Warning, /frameworks/kdelibs4support/po/bn/kdelibs4support.po is written in an unsupported language. File is not indexed.
0001 # Bengali (Bangla) translation of kdelibs4. 0002 # Copyright (C) 2009, Free Software Foundation, Inc. 0003 # translation of kdelibs4.po to Bengali 0004 # Copyright (C) 2003, 2004, 2005, 2006, 2008 Free Software Foundation, Inc. 0005 # Deepayan Sarkar,,, <deepayan@stat.wisc.edu>, 2003. 0006 # Deepayan Sarkar <deepayan@bengalinux.org>, 2003, 2004, 2005. 0007 # Deepayan Sarkar <deepayan.sarkar@gmail.com>, 2006, 2008, 2009.. 0008 # Deepayan Sarkar <deepayan.sarkar@gmail.com>, 2009. 0009 msgid "" 0010 msgstr "" 0011 "Project-Id-Version: kdelibs4\n" 0012 "Report-Msgid-Bugs-To: https://bugs.kde.org\n" 0013 "POT-Creation-Date: 2023-11-05 12:24+0000\n" 0014 "PO-Revision-Date: 2009-01-05 01:16-0800\n" 0015 "Last-Translator: Deepayan Sarkar <deepayan.sarkar@gmail.com>\n" 0016 "Language-Team: en_US <kde-translation@bengalinux.org>\n" 0017 "Language: bn\n" 0018 "MIME-Version: 1.0\n" 0019 "Content-Type: text/plain; charset=UTF-8\n" 0020 "Content-Transfer-Encoding: 8bit\n" 0021 "Plural-Forms: nplurals=2; plural=n != 1;\n" 0022 "X-Generator: Lokalize 0.2\n" 0023 0024 #, kde-format 0025 msgctxt "NAME OF TRANSLATORS" 0026 msgid "Your names" 0027 msgstr "তানিম আহমেদ" 0028 0029 #, kde-format 0030 msgctxt "EMAIL OF TRANSLATORS" 0031 msgid "Your emails" 0032 msgstr "taneem@bengalinux.org" 0033 0034 #, kde-format 0035 msgctxt "color" 0036 msgid "AliceBlue" 0037 msgstr "" 0038 0039 #, kde-format 0040 msgctxt "color" 0041 msgid "AntiqueWhite" 0042 msgstr "" 0043 0044 #, kde-format 0045 msgctxt "color" 0046 msgid "AntiqueWhite1" 0047 msgstr "" 0048 0049 #, kde-format 0050 msgctxt "color" 0051 msgid "AntiqueWhite2" 0052 msgstr "" 0053 0054 #, kde-format 0055 msgctxt "color" 0056 msgid "AntiqueWhite3" 0057 msgstr "" 0058 0059 #, kde-format 0060 msgctxt "color" 0061 msgid "AntiqueWhite4" 0062 msgstr "" 0063 0064 #, kde-format 0065 msgctxt "color" 0066 msgid "BlanchedAlmond" 0067 msgstr "" 0068 0069 #, kde-format 0070 msgctxt "color" 0071 msgid "BlueViolet" 0072 msgstr "" 0073 0074 #, kde-format 0075 msgctxt "color" 0076 msgid "CadetBlue" 0077 msgstr "" 0078 0079 #, kde-format 0080 msgctxt "color" 0081 msgid "CadetBlue1" 0082 msgstr "" 0083 0084 #, kde-format 0085 msgctxt "color" 0086 msgid "CadetBlue2" 0087 msgstr "" 0088 0089 #, kde-format 0090 msgctxt "color" 0091 msgid "CadetBlue3" 0092 msgstr "" 0093 0094 #, kde-format 0095 msgctxt "color" 0096 msgid "CadetBlue4" 0097 msgstr "" 0098 0099 #, kde-format 0100 msgctxt "color" 0101 msgid "CornflowerBlue" 0102 msgstr "" 0103 0104 #, kde-format 0105 msgctxt "color" 0106 msgid "DarkBlue" 0107 msgstr "" 0108 0109 #, kde-format 0110 msgctxt "color" 0111 msgid "DarkCyan" 0112 msgstr "" 0113 0114 #, kde-format 0115 msgctxt "color" 0116 msgid "DarkGoldenrod" 0117 msgstr "" 0118 0119 #, kde-format 0120 msgctxt "color" 0121 msgid "DarkGoldenrod1" 0122 msgstr "" 0123 0124 #, kde-format 0125 msgctxt "color" 0126 msgid "DarkGoldenrod2" 0127 msgstr "" 0128 0129 #, kde-format 0130 msgctxt "color" 0131 msgid "DarkGoldenrod3" 0132 msgstr "" 0133 0134 #, kde-format 0135 msgctxt "color" 0136 msgid "DarkGoldenrod4" 0137 msgstr "" 0138 0139 #, kde-format 0140 msgctxt "color" 0141 msgid "DarkGray" 0142 msgstr "" 0143 0144 #, kde-format 0145 msgctxt "color" 0146 msgid "DarkGreen" 0147 msgstr "" 0148 0149 #, kde-format 0150 msgctxt "color" 0151 msgid "DarkGrey" 0152 msgstr "" 0153 0154 #, kde-format 0155 msgctxt "color" 0156 msgid "DarkKhaki" 0157 msgstr "" 0158 0159 #, kde-format 0160 msgctxt "color" 0161 msgid "DarkMagenta" 0162 msgstr "" 0163 0164 #, kde-format 0165 msgctxt "color" 0166 msgid "DarkOliveGreen" 0167 msgstr "" 0168 0169 #, kde-format 0170 msgctxt "color" 0171 msgid "DarkOliveGreen1" 0172 msgstr "" 0173 0174 #, kde-format 0175 msgctxt "color" 0176 msgid "DarkOliveGreen2" 0177 msgstr "" 0178 0179 #, kde-format 0180 msgctxt "color" 0181 msgid "DarkOliveGreen3" 0182 msgstr "" 0183 0184 #, kde-format 0185 msgctxt "color" 0186 msgid "DarkOliveGreen4" 0187 msgstr "" 0188 0189 #, kde-format 0190 msgctxt "color" 0191 msgid "DarkOrange" 0192 msgstr "" 0193 0194 #, kde-format 0195 msgctxt "color" 0196 msgid "DarkOrange1" 0197 msgstr "" 0198 0199 #, kde-format 0200 msgctxt "color" 0201 msgid "DarkOrange2" 0202 msgstr "" 0203 0204 #, kde-format 0205 msgctxt "color" 0206 msgid "DarkOrange3" 0207 msgstr "" 0208 0209 #, kde-format 0210 msgctxt "color" 0211 msgid "DarkOrange4" 0212 msgstr "" 0213 0214 #, kde-format 0215 msgctxt "color" 0216 msgid "DarkOrchid" 0217 msgstr "" 0218 0219 #, kde-format 0220 msgctxt "color" 0221 msgid "DarkOrchid1" 0222 msgstr "" 0223 0224 #, kde-format 0225 msgctxt "color" 0226 msgid "DarkOrchid2" 0227 msgstr "" 0228 0229 #, kde-format 0230 msgctxt "color" 0231 msgid "DarkOrchid3" 0232 msgstr "" 0233 0234 #, kde-format 0235 msgctxt "color" 0236 msgid "DarkOrchid4" 0237 msgstr "" 0238 0239 #, kde-format 0240 msgctxt "color" 0241 msgid "DarkRed" 0242 msgstr "" 0243 0244 #, kde-format 0245 msgctxt "color" 0246 msgid "DarkSalmon" 0247 msgstr "" 0248 0249 #, kde-format 0250 msgctxt "color" 0251 msgid "DarkSeaGreen" 0252 msgstr "" 0253 0254 #, kde-format 0255 msgctxt "color" 0256 msgid "DarkSeaGreen1" 0257 msgstr "" 0258 0259 #, kde-format 0260 msgctxt "color" 0261 msgid "DarkSeaGreen2" 0262 msgstr "" 0263 0264 #, kde-format 0265 msgctxt "color" 0266 msgid "DarkSeaGreen3" 0267 msgstr "" 0268 0269 #, kde-format 0270 msgctxt "color" 0271 msgid "DarkSeaGreen4" 0272 msgstr "" 0273 0274 #, kde-format 0275 msgctxt "color" 0276 msgid "DarkSlateBlue" 0277 msgstr "" 0278 0279 #, kde-format 0280 msgctxt "color" 0281 msgid "DarkSlateGray" 0282 msgstr "" 0283 0284 #, kde-format 0285 msgctxt "color" 0286 msgid "DarkSlateGray1" 0287 msgstr "" 0288 0289 #, kde-format 0290 msgctxt "color" 0291 msgid "DarkSlateGray2" 0292 msgstr "" 0293 0294 #, kde-format 0295 msgctxt "color" 0296 msgid "DarkSlateGray3" 0297 msgstr "" 0298 0299 #, kde-format 0300 msgctxt "color" 0301 msgid "DarkSlateGray4" 0302 msgstr "" 0303 0304 #, kde-format 0305 msgctxt "color" 0306 msgid "DarkSlateGrey" 0307 msgstr "" 0308 0309 #, kde-format 0310 msgctxt "color" 0311 msgid "DarkTurquoise" 0312 msgstr "" 0313 0314 #, kde-format 0315 msgctxt "color" 0316 msgid "DarkViolet" 0317 msgstr "" 0318 0319 #, kde-format 0320 msgctxt "color" 0321 msgid "DeepPink" 0322 msgstr "" 0323 