, kde-format 14366 #| msgid "Source" 14367 msgctxt "@label" 14368 msgid "Sub Resource" 14369 msgstr "مبدأ" 14370 14371 #: kio/knfotranslator.cpp:92 14372 #, fuzzy, kde-format 14373 #| msgctxt "@title:column" 14374 #| msgid "Modified" 14375 msgctxt "@label resource last modified" 14376 msgid "Resource Modified" 14377 msgstr "تغییریافته" 14378 14379 #: kio/knfotranslator.cpp:93 14380 #, fuzzy, kde-format 14381 #| msgctxt "@title job" 14382 #| msgid "Stating" 14383 msgctxt "@label" 14384 msgid "Numeric Rating" 14385 msgstr "حالت" 14386 14387 #: kio/knfotranslator.cpp:94 14388 #, kde-format 14389 msgctxt "@label" 14390 msgid "Copied From" 14391 msgstr "" 14392 14393 #: kio/knfotranslator.cpp:95 14394 #, kde-format 14395 msgctxt "@label" 14396 msgid "First Usage" 14397 msgstr "" 14398 14399 #: kio/knfotranslator.cpp:96 14400 #, kde-format 14401 msgctxt "@label" 14402 msgid "Last Usage" 14403 msgstr "" 14404 14405 #: kio/knfotranslator.cpp:97 14406 #, fuzzy, kde-format 14407 #| msgid "Comment" 14408 msgctxt "@label" 14409 msgid "Usage Count" 14410 msgstr "توضیح" 14411 14412 #: kio/knfotranslator.cpp:98 14413 #, kde-format 14414 msgctxt "@label" 14415 msgid "Unix File Group" 14416 msgstr "" 14417 14418 #: kio/knfotranslator.cpp:99 14419 #, kde-format 14420 msgctxt "@label" 14421 msgid "Unix File Mode" 14422 msgstr "" 14423 14424 #: kio/knfotranslator.cpp:100 14425 #, fuzzy, kde-format 14426 #| msgid "Open file dialog" 14427 msgctxt "@label" 14428 msgid "Unix File Owner" 14429 msgstr "باز کردن محاوره پرونده" 14430 14431 #: kio/knfotranslator.cpp:101 14432 #, kde-format 14433 msgctxt "@label file type" 14434 msgid "Type" 14435 msgstr "نوع" 14436 14437 #: kio/knfotranslator.cpp:102 14438 #, kde-format 14439 msgctxt "@label Number of fuzzy translations" 14440 msgid "Fuzzy Translations" 14441 msgstr "" 14442 14443 #: kio/knfotranslator.cpp:103 14444 #, kde-format 14445 msgctxt "@label Name of last translator" 14446 msgid "Last Translator" 14447 msgstr "" 14448 14449 #: kio/knfotranslator.cpp:104 14450 #, kde-format 14451 msgctxt "@label Number of obsolete translations" 14452 msgid "Obsolete Translations" 14453 msgstr "" 14454 14455 #: kio/knfotranslator.cpp:105 14456 #, kde-format 14457 msgctxt "@label" 14458 msgid "Translation Source Date" 14459 msgstr "" 14460 14461 #: kio/knfotranslator.cpp:106 14462 #, kde-format 14463 msgctxt "@label Number of total translations" 14464 msgid "Total Translations" 14465 msgstr "" 14466 14467 #: kio/knfotranslator.cpp:107 14468 #, fuzzy, kde-format 14469 #| msgid "Trusted:" 14470 msgctxt "@label Number of translated strings" 14471 msgid "Translated" 14472 msgstr "معتمد:" 14473 14474 #: kio/knfotranslator.cpp:108 14475 #, kde-format 14476 msgctxt "@label" 14477 msgid "Translation Date" 14478 msgstr "" 14479 14480 #: kio/knfotranslator.cpp:109 14481 #, kde-format 14482 msgctxt "@label Number of untranslated strings" 14483 msgid "Untranslated" 14484 msgstr "" 14485 14486 #: kio/kpreviewprops.cpp:51 14487 #, kde-format 14488 msgid "P&review" 14489 msgstr "&پیشنمایش" 14490 14491 #: kio/kscan.cpp:49 14492 #, kde-format 14493 msgid "Acquire Image" 14494 msgstr "به دست آوردن تصویر" 14495 14496 #: kio/kscan.cpp:97 14497 #, kde-format 14498 msgid "OCR Image" 14499 msgstr "تصویر OCR" 14500 14501 #: kio/netaccess.cpp:102 14502 #, kde-format 14503 msgid "File '%1' is not readable" 14504 msgstr "پرونده »%1« خوانا نیست" 14505 14506 #: kio/netaccess.cpp:435 14507 #, kde-format 