0324 #, kde-format 0325 msgctxt "color" 0326 msgid "DeepPink1" 0327 msgstr "" 0328 0329 #, kde-format 0330 msgctxt "color" 0331 msgid "DeepPink2" 0332 msgstr "" 0333 0334 #, kde-format 0335 msgctxt "color" 0336 msgid "DeepPink3" 0337 msgstr "" 0338 0339 #, kde-format 0340 msgctxt "color" 0341 msgid "DeepPink4" 0342 msgstr "" 0343 0344 #, kde-format 0345 msgctxt "color" 0346 msgid "DeepSkyBlue" 0347 msgstr "" 0348 0349 #, kde-format 0350 msgctxt "color" 0351 msgid "DeepSkyBlue1" 0352 msgstr "" 0353 0354 #, kde-format 0355 msgctxt "color" 0356 msgid "DeepSkyBlue2" 0357 msgstr "" 0358 0359 #, kde-format 0360 msgctxt "color" 0361 msgid "DeepSkyBlue3" 0362 msgstr "" 0363 0364 #, kde-format 0365 msgctxt "color" 0366 msgid "DeepSkyBlue4" 0367 msgstr "" 0368 0369 #, kde-format 0370 msgctxt "color" 0371 msgid "DimGray" 0372 msgstr "" 0373 0374 #, kde-format 0375 msgctxt "color" 0376 msgid "DimGrey" 0377 msgstr "" 0378 0379 #, kde-format 0380 msgctxt "color" 0381 msgid "DodgerBlue" 0382 msgstr "" 0383 0384 #, kde-format 0385 msgctxt "color" 0386 msgid "DodgerBlue1" 0387 msgstr "" 0388 0389 #, kde-format 0390 msgctxt "color" 0391 msgid "DodgerBlue2" 0392 msgstr "" 0393 0394 #, kde-format 0395 msgctxt "color" 0396 msgid "DodgerBlue3" 0397 msgstr "" 0398 0399 #, kde-format 0400 msgctxt "color" 0401 msgid "DodgerBlue4" 0402 msgstr "" 0403 0404 #, kde-format 0405 msgctxt "color" 0406 msgid "FloralWhite" 0407 msgstr "" 0408 0409 #, kde-format 0410 msgctxt "color" 0411 msgid "ForestGreen" 0412 msgstr "" 0413 0414 #, kde-format 0415 msgctxt "color" 0416 msgid "GhostWhite" 0417 msgstr "" 0418 0419 #, kde-format 0420 msgctxt "color" 0421 msgid "GreenYellow" 0422 msgstr "" 0423 0424 #, kde-format 0425 msgctxt "color" 0426 msgid "HotPink" 0427 msgstr "" 0428 0429 #, kde-format 0430 msgctxt "color" 0431 msgid "HotPink1" 0432 msgstr "" 0433 0434 #, kde-format 0435 msgctxt "color" 0436 msgid "HotPink2" 0437 msgstr "" 0438 0439 #, kde-format 0440 msgctxt "color" 0441 msgid "HotPink3" 0442 msgstr "" 0443 0444 #, kde-format 0445 msgctxt "color" 0446 msgid "HotPink4" 0447 msgstr "" 0448 0449 #, kde-format 0450 msgctxt "color" 0451 msgid "IndianRed" 0452 msgstr "" 0453 0454 #, kde-format 0455 msgctxt "color" 0456 msgid "IndianRed1" 0457 msgstr "" 0458 0459 #, kde-format 0460 msgctxt "color" 0461 msgid "IndianRed2" 0462 msgstr "" 0463 0464 #, kde-format 0465 msgctxt "color" 0466 msgid "IndianRed3" 0467 msgstr "" 0468 0469 #, kde-format 0470 msgctxt "color" 0471 msgid "IndianRed4" 0472 msgstr "" 0473 0474 #, kde-format 0475 msgctxt "color" 0476 msgid "LavenderBlush" 0477 msgstr "" 0478 0479 #, kde-format 0480 msgctxt "color" 0481 msgid "LavenderBlush1" 0482 msgstr "" 0483 0484 #, kde-format 0485 msgctxt "color" 0486 msgid "LavenderBlush2" 0487 msgstr "" 0488 0489 #, kde-format 0490 msgctxt "color" 0491 msgid "LavenderBlush3" 0492 msgstr "" 0493 0494 #, kde-format 0495 msgctxt "color" 0496 msgid "LavenderBlush4" 0497 msgstr "" 0498 0499 #, kde-format 0500 msgctxt "color" 0501 msgid "LawnGreen" 0502 msgstr "" 0503 0504 #, kde-format 0505 msgctxt "color" 0506 msgid "LemonChiffon" 0507 msgstr "" 0508 0509 #, kde-format 0510 msgctxt "color" 0511 msgid "LemonChiffon1" 0512 msgstr "" 0513 0514 #, kde-format 0515 msgctxt "color" 0516 msgid "LemonChiffon2" 0517 msgstr "" 0518 0519 #, kde-format 0520 msgctxt "color" 0521 msgid "LemonChiffon3" 0522 msgstr "" 0523 0524 #, kde-format 0525 msgctxt "color" 0526 msgid "LemonChiffon4" 0527 msgstr "" 0528 0529 #, kde-format 0530 msgctxt "color" 0531 msgid "LightBlue" 0532 msgstr "" 0533 0534 #, kde-format 0535 msgctxt "color" 0536 msgid "LightBlue1" 0537 msgstr "" 0538 0539 #, kde-format 0540 msgctxt "color" 0541 msgid "LightBlue2" 0542 msgstr "" 0543 0544 #, kde-format 0545 msgctxt "color" 0546 msgid "LightBlue3" 0547 msgstr "" 0548 0549 #, kde-format 0550 msgctxt "color" 0551 msgid "LightBlue4" 0552 msgstr "" 0553 0554 #, kde-format 0555 msgctxt "color" 0556 msgid "LightCoral" 0557 msgstr "" 0558 0559 #, kde-format 0560 msgctxt "color" 0561 msgid "LightCyan" 0562 msgstr "" 0563 0564 #, kde-format 0565 msgctxt "color" 0566 msgid "LightCyan1" 0567 msgstr "" 0568 0569 #, kde-format 0570 msgctxt "color" 0571 msgid "LightCyan2" 0572 msgstr "" 0573 0574 #, kde-format 0575 msgctxt "color" 0576 msgid "LightCyan3" 0577 msgstr "" 0578 0579 #, kde-format 0580 msgctxt "color" 0581 msgid "LightCyan4" 0582 msgstr "" 0583 0584 #, kde-format 0585 msgctxt "color" 0586 msgid "LightGoldenrod" 0587 msgstr "" 0588 0589 #, kde-format 0590 msgctxt "color" 0591 msgid "LightGoldenrod1" 0592 msgstr "" 0593 0594 #, kde-format 0595 msgctxt "color" 0596 msgid "LightGoldenrod2" 0597 msgstr "" 0598 0599 #, kde-format 0600 msgctxt "color" 0601 msgid "LightGoldenrod3" 0602 msgstr "" 0603 0604 #, kde-format 0605 msgctxt "color" 0606 msgid "LightGoldenrod4" 0607 msgstr "" 0608 0609 #, kde-format 0610 msgctxt "color" 0611 msgid "LightGoldenrodYellow" 0612 msgstr "" 0613 0614 #, kde-format 0615 msgctxt "color" 0616 msgid "LightGray" 0617 msgstr "" 0618 0619 #, kde-format 0620 msgctxt "color" 0621 msgid "LightGreen" 0622 msgstr "" 0623 0624 #, kde-format 0625 msgctxt "color" 0626 msgid "LightGrey" 0627 msgstr "" 0628 0629 #, kde-format 0630 msgctxt "color" 0631 msgid "LightPink" 0632 msgstr "" 0633 0634 #, kde-format 0635 msgctxt "color" 0636 msgid "LightPink1" 0637 msgstr "" 0638 0639 #, kde-format 0640 msgctxt "color" 0641 msgid "LightPink2" 0642 msgstr "" 0643 0644 #, kde-format 0645 msgctxt "color" 0646 msgid "LightPink3" 0647 msgstr "" 0648 0649 #, kde-format 0650 msgctxt "color" 0651 msgid "LightPink4" 0652 msgstr "" 0653 0654 #, kde-format 0655 msgctxt "color" 0656 msgid "LightSalmon" 0657 msgstr "" 0658 0659 #, kde-format 0660 msgctxt "color" 0661 msgid "LightSalmon1" 0662 msgstr "" 0663 0664 #, kde-format 0665 msgctxt "color" 0666 msgid "LightSalmon2" 0667 msgstr "" 0668 0669 #, kde-format 0670 msgctxt "color" 0671 msgid "LightSalmon3" 0672 msgstr "" 0673 0674 #, kde-format 0675 msgctxt "color" 0676 msgid "LightSalmon4" 0677 msgstr "" 0678 0679 #, kde-format 0680 msgctxt "color" 0681 msgid "LightSeaGreen" 0682 msgstr "" 0683 0684 #, kde-format 0685 msgctxt "color" 0686 msgid "LightSkyBlue" 0687 msgstr "" 0688 0689 #, kde-format 0690 msgctxt "color" 0691 msgid "LightSkyBlue1" 0692 msgstr "" 0693 0694 #, kde-format 0695 msgctxt "color" 0696 msgid "LightSkyBlue2" 0697 msgstr "" 0698 0699 #, kde-format 