14508 msgid "ERROR: Unknown protocol '%1'" 14509 msgstr "خطا: قرارداد ناشناخته »%1«" 14510 14511 #: kio/passworddialog.cpp:56 14512 #, kde-format 14513 msgid "Authorization Dialog" 14514 msgstr "محاوره اجازه" 14515 14516 #: kioslave/metainfo/metainfo.cpp:98 14517 #, kde-format 14518 msgid "No metainfo for %1" 14519 msgstr "جاینوشتررررررررااطلاعاتی برای %1 وجود ندارد" 14520 14521 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14522 #: kssl/kcm/cacertificates.ui:24 14523 #, fuzzy, kde-format 14524 #| msgid "Organization:" 14525 msgid "Organization / Common Name" 14526 msgstr "سازمان:" 14527 14528 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14529 #: kssl/kcm/cacertificates.ui:29 14530 #, kde-format 14531 msgid "Organizational Unit" 14532 msgstr "واحد سازمانی" 14533 14534 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14535 #: kssl/kcm/cacertificates.ui:42 14536 #, fuzzy, kde-format 14537 msgid "Display..." 14538 msgstr "نمایش" 14539 14540 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14541 #: kssl/kcm/cacertificates.ui:68 14542 #, kde-format 14543 msgid "Disable" 14544 msgstr "غیرفعال" 14545 14546 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14547 #: kssl/kcm/cacertificates.ui:78 14548 #, fuzzy, kde-format 14549 #| msgid "Emblems" 14550 msgid "Enable" 14551 msgstr "فعالسازی" 14552 14553 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14554 #: kssl/kcm/cacertificates.ui:104 14555 #, kde-format 14556 msgid "Remove" 14557 msgstr "حذف" 14558 14559 #. i18n: ectx: property (text), widget (QPushButton, add) 14560 #: kssl/kcm/cacertificates.ui:111 14561 #, kde-format 14562 msgid "Add..." 14563 msgstr "افزودن..." 14564 14565 #: kssl/kcm/cacertificatespage.cpp:140 14566 #, fuzzy, kde-format 14567 #| msgid "Send certificate" 14568 msgid "System certificates" 14569 msgstr "ارسال گواهینامه" 14570 14571 #: kssl/kcm/cacertificatespage.cpp:147 14572 #, fuzzy, kde-format 14573 #| msgid "Send certificate" 14574 msgid "User-added certificates" 14575 msgstr "ارسال گواهینامه" 14576 14577 #: kssl/kcm/cacertificatespage.cpp:302 14578 #, fuzzy, kde-format 14579 #| msgid "Certificate" 14580 msgid "Pick Certificates" 14581 msgstr "گواهینامه" 14582 14583 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14584 #: kssl/kcm/displaycert.ui:23 14585 #, fuzzy, kde-format 14586 #| msgid "Security Information" 14587 msgid "<b>Subject Information</b>" 14588 msgstr "اطلاعات امنیتی" 14589 14590 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14591 #: kssl/kcm/displaycert.ui:39 14592 #, fuzzy, kde-format 14593 #| msgid " <b>[Cross Domain]</b>" 14594 msgid "<b>Issuer Information</b>" 14595 msgstr " <b>[دامنه متقابل]</b>" 14596 14597 #. i18n: ectx: property (text), widget (QLabel, label) 14598 #: kssl/kcm/displaycert.ui:55 14599 #, fuzzy, kde-format 14600 #| msgid "<b>%1</b>" 14601 msgid "<b>Other</b>" 14602 msgstr "غیره" 14603 14604 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14605 #: kssl/kcm/displaycert.ui:64 14606 #, fuzzy, kde-format 14607 #| msgid "Validity period:" 14608 msgid "Validity period" 14609 msgstr "دورهٔ اعتبار:" 14610 14611 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14612 #: kssl/kcm/displaycert.ui:78 14613 #, fuzzy, kde-format 14614 #| msgid "Serial Number:" 14615 msgid "Serial number" 14616 msgstr "شمارهٔ متوالی:" 14617 14618 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14619 #: kssl/kcm/displaycert.ui:92 14620 #, fuzzy, kde-format 