0700 msgctxt "color" 0701 msgid "LightSkyBlue3" 0702 msgstr "" 0703 0704 #, kde-format 0705 msgctxt "color" 0706 msgid "LightSkyBlue4" 0707 msgstr "" 0708 0709 #, kde-format 0710 msgctxt "color" 0711 msgid "LightSlateBlue" 0712 msgstr "" 0713 0714 #, kde-format 0715 msgctxt "color" 0716 msgid "LightSlateGray" 0717 msgstr "" 0718 0719 #, kde-format 0720 msgctxt "color" 0721 msgid "LightSlateGrey" 0722 msgstr "" 0723 0724 #, kde-format 0725 msgctxt "color" 0726 msgid "LightSteelBlue" 0727 msgstr "" 0728 0729 #, kde-format 0730 msgctxt "color" 0731 msgid "LightSteelBlue1" 0732 msgstr "" 0733 0734 #, kde-format 0735 msgctxt "color" 0736 msgid "LightSteelBlue2" 0737 msgstr "" 0738 0739 #, kde-format 0740 msgctxt "color" 0741 msgid "LightSteelBlue3" 0742 msgstr "" 0743 0744 #, kde-format 0745 msgctxt "color" 0746 msgid "LightSteelBlue4" 0747 msgstr "" 0748 0749 #, kde-format 0750 msgctxt "color" 0751 msgid "LightYellow" 0752 msgstr "" 0753 0754 #, kde-format 0755 msgctxt "color" 0756 msgid "LightYellow1" 0757 msgstr "" 0758 0759 #, kde-format 0760 msgctxt "color" 0761 msgid "LightYellow2" 0762 msgstr "" 0763 0764 #, kde-format 0765 msgctxt "color" 0766 msgid "LightYellow3" 0767 msgstr "" 0768 0769 #, kde-format 0770 msgctxt "color" 0771 msgid "LightYellow4" 0772 msgstr "" 0773 0774 #, kde-format 0775 msgctxt "color" 0776 msgid "LimeGreen" 0777 msgstr "" 0778 0779 #, kde-format 0780 msgctxt "color" 0781 msgid "MediumAquamarine" 0782 msgstr "" 0783 0784 #, kde-format 0785 msgctxt "color" 0786 msgid "MediumBlue" 0787 msgstr "" 0788 0789 #, kde-format 0790 msgctxt "color" 0791 msgid "MediumOrchid" 0792 msgstr "" 0793 0794 #, kde-format 0795 msgctxt "color" 0796 msgid "MediumOrchid1" 0797 msgstr "" 0798 0799 #, kde-format 0800 msgctxt "color" 0801 msgid "MediumOrchid2" 0802 msgstr "" 0803 0804 #, kde-format 0805 msgctxt "color" 0806 msgid "MediumOrchid3" 0807 msgstr "" 0808 0809 #, kde-format 0810 msgctxt "color" 0811 msgid "MediumOrchid4" 0812 msgstr "" 0813 0814 #, kde-format 0815 msgctxt "color" 0816 msgid "MediumPurple" 0817 msgstr "" 0818 0819 #, kde-format 0820 msgctxt "color" 0821 msgid "MediumPurple1" 0822 msgstr "" 0823 0824 #, kde-format 0825 msgctxt "color" 0826 msgid "MediumPurple2" 0827 msgstr "" 0828 0829 #, kde-format 0830 msgctxt "color" 0831 msgid "MediumPurple3" 0832 msgstr "" 0833 0834 #, kde-format 0835 msgctxt "color" 0836 msgid "MediumPurple4" 0837 msgstr "" 0838 0839 #, kde-format 0840 msgctxt "color" 0841 msgid "MediumSeaGreen" 0842 msgstr "" 0843 0844 #, kde-format 0845 msgctxt "color" 0846 msgid "MediumSlateBlue" 0847 msgstr "" 0848 0849 #, kde-format 0850 msgctxt "color" 0851 msgid "MediumSpringGreen" 0852 msgstr "" 0853 0854 #, kde-format 0855 msgctxt "color" 0856 msgid "MediumTurquoise" 0857 msgstr "" 0858 0859 #, kde-format 0860 msgctxt "color" 0861 msgid "MediumVioletRed" 0862 msgstr "" 0863 0864 #, kde-format 0865 msgctxt "color" 0866 msgid "MidnightBlue" 0867 msgstr "" 0868 0869 #, kde-format 0870 msgctxt "color" 0871 msgid "MintCream" 0872 msgstr "" 0873 0874 #, kde-format 0875 msgctxt "color" 0876 msgid "MistyRose" 0877 msgstr "" 0878 0879 #, kde-format 0880 msgctxt "color" 0881 msgid "MistyRose1" 0882 msgstr "" 0883 0884 #, kde-format 0885 msgctxt "color" 0886 msgid "MistyRose2" 0887 msgstr "" 0888 0889 #, kde-format 0890 msgctxt "color" 0891 msgid "MistyRose3" 0892 msgstr "" 0893 0894 #, kde-format 0895 msgctxt "color" 0896 msgid "MistyRose4" 0897 msgstr "" 0898 0899 #, kde-format 0900 msgctxt "color" 0901 msgid "NavajoWhite" 0902 msgstr "" 0903 0904 #, kde-format 0905 msgctxt "color" 0906 msgid "NavajoWhite1" 0907 msgstr "" 0908 0909 #, kde-format 0910 msgctxt "color" 0911 msgid "NavajoWhite2" 0912 msgstr "" 0913 0914 #, kde-format 0915 msgctxt "color" 0916 msgid "NavajoWhite3" 0917 msgstr "" 0918 0919 #, kde-format 0920 msgctxt "color" 0921 msgid "NavajoWhite4" 0922 msgstr "" 0923 0924 #, kde-format 0925 msgctxt "color" 0926 msgid "NavyBlue" 0927 msgstr "" 0928 0929 #, kde-format 0930 msgctxt "color" 0931 msgid "OldLace" 0932 msgstr "" 0933 0934 #, kde-format 0935 msgctxt "color" 0936 msgid "OliveDrab" 0937 msgstr "" 0938 0939 #, kde-format 0940 msgctxt "color" 0941 msgid "OliveDrab1" 0942 msgstr "" 0943 0944 #, kde-format 0945 msgctxt "color" 0946 msgid "OliveDrab2" 0947 msgstr "" 0948 0949 #, kde-format 0950 msgctxt "color" 0951 msgid "OliveDrab3" 0952 msgstr "" 0953 0954 #, kde-format 0955 msgctxt "color" 0956 msgid "OliveDrab4" 0957 msgstr "" 0958 0959 #, kde-format 0960 msgctxt "color" 0961 msgid "OrangeRed" 0962 msgstr "" 0963 0964 #, kde-format 0965 msgctxt "color" 0966 msgid "OrangeRed1" 0967 msgstr "" 0968 0969 #, kde-format 0970 msgctxt "color" 0971 msgid "OrangeRed2" 0972 msgstr "" 0973 0974 #, kde-format 0975 msgctxt "color" 0976 msgid "OrangeRed3" 0977 msgstr "" 0978 0979 #, kde-format 0980 msgctxt "color" 0981 msgid "OrangeRed4" 0982 msgstr "" 0983 0984 #, kde-format 0985 msgctxt "color" 0986 msgid "PaleGoldenrod" 0987 msgstr "" 0988 0989 #, kde-format 0990 msgctxt "color" 0991 msgid "PaleGreen" 0992 msgstr "" 0993 0994 #, kde-format 0995 msgctxt "color" 0996 msgid "PaleGreen1" 0997 msgstr "" 0998 0999 #, kde-format 1000 msgctxt "color" 1001 msgid "PaleGreen2" 1002 msgstr "" 1003 1004 #, kde-format 1005 msgctxt "color" 1006 msgid "PaleGreen3" 1007 msgstr "" 1008 1009 #, kde-format 1010 msgctxt "color" 1011 msgid "PaleGreen4" 1012 msgstr "" 1013 1014 #, kde-format 1015 msgctxt "color" 1016 msgid "PaleTurquoise" 1017 msgstr "" 1018 1019 #, kde-format 1020 msgctxt "color" 1021 msgid "PaleTurquoise1" 1022 msgstr "" 1023 1024 #, kde-format 1025 msgctxt "color" 1026 msgid "PaleTurquoise2" 1027 msgstr "" 1028 1029 #, kde-format 1030 msgctxt "color" 1031 msgid "PaleTurquoise3" 1032 msgstr "" 1033 1034 #, kde-format 1035 msgctxt "color" 1036 msgid "PaleTurquoise4" 1037 msgstr "" 1038 1039 #, kde-format 1040 msgctxt "color" 1041 msgid "PaleVioletRed" 1042 msgstr "" 1043 1044 #, kde-format 1045 msgctxt "color" 1046 msgid "PaleVioletRed1" 1047 msgstr "" 1048 1049 #, kde-format 1050 msgctxt "color" 1051 msgid "PaleVioletRed2" 1052 msgstr "" 1053 1054 #, kde-format 1055 msgctxt "color" 1056 msgid "PaleVioletRed3" 1057 msgstr "" 1058 1059 #, kde-format 1060 msgctxt "color" 1061 msgid "PaleVioletRed4" 1062 msgstr "" 1063 1064 #, kde-format 1065 msgctxt "color" 1066 msgid "PapayaWhip" 1067 msgstr "" 1068 1069 #, kde-format 1070 msgctxt "color" 1071 msgid "PeachPuff" 1072 msgstr "" 1073 1074 #, kde-format 1075 msgctxt "color" 1076 msgid "PeachPuff1" 1077 msgstr "" 1078 1079 #, kde-format 1080 msgctxt "color" 1081 msgid "PeachPuff2" 1082 msgstr "" 1083 1084 #, kde-format 1085 msgctxt "color" 1086 msgid "PeachPuff3" 1087 msgstr "" 1088 1089 #, kde-format 1090 msgctxt "color" 1091 msgid "PeachPuff4" 1092 msgstr "" 1093 1094 #, kde-format 1095 msgctxt "color" 1096 msgid "PowderBlue" 1097 msgstr "" 1098 1099 #, kde-format 1100 msgctxt "color" 1101 msgid "RosyBrown" 1102 msgstr "" 1103 1104 #, kde-format 1105 msgctxt "color" 1106 msgid "RosyBrown1" 1107 msgstr "" 1108 1109 #, kde-format 1110 msgctxt "color" 1111 msgid "RosyBrown2" 1112 msgstr "" 1113 1114 #, kde-format 1115 msgctxt "color" 1116 msgid "RosyBrown3" 1117 msgstr "" 1118 1119 #, kde-format 1120 msgctxt "color" 1121 msgid "RosyBrown4" 1122 msgstr "" 1123 1124 #, kde-format 1125 msgctxt "color" 1126 msgid "RoyalBlue" 1127 msgstr "" 1128 1129 #, kde-format 1130 msgctxt "color" 1131 msgid "RoyalBlue1" 1132 msgstr "" 1133 1134 #, kde-format 1135 msgctxt "color" 1136 msgid "RoyalBlue2" 1137 msgstr "" 1138 1139 #, kde-format 1140 msgctxt "color" 1141 msgid "RoyalBlue3" 1142 msgstr "" 1143 1144 #, kde-format 1145 msgctxt "color" 1146 msgid "RoyalBlue4" 1147 msgstr "" 1148 1149 #, kde-format 1150 msgctxt "color" 1151 msgid "SaddleBrown" 1152 msgstr "" 1153 1154 #, kde-format 1155 msgctxt "color" 1156 msgid "SandyBrown" 1157 msgstr "" 1158 1159 #, kde-format 1160 msgctxt "color" 1161 msgid "SeaGreen" 1162 msgstr "" 1163 1164 #, kde-format 1165 msgctxt "color" 1166 msgid "SeaGreen1" 1167 msgstr "" 1168 1169 #, kde-format 1170 msgctxt "color" 1171 msgid "SeaGreen2" 1172 msgstr "" 1173 1174 #, kde-format 1175 msgctxt "color" 1176 msgid "SeaGreen3" 1177 msgstr "" 1178 1179 #, kde-format 1180 msgctxt "color" 1181 msgid "SeaGreen4" 1182 msgstr "" 1183 1184 #, kde-format 1185 msgctxt "color" 1186 msgid "SkyBlue" 1187 msgstr "" 1188 1189 #, kde-format 1190 msgctxt "color" 1191 msgid "SkyBlue1" 1192 msgstr "" 1193 1194 #, kde-format 1195 msgctxt "color" 1196 msgid "SkyBlue2" 1197 msgstr "" 1198 1199 #, kde-format 1200 msgctxt "color" 1201 msgid "SkyBlue3" 1202 msgstr "" 1203 1204 #, kde-format 1205 msgctxt "color" 1206 msgid "SkyBlue4" 1207 msgstr "" 1208 1209 #, kde-format 1210 msgctxt "color" 1211 msgid "SlateBlue" 1212 msgstr "" 1213 1214 #, kde-format 1215 msgctxt "color" 1216 msgid "SlateBlue1" 1217 msgstr "" 1218 1219 #, kde-format 1220 msgctxt "color" 1221 msgid "SlateBlue2" 1222 msgstr "" 1223 1224 #, kde-format 1225 msgctxt "color" 1226 msgid "SlateBlue3" 1227 msgstr "" 1228 1229 #, kde-format 1230 msgctxt "color" 1231 msgid "SlateBlue4" 1232 msgstr "" 1233 1234 #, kde-format 1235 msgctxt "color" 1236 msgid "SlateGray" 1237 msgstr "" 1238 1239 #, kde-format 1240 msgctxt "color" 1241 msgid "SlateGray1" 1242 msgstr "" 1243 1244 #, kde-format 1245 msgctxt "color" 1246 msgid "SlateGray2" 1247 msgstr "" 1248 1249 #, kde-format 1250 msgctxt "color" 1251 msgid "SlateGray3" 1252 msgstr "" 1253 1254 #, kde-format 1255 msgctxt "color" 1256 msgid "SlateGray4" 1257 msgstr "" 1258 1259 #, kde-format 1260 msgctxt "color" 1261 msgid "SlateGrey" 1262 msgstr "" 1263 1264 #, kde-format 1265 msgctxt "color" 1266 msgid "SpringGreen" 1267 msgstr "" 1268 1269 #, kde-format 1270 msgctxt "color" 1271 msgid "SpringGreen1" 1272 msgstr "" 1273 1274 #, kde-format 1275 msgctxt "color" 1276 msgid "SpringGreen2" 1277 msgstr "" 1278 1279 #, kde-format 1280 msgctxt "color" 1281 msgid "SpringGreen3" 1282 msgstr "" 1283 1284 #, kde-format 1285 msgctxt "color" 1286 msgid "SpringGreen4" 1287 msgstr "" 1288 1289 #, kde-format 1290 msgctxt "color" 1291 msgid "SteelBlue" 1292 msgstr "" 1293 1294 #, kde-format 1295 msgctxt "color" 1296 msgid "SteelBlue1" 1297 msgstr "" 1298 1299 #, kde-format 1300 msgctxt "color" 1301 msgid "SteelBlue2" 1302 msgstr "" 1303 1304 #, kde-format 1305 msgctxt "color" 1306 msgid "SteelBlue3" 1307 msgstr "" 1308 1309 #, kde-format 1310 msgctxt "color" 1311 msgid "SteelBlue4" 1312 msgstr "" 1313 1314 #, kde-format 1315 msgctxt "color" 1316 msgid "VioletRed" 1317 msgstr "" 1318 1319 #, kde-format 1320 msgctxt "color" 1321 msgid "VioletRed1" 1322 msgstr "" 1323 1324 #, kde-format 1325 msgctxt "color" 1326 msgid "VioletRed2" 1327 msgstr "" 1328 1329 #, kde-format 1330 msgctxt "color" 1331 msgid "VioletRed3" 1332 msgstr "" 1333 1334 #, kde-format 1335 msgctxt "color" 1336 msgid "VioletRed4" 1337 msgstr "" 1338 1339 #, kde-format 1340 msgctxt "color" 1341 msgid "WhiteSmoke" 1342 msgstr "" 1343 1344 #, kde-format 1345 msgctxt "color" 1346 msgid "YellowGreen" 1347 msgstr "" 1348 1349 #, kde-format 1350 msgctxt "color" 1351 msgid "aquamarine" 1352 msgstr "" 1353 1354 #, kde-format 1355 msgctxt "color" 1356 msgid "aquamarine1" 1357 msgstr "" 1358 1359 #, kde-format 1360 msgctxt "color" 1361 msgid "aquamarine2" 1362 msgstr "" 1363 1364 #, kde-format 1365 msgctxt "color" 1366 msgid "aquamarine3" 1367 msgstr "" 1368 1369 #, kde-format 1370 msgctxt "color" 1371 msgid "aquamarine4" 1372 msgstr "" 1373 1374 #, kde-format 1375 msgctxt "color" 1376 msgid "azure" 1377 msgstr "" 1378 1379 #, kde-format 1380 msgctxt "color" 1381 msgid "azure1" 1382 msgstr "" 1383 1384 #, kde-format 1385 msgctxt "color" 1386 msgid "azure2" 1387 msgstr "" 1388 1389 #, kde-format 1390 msgctxt "color" 1391 msgid "azure3" 1392 msgstr "" 1393 1394 #, kde-format 1395 msgctxt "color" 1396 msgid "azure4" 1397 msgstr "" 1398 1399 #, kde-format 1400 msgctxt "color" 1401 msgid "beige" 1402 msgstr "" 1403 1404 #, kde-format 1405 msgctxt "color" 1406 msgid "bisque" 1407 msgstr "" 1408 1409 #, kde-format 1410 msgctxt "color" 1411 msgid "bisque1" 1412 msgstr "" 1413 1414 #, kde-format 1415 msgctxt "color" 1416 msgid "bisque2" 1417 msgstr "" 1418 1419 #, kde-format 1420 msgctxt "color" 1421 msgid "bisque3" 1422 msgstr "" 1423 1424 #, kde-format 1425 msgctxt "color" 1426 msgid "bisque4" 1427 msgstr "" 1428 1429 #, kde-format 1430 msgctxt "color" 1431 msgid "black" 1432 msgstr "" 1433 1434 #, kde-format 1435 msgctxt "color" 1436 msgid "blue" 1437 msgstr "" 1438 1439 #, kde-format 1440 msgctxt "color" 1441 msgid "blue1" 1442 msgstr "" 1443 1444 #, kde-format 1445 msgctxt "color" 1446 msgid "blue2" 1447 msgstr "" 1448 1449 #, kde-format 1450 msgctxt "color" 1451 msgid "blue3" 1452 msgstr "" 1453 1454 #, kde-format 1455 msgctxt "color" 