14621 #| msgid "MD5 Digest:" 14622 msgid "MD5 digest" 14623 msgstr "چکیده MD5:" 14624 14625 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14626 #: kssl/kcm/displaycert.ui:106 14627 #, fuzzy, kde-format 14628 #| msgid "MD5 Digest:" 14629 msgid "SHA1 digest" 14630 msgstr "چکیدهٔ MD5:" 14631 14632 #: kssl/kcm/displaycertdialog.cpp:73 14633 #, fuzzy, kde-format 14634 #| msgid "%1 (%2)" 14635 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14636 msgid "%1 to %2" 14637 msgstr "به:" 14638 14639 #: kssl/kcm/kcmssl.cpp:37 14640 #, fuzzy, kde-format 14641 #| msgid "Reload configuration file" 14642 msgid "SSL Configuration Module" 14643 msgstr "بارگذاری مجدد پرونده پیکربندی" 14644 14645 #: kssl/kcm/kcmssl.cpp:39 14646 #, kde-format 14647 msgid "Copyright 2010 Andreas Hartmetz" 14648 msgstr "" 14649 14650 #: kssl/kcm/kcmssl.cpp:40 14651 #, kde-format 14652 msgid "Andreas Hartmetz" 14653 msgstr "" 14654 14655 #: kssl/kcm/kcmssl.cpp:52 14656 #, kde-format 14657 msgid "SSL Signers" 14658 msgstr "امضاکنندگان SSL" 14659 14660 #: kssl/ksslcertificate.cpp:202 14661 #, kde-format 14662 msgid "Signature Algorithm: " 14663 msgstr "الگوریتم امضا:" 14664 14665 #: kssl/ksslcertificate.cpp:203 14666 #, kde-format 14667 msgid "Unknown" 14668 msgstr "ناشناخته" 14669 14670 #: kssl/ksslcertificate.cpp:206 14671 #, kde-format 14672 msgid "Signature Contents:" 14673 msgstr "محتویات امضا:" 14674 14675 #: kssl/ksslcertificate.cpp:341 14676 #, kde-format 14677 msgctxt "Unknown" 14678 msgid "Unknown key algorithm" 14679 msgstr "الگوریتم کلید ناشناخته" 14680 14681 #: kssl/ksslcertificate.cpp:347 14682 #, kde-format 14683 msgid "Key type: RSA (%1 bit)" 14684 msgstr "نوع کلید: RSA (%1 بیت)" 14685 14686 #: kssl/ksslcertificate.cpp:349 14687 #, kde-format 14688 msgid "Modulus: " 14689 msgstr "پیمانهها:" 14690 14691 #: kssl/ksslcertificate.cpp:362 14692 #, kde-format 14693 msgid "Exponent: 0x" 14694 msgstr "نما: 0x" 14695 14696 #: kssl/ksslcertificate.cpp:374 14697 #, kde-format 14698 msgid "Key type: DSA (%1 bit)" 14699 msgstr "نوع کلید: )%1 بیت(" 14700 14701 #: kssl/ksslcertificate.cpp:376 14702 #, kde-format 14703 msgid "Prime: " 14704 msgstr "اولیه:" 14705 14706 #: kssl/ksslcertificate.cpp:389 14707 #, kde-format 14708 msgid "160 bit prime factor: " 14709 msgstr "عامل اولیه ۱۶۰ بیت:" 14710 14711 #: kssl/ksslcertificate.cpp:417 14712 #, kde-format 14713 msgid "Public key: " 14714 msgstr "کلید عمومی:" 14715 14716 #: kssl/ksslcertificate.cpp:1065 14717 #, kde-format 14718 msgid "The certificate is valid." 14719 msgstr "گواهینامه معتبر است." 14720 14721 #: kssl/ksslcertificate.cpp:1067 14722 #, kde-format 14723 msgid "" 14724 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14725 "Authority) certificate can not be found." 14726 msgstr "" 14727 14728 #: kssl/ksslcertificate.cpp:1069 14729 #, fuzzy, kde-format 14730 msgid "" 14731 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14732 "CA's (Certificate Authority) CRL can not be found." 14733 msgstr "" 14734 "پروندههای ریشه اعتبار امضای گواهینامه را نمیتوان یافت؛ بنابراین، گواهینامه " 14735 "وارسی نمیشود." 14736 14737 #: kssl/ksslcertificate.cpp:1071 14738 #, kde-format 14739 msgid "" 14740 "The decryption of the certificate's signature failed. This means it could " 14741 "not even be calculated as opposed to just not matching the expected result." 