1456 msgid "blue4" 1457 msgstr "" 1458 1459 #, kde-format 1460 msgctxt "color" 1461 msgid "brown" 1462 msgstr "" 1463 1464 #, kde-format 1465 msgctxt "color" 1466 msgid "brown1" 1467 msgstr "" 1468 1469 #, kde-format 1470 msgctxt "color" 1471 msgid "brown2" 1472 msgstr "" 1473 1474 #, kde-format 1475 msgctxt "color" 1476 msgid "brown3" 1477 msgstr "" 1478 1479 #, kde-format 1480 msgctxt "color" 1481 msgid "brown4" 1482 msgstr "" 1483 1484 #, kde-format 1485 msgctxt "color" 1486 msgid "burlywood" 1487 msgstr "" 1488 1489 #, kde-format 1490 msgctxt "color" 1491 msgid "burlywood1" 1492 msgstr "" 1493 1494 #, kde-format 1495 msgctxt "color" 1496 msgid "burlywood2" 1497 msgstr "" 1498 1499 #, kde-format 1500 msgctxt "color" 1501 msgid "burlywood3" 1502 msgstr "" 1503 1504 #, kde-format 1505 msgctxt "color" 1506 msgid "burlywood4" 1507 msgstr "" 1508 1509 #, kde-format 1510 msgctxt "color" 1511 msgid "chartreuse" 1512 msgstr "" 1513 1514 #, kde-format 1515 msgctxt "color" 1516 msgid "chartreuse1" 1517 msgstr "" 1518 1519 #, kde-format 1520 msgctxt "color" 1521 msgid "chartreuse2" 1522 msgstr "" 1523 1524 #, kde-format 1525 msgctxt "color" 1526 msgid "chartreuse3" 1527 msgstr "" 1528 1529 #, kde-format 1530 msgctxt "color" 1531 msgid "chartreuse4" 1532 msgstr "" 1533 1534 #, kde-format 1535 msgctxt "color" 1536 msgid "chocolate" 1537 msgstr "" 1538 1539 #, kde-format 1540 msgctxt "color" 1541 msgid "chocolate1" 1542 msgstr "" 1543 1544 #, kde-format 1545 msgctxt "color" 1546 msgid "chocolate2" 1547 msgstr "" 1548 1549 #, kde-format 1550 msgctxt "color" 1551 msgid "chocolate3" 1552 msgstr "" 1553 1554 #, kde-format 1555 msgctxt "color" 1556 msgid "chocolate4" 1557 msgstr "" 1558 1559 #, kde-format 1560 msgctxt "color" 1561 msgid "coral" 1562 msgstr "" 1563 1564 #, kde-format 1565 msgctxt "color" 1566 msgid "coral1" 1567 msgstr "" 1568 1569 #, kde-format 1570 msgctxt "color" 1571 msgid "coral2" 1572 msgstr "" 1573 1574 #, kde-format 1575 msgctxt "color" 1576 msgid "coral3" 1577 msgstr "" 1578 1579 #, kde-format 1580 msgctxt "color" 1581 msgid "coral4" 1582 msgstr "" 1583 1584 #, kde-format 1585 msgctxt "color" 1586 msgid "cornsilk" 1587 msgstr "" 1588 1589 #, kde-format 1590 msgctxt "color" 1591 msgid "cornsilk1" 1592 msgstr "" 1593 1594 #, kde-format 1595 msgctxt "color" 1596 msgid "cornsilk2" 1597 msgstr "" 1598 1599 #, kde-format 1600 msgctxt "color" 1601 msgid "cornsilk3" 1602 msgstr "" 1603 1604 #, kde-format 1605 msgctxt "color" 1606 msgid "cornsilk4" 1607 msgstr "" 1608 1609 #, kde-format 1610 msgctxt "color" 1611 msgid "cyan" 1612 msgstr "" 1613 1614 #, kde-format 1615 msgctxt "color" 1616 msgid "cyan1" 1617 msgstr "" 1618 1619 #, kde-format 1620 msgctxt "color" 1621 msgid "cyan2" 1622 msgstr "" 1623 1624 #, kde-format 1625 msgctxt "color" 1626 msgid "cyan3" 1627 msgstr "" 1628 1629 #, kde-format 1630 msgctxt "color" 1631 msgid "cyan4" 1632 msgstr "" 1633 1634 #, kde-format 1635 msgctxt "color" 1636 msgid "firebrick" 1637 msgstr "" 1638 1639 #, kde-format 1640 msgctxt "color" 1641 msgid "firebrick1" 1642 msgstr "" 1643 1644 #, kde-format 1645 msgctxt "color" 1646 msgid "firebrick2" 1647 msgstr "" 1648 1649 #, kde-format 1650 msgctxt "color" 1651 msgid "firebrick3" 1652 msgstr "" 1653 1654 #, kde-format 1655 msgctxt "color" 1656 msgid "firebrick4" 1657 msgstr "" 1658 1659 #, kde-format 1660 msgctxt "color" 1661 msgid "gainsboro" 1662 msgstr "" 1663 1664 #, kde-format 1665 msgctxt "color" 1666 msgid "gold" 1667 msgstr "" 1668 1669 #, kde-format 1670 msgctxt "color" 1671 msgid "gold1" 1672 msgstr "" 1673 1674 #, kde-format 1675 msgctxt "color" 1676 msgid "gold2" 1677 msgstr "" 1678 1679 #, kde-format 1680 msgctxt "color" 1681 msgid "gold3" 1682 msgstr "" 1683 1684 #, kde-format 1685 msgctxt "color" 1686 msgid "gold4" 1687 msgstr "" 1688 1689 #, kde-format 1690 msgctxt "color" 1691 msgid "goldenrod" 1692 msgstr "" 1693 1694 #, kde-format 1695 msgctxt "color" 1696 msgid "goldenrod1" 1697 msgstr "" 1698 1699 #, kde-format 1700 msgctxt "color" 1701 msgid "goldenrod2" 1702 msgstr "" 1703 1704 #, kde-format 1705 msgctxt "color" 1706 msgid "goldenrod3" 1707 msgstr "" 1708 1709 #, kde-format 1710 msgctxt "color" 1711 msgid "goldenrod4" 1712 msgstr "" 1713 1714 #, kde-format 1715 msgctxt "color" 1716 msgid "green" 1717 msgstr "" 1718 1719 #, kde-format 1720 msgctxt "color" 1721 msgid "green1" 1722 msgstr "" 1723 1724 #, kde-format 1725 msgctxt "color" 1726 msgid "green2" 1727 msgstr "" 1728 1729 #, kde-format 1730 msgctxt "color" 1731 msgid "green3" 1732 msgstr "" 1733 1734 #, kde-format 1735 msgctxt "color" 1736 msgid "green4" 1737 msgstr "" 1738 1739 #, kde-format 1740 msgctxt "color" 1741 msgid "honeydew" 1742 msgstr "" 1743 1744 #, kde-format 1745 msgctxt "color" 1746 msgid "honeydew1" 1747 msgstr "" 1748 1749 #, kde-format 1750 msgctxt "color" 1751 msgid "honeydew2" 1752 msgstr "" 1753 1754 #, kde-format 1755 msgctxt "color" 1756 msgid "honeydew3" 1757 msgstr "" 1758 1759 #, kde-format 1760 msgctxt "color" 1761 msgid "honeydew4" 1762 msgstr "" 1763 1764 #, kde-format 1765 msgctxt "color" 1766 msgid "ivory" 1767 msgstr "" 1768 1769 #, kde-format 1770 msgctxt "color" 1771 msgid "ivory1" 1772 msgstr "" 1773 1774 #, kde-format 1775 msgctxt "color" 1776 msgid "ivory2" 1777 msgstr "" 1778 1779 #, kde-format 1780 msgctxt "color" 1781 msgid "ivory3" 1782 msgstr "" 1783 1784 #, kde-format 1785 msgctxt "color" 1786 msgid "ivory4" 1787 msgstr "" 1788 1789 #, kde-format 1790 msgctxt "color" 1791 msgid "khaki" 1792 msgstr "" 1793 1794 #, kde-format 1795 msgctxt "color" 1796 msgid "khaki1" 1797 msgstr "" 1798 1799 #, kde-format 1800 msgctxt "color" 1801 msgid "khaki2" 1802 msgstr "" 1803 1804 #, kde-format 1805 msgctxt "color" 1806 msgid "khaki3" 1807 msgstr "" 1808 1809 #, kde-format 1810 msgctxt "color" 1811 msgid "khaki4" 1812 msgstr "" 1813 1814 #, kde-format 1815 msgctxt "color" 1816 msgid "lavender" 1817 msgstr "" 1818 1819 #, kde-format 1820 msgctxt "color" 1821 msgid "linen" 1822 msgstr "" 1823 1824 #, kde-format 1825 msgctxt "color" 1826 msgid "magenta" 1827 msgstr "" 1828 1829 #, kde-format 1830 msgctxt "color" 1831 msgid "magenta1" 1832 msgstr "" 1833 1834 #, kde-format 1835 msgctxt "color" 1836 msgid "magenta2" 1837 msgstr "" 1838 1839 #, kde-format 1840 msgctxt "color" 1841 msgid "magenta3" 1842 msgstr "" 1843 1844 #, kde-format 1845 msgctxt "color" 1846 msgid "magenta4" 1847 