14742 msgstr "" 14743 14744 #: kssl/ksslcertificate.cpp:1073 14745 #, kde-format 14746 msgid "" 14747 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14748 "This means it could not even be calculated as opposed to just not matching " 14749 "the expected result." 14750 msgstr "" 14751 14752 #: kssl/ksslcertificate.cpp:1075 14753 #, kde-format 14754 msgid "" 14755 "The decoding of the public key of the issuer failed. This means that the " 14756 "CA's (Certificate Authority) certificate can not be used to verify the " 14757 "certificate you wanted to use." 14758 msgstr "" 14759 14760 #: kssl/ksslcertificate.cpp:1077 14761 #, fuzzy, kde-format 14762 msgid "" 14763 "The certificate's signature is invalid. This means that the certificate can " 14764 "not be verified." 14765 msgstr "" 14766 "پروندههای ریشه اعتبار امضای گواهینامه را نمیتوان یافت؛ بنابراین، گواهینامه " 14767 "وارسی نمیشود." 14768 14769 #: kssl/ksslcertificate.cpp:1079 14770 #, fuzzy, kde-format 14771 msgid "" 14772 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14773 "that the CRL can not be verified." 14774 msgstr "" 14775 "پروندههای ریشه اعتبار امضای گواهینامه را نمیتوان یافت؛ بنابراین، گواهینامه " 14776 "وارسی نمیشود." 14777 14778 #: kssl/ksslcertificate.cpp:1081 14779 #, fuzzy, kde-format 14780 msgid "The certificate is not valid, yet." 14781 msgstr "گواهینامه نامعتبر است." 14782 14783 #: kssl/ksslcertificate.cpp:1083 14784 #, fuzzy, kde-format 14785 msgid "The certificate is not valid, any more." 14786 msgstr "گواهینامه نامعتبر است." 14787 14788 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14789 #, fuzzy, kde-format 14790 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14791 msgstr "گواهینامه نامعتبر است." 14792 14793 #: kssl/ksslcertificate.cpp:1089 14794 #, kde-format 14795 msgid "The time format of the certificate's 'notBefore' field is invalid." 14796 msgstr "" 14797 14798 #: kssl/ksslcertificate.cpp:1091 14799 #, kde-format 14800 msgid "The time format of the certificate's 'notAfter' field is invalid." 14801 msgstr "" 14802 14803 #: kssl/ksslcertificate.cpp:1093 14804 #, fuzzy, kde-format 14805 msgid "" 14806 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14807 "field is invalid." 14808 msgstr "گواهینامه نامعتبر است." 14809 14810 #: kssl/ksslcertificate.cpp:1095 14811 #, fuzzy, kde-format 14812 msgid "" 14813 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14814 "field is invalid." 14815 msgstr "گواهینامه نامعتبر است." 14816 14817 #: kssl/ksslcertificate.cpp:1097 14818 #, kde-format 14819 msgid "The OpenSSL process ran out of memory." 14820 msgstr "" 14821 14822 #: kssl/ksslcertificate.cpp:1099 14823 #, kde-format 14824 msgid "" 14825 "The certificate is self-signed and not in the list of trusted certificates. " 14826 "If you want to accept this certificate, import it into the list of trusted " 14827 "certificates." 14828 msgstr "" 14829 14830 #: kssl/ksslcertificate.cpp:1102 14831 #, kde-format 14832 msgid "" 14833 "The certificate is self-signed. While the trust chain could be built up, the " 14834 "root CA's (Certificate Authority) certificate can not be found." 14835 msgstr "" 14836 14837 #: kssl/ksslcertificate.cpp:1104 14838 #, kde-format 14839 msgid "" 14840 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14841 "your trust chain is broken." 14842 msgstr "" 14843 14844 #: kssl/ksslcertificate.cpp:1106 14845 #, kde-format 14846 msgid "" 14847 "The certificate can not be verified as it is the only certificate in the " 14848 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14849 "to import it into the list of trusted certificates." 14850 msgstr "" 14851 14852 #: kssl/ksslcertificate.cpp:1108 14853 #, kde-format 14854 msgid "The certificate chain is longer than the maximum depth specified." 14855 msgstr "" 14856 14857 #: kssl/ksslcertificate.cpp:1111 14858 #, kde-format 14859 msgid "The certificate has been revoked." 14860 msgstr "گواهینامه لغو شده است." 14861 14862 #: kssl/ksslcertificate.cpp:1113 14863 #, fuzzy, kde-format 14864 msgid "The certificate's CA (Certificate Authority) is invalid." 14865 msgstr "گواهینامه نامعتبر است." 14866 14867 #: kssl/ksslcertificate.cpp:1115 14868 #, kde-format 14869 msgid "" 14870 "The length of the trust chain exceeded one of the CA's (Certificate " 14871 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14872 msgstr "" 14873 14874 #: kssl/ksslcertificate.cpp:1117 14875 #, kde-format 14876 msgid "" 14877 "The certificate has not been signed for the purpose you tried to use it for. " 14878 "This means the CA (Certificate Authority) does not allow this usage." 14879 msgstr "" 14880 14881 #: kssl/ksslcertificate.cpp:1120 14882 #, kde-format 14883 msgid "" 14884 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14885 "to use this certificate for." 14886 msgstr "" 14887 14888 #: kssl/ksslcertificate.cpp:1123 14889 #, kde-format 14890 msgid "" 14891 "The root CA (Certificate Authority) has been marked to be rejected for the " 14892 "purpose you tried to use it for." 14893 msgstr "" 14894 14895 #: kssl/ksslcertificate.cpp:1125 14896 #, fuzzy, kde-format 14897 msgid "" 14898 "The certificate's CA (Certificate Authority) does not match the CA name of " 14899 "the certificate." 14900 msgstr "" 14901 "نشانی اینترنتی میزبان %1 با آن نشانی که برایش گواهینامه صادر شد، مطابقت " 14902 "ندارد." 14903 14904 #: kssl/ksslcertificate.cpp:1127 14905 #, fuzzy, kde-format 14906 msgid "" 14907 "The CA (Certificate Authority) certificate's key ID does not match the key " 14908 "ID in the 'Issuer' section of the certificate you are trying to use." 14909 msgstr "" 14910 "نشانی اینترنتی میزبان %1 با آن نشانی که برایش گواهینامه صادر شد، مطابقت " 14911 "ندارد." 14912 14913 #: kssl/ksslcertificate.cpp:1129 14914 #, kde-format 14915 msgid "" 14916 "The CA (Certificate Authority) certificate's key ID and name do not match " 14917 "the key ID and name in the 'Issuer' section of the certificate you are " 14918 "trying to use." 14919 msgstr "" 14920 14921 #: kssl/ksslcertificate.cpp:1131 14922 #, kde-format 14923 msgid "" 14924 "The certificate's CA (Certificate Authority) is not allowed to sign " 14925 "certificates." 14926 msgstr "" 14927 14928 #: kssl/ksslcertificate.cpp:1133 14929 #, kde-format 14930 msgid "OpenSSL could not be verified." 14931 msgstr "" 14932 14933 #: kssl/ksslcertificate.cpp:1137 14934 #, kde-format 14935 msgid "" 14936 "The signature test for this certificate failed. This could mean that the " 14937 "signature of this certificate or any in its trust path are invalid, could " 14938 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14939 "verified. If you see this message, please let the author of the software you " 14940 "are using know that he or she should use the new, more specific error " 14941 "messages." 14942 msgstr "" 14943 14944 #: kssl/ksslcertificate.cpp:1139 14945 #, kde-format 14946 msgid "" 14947 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14948 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14949 "valid yet or not valid any more. If you see this message, please let the " 14950 "author of the software you are using know that he or she should use the new, " 14951 "more specific error messages." 