msgstr "" 1848 1849 #, kde-format 1850 msgctxt "color" 1851 msgid "maroon" 1852 msgstr "" 1853 1854 #, kde-format 1855 msgctxt "color" 1856 msgid "maroon1" 1857 msgstr "" 1858 1859 #, kde-format 1860 msgctxt "color" 1861 msgid "maroon2" 1862 msgstr "" 1863 1864 #, kde-format 1865 msgctxt "color" 1866 msgid "maroon3" 1867 msgstr "" 1868 1869 #, kde-format 1870 msgctxt "color" 1871 msgid "maroon4" 1872 msgstr "" 1873 1874 #, kde-format 1875 msgctxt "color" 1876 msgid "moccasin" 1877 msgstr "" 1878 1879 #, kde-format 1880 msgctxt "color" 1881 msgid "navy" 1882 msgstr "" 1883 1884 #, kde-format 1885 msgctxt "color" 1886 msgid "orange" 1887 msgstr "" 1888 1889 #, kde-format 1890 msgctxt "color" 1891 msgid "orange1" 1892 msgstr "" 1893 1894 #, kde-format 1895 msgctxt "color" 1896 msgid "orange2" 1897 msgstr "" 1898 1899 #, kde-format 1900 msgctxt "color" 1901 msgid "orange3" 1902 msgstr "" 1903 1904 #, kde-format 1905 msgctxt "color" 1906 msgid "orange4" 1907 msgstr "" 1908 1909 #, kde-format 1910 msgctxt "color" 1911 msgid "orchid" 1912 msgstr "" 1913 1914 #, kde-format 1915 msgctxt "color" 1916 msgid "orchid1" 1917 msgstr "" 1918 1919 #, kde-format 1920 msgctxt "color" 1921 msgid "orchid2" 1922 msgstr "" 1923 1924 #, kde-format 1925 msgctxt "color" 1926 msgid "orchid3" 1927 msgstr "" 1928 1929 #, kde-format 1930 msgctxt "color" 1931 msgid "orchid4" 1932 msgstr "" 1933 1934 #, kde-format 1935 msgctxt "color" 1936 msgid "peru" 1937 msgstr "" 1938 1939 #, kde-format 1940 msgctxt "color" 1941 msgid "pink" 1942 msgstr "" 1943 1944 #, kde-format 1945 msgctxt "color" 1946 msgid "pink1" 1947 msgstr "" 1948 1949 #, kde-format 1950 msgctxt "color" 1951 msgid "pink2" 1952 msgstr "" 1953 1954 #, kde-format 1955 msgctxt "color" 1956 msgid "pink3" 1957 msgstr "" 1958 1959 #, kde-format 1960 msgctxt "color" 1961 msgid "pink4" 1962 msgstr "" 1963 1964 #, kde-format 1965 msgctxt "color" 1966 msgid "plum" 1967 msgstr "" 1968 1969 #, kde-format 1970 msgctxt "color" 1971 msgid "plum1" 1972 msgstr "" 1973 1974 #, kde-format 1975 msgctxt "color" 1976 msgid "plum2" 1977 msgstr "" 1978 1979 #, kde-format 1980 msgctxt "color" 1981 msgid "plum3" 1982 msgstr "" 1983 1984 #, kde-format 1985 msgctxt "color" 1986 msgid "plum4" 1987 msgstr "" 1988 1989 #, kde-format 1990 msgctxt "color" 1991 msgid "purple" 1992 msgstr "" 1993 1994 #, kde-format 1995 msgctxt "color" 1996 msgid "purple1" 1997 msgstr "" 1998 1999 #, kde-format 2000 msgctxt "color" 2001 msgid "purple2" 2002 msgstr "" 2003 2004 #, kde-format 2005 msgctxt "color" 2006 msgid "purple3" 2007 msgstr "" 2008 2009 #, kde-format 2010 msgctxt "color" 2011 msgid "purple4" 2012 msgstr "" 2013 2014 #, fuzzy, kde-format 2015 msgctxt "color" 2016 msgid "red" 2017 msgstr "বুধ" 2018 2019 #, kde-format 2020 msgctxt "color" 2021 msgid "red1" 2022 msgstr "" 2023 2024 #, kde-format 2025 msgctxt "color" 2026 msgid "red2" 2027 msgstr "" 2028 2029 #, kde-format 2030 msgctxt "color" 2031 msgid "red3" 2032 msgstr "" 2033 2034 #, kde-format 2035 msgctxt "color" 2036 msgid "red4" 2037 msgstr "" 2038 2039 #, kde-format 2040 msgctxt "color" 2041 msgid "salmon" 2042 msgstr "" 2043 2044 #, kde-format 2045 msgctxt "color" 2046 msgid "salmon1" 2047 msgstr "" 2048 2049 #, kde-format 2050 msgctxt "color" 2051 msgid "salmon2" 2052 msgstr "" 2053 2054 #, kde-format 2055 msgctxt "color" 2056 msgid "salmon3" 2057 msgstr "" 2058 2059 #, kde-format 2060 msgctxt "color" 2061 msgid "salmon4" 2062 msgstr "" 2063 2064 #, kde-format 2065 msgctxt "color" 2066 msgid "seashell" 2067 msgstr "" 2068 2069 #, kde-format 2070 msgctxt "color" 2071 msgid "seashell1" 2072 msgstr "" 2073 2074 #, kde-format 2075 msgctxt "color" 2076 msgid "seashell2" 2077 msgstr "" 2078 2079 #, kde-format 2080 msgctxt "color" 2081 msgid "seashell3" 2082 msgstr "" 2083 2084 #, kde-format 2085 msgctxt "color" 2086 msgid "seashell4" 2087 msgstr "" 2088 2089 #, kde-format 2090 msgctxt "color" 2091 msgid "sienna" 2092 msgstr "" 2093 2094 #, kde-format 2095 msgctxt "color" 2096 msgid "sienna1" 2097 msgstr "" 2098 2099 #, kde-format 2100 msgctxt "color" 2101 msgid "sienna2" 2102 msgstr "" 2103 2104 #, kde-format 2105 msgctxt "color" 2106 msgid "sienna3" 2107 msgstr "" 2108 2109 #, kde-format 2110 msgctxt "color" 2111 msgid "sienna4" 2112 msgstr "" 2113 2114 #, kde-format 2115 msgctxt "color" 2116 msgid "snow" 2117 msgstr "" 2118 2119 #, kde-format 2120 msgctxt "color" 2121 msgid "snow1" 2122 msgstr "" 2123 2124 #, kde-format 2125 msgctxt "color" 2126 msgid "snow2" 2127 msgstr "" 2128 2129 #, kde-format 2130 msgctxt "color" 2131 msgid "snow3" 2132 msgstr "" 2133 2134 #, kde-format 2135 msgctxt "color" 2136 msgid "snow4" 2137 msgstr "" 2138 2139 #, fuzzy, kde-format 2140 msgctxt "color" 2141 msgid "tan" 2142 msgstr "জানুয়ারী" 2143 2144 #, kde-format 2145 msgctxt "color" 2146 msgid "tan1" 2147 msgstr "" 2148 2149 #, kde-format 2150 msgctxt "color" 2151 msgid "tan2" 2152 msgstr "" 2153 2154 #, kde-format 2155 msgctxt "color" 2156 msgid "tan3" 2157 msgstr "" 2158 2159 #, kde-format 2160 msgctxt "color" 2161 msgid "tan4" 2162 msgstr "" 2163 2164 #, kde-format 2165 msgctxt "color" 2166 msgid "thistle" 2167 msgstr "" 2168 2169 #, kde-format 2170 msgctxt "color" 2171 msgid "thistle1" 2172 msgstr "" 2173 2174 #, kde-format 2175 msgctxt "color" 2176 msgid "thistle2" 2177 msgstr "" 2178 2179 #, kde-format 2180 msgctxt "color" 2181 msgid "thistle3" 2182 msgstr "" 2183 2184 #, kde-format 2185 msgctxt "color" 2186 msgid "thistle4" 2187 msgstr "" 2188 2189 #, kde-format 2190 msgctxt "color" 2191 msgid "tomato" 2192 msgstr "" 2193 2194 #, kde-format 2195 msgctxt "color" 2196 msgid "tomato1" 2197 msgstr "" 2198 2199 #, kde-format 2200 msgctxt "color" 2201 msgid "tomato2" 2202 msgstr "" 2203 2204 #, kde-format 2205 msgctxt "color" 2206 msgid "tomato3" 2207 msgstr "" 2208 2209 #, kde-format 2210 msgctxt "color" 2211 msgid "tomato4" 2212 msgstr "" 2213 2214 #, kde-format 2215 msgctxt "color" 2216 msgid "turquoise" 2217 msgstr "" 2218 2219 #, kde-format 2220 msgctxt "color" 2221 msgid "turquoise1" 2222 msgstr "" 2223 2224 #, kde-format 2225 msgctxt "color" 2226 msgid "turquoise2" 2227 msgstr "" 2228 2229 #, kde-format 2230 msgctxt "color" 2231 msgid "turquoise3" 2232 msgstr "" 2233 2234 #, kde-format 2235 msgctxt "color" 2236 msgid "turquoise4" 2237 msgstr "" 2238 2239 #, kde-format 2240 msgctxt "color" 2241 msgid "violet" 2242 msgstr "" 2243 2244 #, kde-format 2245 msgctxt "color" 2246 msgid "wheat" 2247 msgstr "" 2248 2249 #, kde-format 2250 msgctxt "color" 2251 msgid "wheat1" 2252 msgstr "" 2253 2254 #, kde-format 2255 msgctxt "color" 2256 msgid "wheat2" 2257 msgstr "" 2258 2259 #, kde-format 2260 msgctxt "color" 2261 msgid "wheat3" 2262 msgstr "" 2263 2264 #, kde-format 2265 msgctxt "color" 2266 msgid "wheat4" 2267 msgstr "" 2268 2269 #, kde-format 2270 msgctxt "color" 2271 msgid "white" 2272 msgstr "" 2273 2274 #, kde-format 2275 msgctxt "color" 2276 msgid "yellow" 2277 msgstr "" 2278 2279 #, kde-format 2280 msgctxt "color" 2281 msgid "yellow1" 2282 msgstr "" 2283 2284 #, kde-format 2285 msgctxt "color" 2286 msgid "yellow2" 2287 msgstr "" 2288 2289 #, kde-format 2290 msgctxt "color" 2291 msgid "yellow3" 2292 msgstr "" 2293 2294 #, kde-format 2295 msgctxt "color" 2296 msgid "yellow4" 2297 msgstr "" 2298 2299 #: kdebugdialog/kdebugdialog.cpp:44 kdebugdialog/klistdebugdialog.cpp:38 2300 #, kde-format 2301 msgid "Debug Settings" 2302 msgstr "ডিবাগ সেটিংস" 2303 2304 #: kdebugdialog/kdebugdialog.cpp:59 2305 #, kde-format 2306 msgid "File" 2307 msgstr "ফাইল" 2308 2309 #: kdebugdialog/kdebugdialog.cpp:60 2310 #, kde-format 2311 msgid "Message Box" 2312 msgstr "বার্তা বাক্স" 2313 2314 #: kdebugdialog/kdebugdialog.cpp:61 2315 #, kde-format 2316 msgid "Shell" 2317 msgstr "শেল" 2318 2319 #: kdebugdialog/kdebugdialog.cpp:62 2320 #, kde-format 2321 msgid "Syslog" 2322 msgstr "সিস-লগ" 2323 2324 #: kdebugdialog/kdebugdialog.cpp:63 2325 #, kde-format 2326 msgid "None" 2327 msgstr "খালি" 2328 2329 #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) 2330 #: kdebugdialog/kdebugdialog.ui:48 2331 #, kde-format 2332 msgid "Information" 2333 msgstr "তথ্য" 2334 2335 #. i18n: ectx: property (text), widget (QLabel, label_2) 2336 #. i18n: ectx: property (text), widget (QLabel, label_8) 2337 #. i18n: ectx: property (text), widget (QLabel, label_4) 2338 #. i18n: ectx: property (text), widget (QLabel, label_6) 2339 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 2340 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 2341 #, kde-format 2342 msgid "Output to:" 2343 msgstr "আউটপুট যাবে:" 2344 2345 #. i18n: ectx: property (text), widget (QLabel, label_3) 2346 #. i18n: ectx: property (text), widget (QLabel, label_9) 2347 #. i18n: ectx: property (text), widget (QLabel, label_5) 2348 #. i18n: ectx: property (text), widget (QLabel, label_7) 2349 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 2350 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 2351 #, fuzzy, kde-format 2352 msgid "Filename:" 2353 msgstr "ফাইলের নাম:" 2354 2355 #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) 2356 #: kdebugdialog/kdebugdialog.ui:83 2357 #, fuzzy, kde-format 2358 msgid "Error" 2359 msgstr "মারাত্মক সমস্যা" 2360 2361 #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) 2362 #: kdebugdialog/kdebugdialog.ui:118 2363 #, kde-format 2364 msgid "Abort on fatal errors" 2365 msgstr "মারাত্মক সমস্যা হলে বের হয়ে যাবে" 2366 2367 #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) 2368 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:78 2369 #, kde-format 2370 msgid "Disable all debug output" 2371 msgstr "ডিবাগ আউটপুট নিষ্ক্রিয় করো" 2372 2373 #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) 2374 #: kdebugdialog/kdebugdialog.ui:145 2375 #, kde-format 2376 msgid "Warning" 2377 msgstr "সতর্কবার্তা" 2378 2379 #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) 2380 #: kdebugdialog/kdebugdialog.ui:180 2381 #, kde-format 2382 msgid "Fatal Error" 2383 msgstr "মারাত্মক সমস্যা" 2384 2385 #: kdebugdialog/klistdebugdialog.cpp:69 2386 #, kde-format 2387 msgid "&Select All" 2388 msgstr "সকল নির্বাচ&ন করো" 2389 2390 #: kdebugdialog/klistdebugdialog.cpp:70 2391 #, kde-format 2392 msgid "&Deselect All" 2393 msgstr "সকল &অনির্বাচিত করো" 2394 2395 #: kdebugdialog/main.cpp:100 2396 #, kde-format 2397 msgid "KDebugDialog" 2398 msgstr "কে-ডিবাগ-ডায়ালগ" 2399 2400 #: kdebugdialog/main.cpp:101 2401 #, kde-format 2402 msgid "A dialog box for setting preferences for debug output" 2403 msgstr "ডিবাগের আউটপুট সম্পর্কিত পছন্দ নির্ধারণের ডায়ালগ বাক্স " 2404 2405 #: kdebugdialog/main.cpp:102 2406 #, fuzzy, kde-format 2407 #| msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2408 msgid "Copyright 1999-2009, David Faure <faure@kde.org>" 2409 msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>" 2410 2411 #: kdebugdialog/main.cpp:103 2412 #, kde-format 2413 msgid "David Faure" 2414 msgstr "David Faure" 2415 2416 #: kdebugdialog/main.cpp:103 2417 #, kde-format 2418 msgid "Maintainer" 2419 msgstr "রক্ষণাবেক্ষণকারী" 2420 2421 #: kdebugdialog/main.cpp:108 2422 #, kde-format 2423 msgid "Show the fully-fledged dialog instead of the default list dialog" 2424 msgstr "ডিফল্ট লিস্ট ডায়ালগ-এর পরিবর্তে সম্পূর্ণ ডায়ালগ দেখাও" 2425 2426 #: kdebugdialog/main.cpp:109 2427 #, kde-format 2428 msgid "Turn area on" 2429 msgstr "ক্ষেত্র সক্রিয় করো" 2430 2431 #: kdebugdialog/main.cpp:110 2432 #, kde-format 2433 msgid "Turn area off" 2434 msgstr "ক্ষেত্র নিষ্ক্রিয় করো" 2435 2436 #: kdecore/k3resolver.cpp:533 kdecore/netsupp.cpp:865 2437 #, kde-format 2438 msgid "no error" 2439 msgstr "কোনো ভুল নেই" 2440 2441 #: kdecore/k3resolver.cpp:534 2442 #, kde-format 2443 msgid "requested family not supported for this host name" 2444 msgstr "এই হোস্ট-নামের জন্য অনুরোধ করা ফ্যামিলি সমর্থিত নয়" 2445 2446 #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:867 2447 #, kde-format 2448 msgid "temporary failure in name resolution" 2449 msgstr "নেম রিসোলিউশনে সাময়িক সমস্যা" 2450 2451 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:869 2452 #, kde-format 2453 msgid "non-recoverable failure in name resolution" 2454 msgstr "নেম রিসোলিউশনের প্রচেষ্টায় ব্যর্থ" 2455 2456 #: kdecore/k3resolver.cpp:537 2457 #, kde-format 2458 msgid "invalid flags" 2459 msgstr "অবৈধ ফ্ল্যাগ" 2460 2461 #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:871 2462 #, kde-format 2463 msgid "memory allocation failure" 2464 msgstr "memory allocation failure" 2465 2466 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:873 2467 #, kde-format 2468 msgid "name or service not known" 2469 msgstr "name or service not known" 2470 2471 #: kdecore/k3resolver.cpp:540 2472 #, kde-format 2473 msgid "requested family not supported" 2474 msgstr "প্রার্থিত ফ্যামিলি সমর্থিত নয়" 2475 2476 #: kdecore/k3resolver.cpp:541 