14952 msgstr "" 14953 14954 #: kssl/ksslcertificate.cpp:1145 14955 #, kde-format 14956 msgid "" 14957 "Certificate signing authority root files could not be found so the " 14958 "certificate is not verified." 14959 msgstr "" 14960 "پروندههای ریشه اعتبار امضای گواهینامه را نمیتوان یافت؛ بنابراین، گواهینامه " 14961 "وارسی نمیشود." 14962 14963 #: kssl/ksslcertificate.cpp:1147 14964 #, kde-format 14965 msgid "SSL support was not found." 14966 msgstr "پشتیبانی SSL یافت نشد." 14967 14968 #: kssl/ksslcertificate.cpp:1149 14969 #, kde-format 14970 msgid "Private key test failed." 14971 msgstr "خرابی در آزمون کلید خصوصی." 14972 14973 #: kssl/ksslcertificate.cpp:1151 14974 #, kde-format 14975 msgid "The certificate has not been issued for this host." 14976 msgstr "برای این میزبان، گواهینامه صادر نشده است." 14977 14978 #: kssl/ksslcertificate.cpp:1153 14979 #, kde-format 14980 msgid "This certificate is not relevant." 14981 msgstr "این گواهینامه مناسب نیست." 14982 14983 #: kssl/ksslcertificate.cpp:1158 14984 #, kde-format 14985 msgid "The certificate is invalid." 14986 msgstr "گواهینامه نامعتبر است." 14987 14988 #: kssl/ksslutils.cpp:90 14989 #, kde-format 14990 msgid "GMT" 14991 msgstr "GMT" 14992 14993 #, fuzzy 14994 #~ msgctxt "color" 14995 #~ msgid "hot" 14996 #~ msgstr "سهشنبه" 14997 14998 #, fuzzy 14999 #~ msgctxt "color" 15000 #~ msgid "sea" 15001 #~ msgstr "مکث" 15002 15003 #, fuzzy 15004 #~ msgctxt "@item Calendar system" 15005 #~ msgid "Gregorian (Proleptic)" 15006 #~ msgstr "گریگوری" 15007 15008 #, fuzzy 15009 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 15010 #~ msgid "of Mes" 15011 #~ msgstr "مهر" 15012 15013 #, fuzzy 15014 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 15015 #~ msgid "of Ter" 15016 #~ msgstr "تیر" 15017 15018 #, fuzzy 15019 #~ msgctxt "Ethiopian month 1 - ShortName" 15020 #~ msgid "Mes" 15021 #~ msgstr "بله" 15022 15023 #, fuzzy 15024 #~ msgctxt "Ethiopian month 5 - LongName" 15025 #~ msgid "Ter" 15026 #~ msgstr "سهشنبه" 15027 15028 #, fuzzy 15029 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 15030 #~ msgid "Ham" 15031 #~ msgstr "قبل از ظهر" 15032 15033 #, fuzzy 15034 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 15035 #~ msgid "Arb" 15036 #~ msgstr "چهارشنبه" 15037 15038 #, fuzzy 15039 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 15040 #~ msgid "Rob" 15041 #~ msgstr "کار" 15042 15043 #, fuzzy 15044 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 15045 #~ msgid "Arb" 15046 #~ msgstr "چهارشنبه" 15047 15048 #~ msgctxt "of May long" 15049 #~ msgid "of May" 15050 #~ msgstr "مه" 15051 15052 #~ msgctxt "May long" 15053 #~ msgid "May" 15054 #~ msgstr "مه" 15055 15056 #~ msgid "R. Thaani" 15057 #~ msgstr "ربیعالثانی" 15058 15059 #~ msgid "J. Thaani" 15060 #~ msgstr "جمادیالثانی" 15061 15062 #~ msgid "Hijjah" 15063 #~ msgstr "حجه" 15064 15065 #~ msgctxt "of Tir long" 15066 #~ msgid "of Tir" 15067 #~ msgstr "تیر" 15068 15069 #~ msgctxt "of Dei long" 15070 #~ msgid "of Dei" 15071 #~ msgstr "دی" 15072 15073 #~ msgctxt "Tir long" 15074 #~ msgid "Tir" 15075 #~ msgstr "تیر" 15076 15077 #~ msgctxt "Dei long" 15078 #~ msgid "Dei" 15079 #~ msgstr "دی" 15080 15081 #~ msgctxt "Shanbe short" 15082 #~ msgid "shn" 15083 #~ msgstr "شنبه"