2477 #, kde-format 2478 msgid "requested service not supported for this socket type" 2479 msgstr "প্রার্থিত সার্ভিস এই ধরনের সকেট-এর জন্য সমর্থিত নয়" 2480 2481 #: kdecore/k3resolver.cpp:542 2482 #, kde-format 2483 msgid "requested socket type not supported" 2484 msgstr "প্রার্থিত সকেট টাইপ সমর্থিত নয়" 2485 2486 #: kdecore/k3resolver.cpp:543 2487 #, kde-format 2488 msgid "unknown error" 2489 msgstr "অচেনা সমস্যা" 2490 2491 #: kdecore/k3resolver.cpp:545 2492 #, kde-format 2493 msgctxt "1: the i18n'ed system error code, from errno" 2494 msgid "system error: %1" 2495 msgstr "system error: %1" 2496 2497 #: kdecore/k3resolver.cpp:556 2498 #, kde-format 2499 msgid "request was canceled" 2500 msgstr "আবেদন বাতিল করা হয়েছে" 2501 2502 #: kdecore/k3socketaddress.cpp:631 2503 #, kde-format 2504 msgctxt "1: the unknown socket address family number" 2505 msgid "Unknown family %1" 2506 msgstr "অপরিচিত family %1" 2507 2508 #: kdecore/k3socketbase.cpp:215 2509 #, kde-format 2510 msgctxt "Socket error code NoError" 2511 msgid "no error" 2512 msgstr "কোন সমস্যা হয়নি" 2513 2514 #: kdecore/k3socketbase.cpp:220 2515 #, kde-format 2516 msgctxt "Socket error code LookupFailure" 2517 msgid "name lookup has failed" 2518 msgstr "নাম 'লুক-আপ' ব্যর্থ হয়েছে" 2519 2520 #: kdecore/k3socketbase.cpp:225 2521 #, kde-format 2522 msgctxt "Socket error code AddressInUse" 2523 msgid "address already in use" 2524 msgstr "ঠিকানা আগে থেকেই ব্যবহার করা হচ্ছে" 2525 2526 #: kdecore/k3socketbase.cpp:230 2527 #, kde-format 2528 msgctxt "Socket error code AlreadyBound" 2529 msgid "socket is already bound" 2530 msgstr "সকেট আগে থেকেই 'বাউণ্ড' করা রয়েছে" 2531 2532 #: kdecore/k3socketbase.cpp:235 2533 #, kde-format 2534 msgctxt "Socket error code AlreadyCreated" 2535 msgid "socket is already created" 2536 msgstr "সকেট আগে থেকেই তৈরি করা আছে" 2537 2538 #: kdecore/k3socketbase.cpp:240 2539 #, kde-format 2540 msgctxt "Socket error code NotBound" 2541 msgid "socket is not bound" 2542 msgstr "সকেট 'বাউণ্ড' করা নেই" 2543 2544 #: kdecore/k3socketbase.cpp:245 2545 #, kde-format 2546 msgctxt "Socket error code NotCreated" 2547 msgid "socket has not been created" 2548 msgstr "সকেট তৈরি করা হয়নি" 2549 2550 #: kdecore/k3socketbase.cpp:250 2551 #, kde-format 2552 msgctxt "Socket error code WouldBlock" 2553 msgid "operation would block" 2554 msgstr "অপারেশন ব্লক করবে" 2555 2556 #: kdecore/k3socketbase.cpp:255 2557 #, kde-format 2558 msgctxt "Socket error code ConnectionRefused" 2559 msgid "connection actively refused" 2560 msgstr "যোগাযোগ অস্বীকার করা হয়েছে" 2561 2562 #: kdecore/k3socketbase.cpp:260 2563 #, kde-format 2564 msgctxt "Socket error code ConnectionTimedOut" 2565 msgid "connection timed out" 2566 msgstr "যোগাযোগ টাইম-আউট হয়ে গেছে" 2567 2568 #: kdecore/k3socketbase.cpp:265 2569 #, kde-format 2570 msgctxt "Socket error code InProgress" 2571 msgid "operation is already in progress" 2572 msgstr "অপারেশন আগে থেকেই চলছে" 2573 2574 #: kdecore/k3socketbase.cpp:270 2575 #, kde-format 2576 msgctxt "Socket error code NetFailure" 2577 msgid "network failure occurred" 2578 msgstr "নেটওয়ার্ক সমস্যা ঘটেছে" 2579 2580 #: kdecore/k3socketbase.cpp:275 2581 #, kde-format 2582 msgctxt "Socket error code NotSupported" 2583 msgid "operation is not supported" 2584 msgstr "অপারেশন সমর্থিত নয়" 2585 2586 #: kdecore/k3socketbase.cpp:280 2587 #, kde-format 2588 msgctxt "Socket error code Timeout" 2589 msgid "timed operation timed out" 2590 msgstr "অপারেশন টাইম-আউট হয়েছে" 2591 2592 #: kdecore/k3socketbase.cpp:285 2593 #, kde-format 2594 msgctxt "Socket error code UnknownError" 2595 msgid "an unknown/unexpected error has happened" 2596 msgstr "একটি অজানা/অপ্রত্যাশিত সমস্যা ঘটেছে" 2597 2598 #: kdecore/k3socketbase.cpp:290 2599 #, kde-format 2600 msgctxt "Socket error code RemotelyDisconnected" 2601 msgid "remote host closed connection" 2602 msgstr "দূরবর্তী হোস্ট যোগাযোগ বিচ্ছিন্ন করেছে" 2603 2604 #: kdecore/k4aboutdata.cpp:267 2605 #, kde-format 2606 msgid "" 2607 "No licensing terms for this program have been specified.\n" 2608 "Please check the documentation or the source for any\n" 2609 "licensing terms.\n" 2610 msgstr "" 2611 2612 #: kdecore/k4aboutdata.cpp:273 2613 #, kde-format 2614 msgid "This program is distributed under the terms of the %1." 2615 msgstr "" 2616 2617 #: kdecore/k4aboutdata.cpp:297 2618 #, kde-format 2619 msgctxt "@item license (short name)" 2620 msgid "GPL v2" 2621 msgstr "জি-পি-এল v2" 2622 2623 #: kdecore/k4aboutdata.cpp:298 2624 #, kde-format 2625 msgctxt "@item license" 2626 msgid "GNU General Public License Version 2" 2627 msgstr "GNU General Public License Version 2" 2628 2629 #: kdecore/k4aboutdata.cpp:301 2630 #, kde-format 2631 msgctxt "@item license (short name)" 2632 msgid "LGPL v2" 2633 msgstr "এল-জি-পি-এল v2" 2634 2635 #: kdecore/k4aboutdata.cpp:302 2636 #, kde-format 2637 msgctxt "@item license" 2638 msgid "GNU Lesser General Public License Version 2" 2639 msgstr "GNU Lesser General Public License Version 2" 2640 2641 #: kdecore/k4aboutdata.cpp:305 2642 #, kde-format 2643 msgctxt "@item license (short name)" 2644 msgid "BSD License" 2645 msgstr "বি-এস-ডি লাইসেন্স" 2646 2647 #: kdecore/k4aboutdata.cpp:306 2648 #, kde-format 2649 msgctxt "@item license" 2650 msgid "BSD License" 2651 msgstr "বি-এস-ডি লাইসেন্স" 2652 2653 #: kdecore/k4aboutdata.cpp:309 2654 #, kde-format 2655 msgctxt "@item license (short name)" 2656 msgid "Artistic License" 2657 msgstr "আর্টিস্টিক লাইসেন্স" 2658 2659 #: kdecore/k4aboutdata.cpp:310 2660 #, kde-format 2661 msgctxt "@item license" 2662 msgid "Artistic License" 2663 msgstr "আর্টিস্টিক লাইসেন্স" 2664 2665 #: kdecore/k4aboutdata.cpp:313 2666 #, kde-format 2667 msgctxt "@item license (short name)" 2668 msgid "QPL v1.0" 2669 msgstr "QPL v1.0" 2670 2671 #: kdecore/k4aboutdata.cpp:314 2672 #, kde-format 2673 msgctxt "@item license" 2674 msgid "Q Public License" 2675 msgstr "কিউ পাবলিক লাইসেন্স" 2676 2677 #: kdecore/k4aboutdata.cpp:317 2678 #, kde-format 2679 msgctxt "@item license (short name)" 2680 msgid "GPL v3" 2681 msgstr "জি-পি-এল v3" 2682 2683 #: kdecore/k4aboutdata.cpp:318 2684 #, kde-format 2685 msgctxt "@item license" 2686 msgid "GNU General Public License Version 3" 2687 msgstr "GNU General Public License Version 3" 2688 2689 #: kdecore/k4aboutdata.cpp:321 2690 #, kde-format 2691 msgctxt "@item license (short name)" 2692 msgid "LGPL v3" 2693 msgstr "এল-জি-পি-এল v3" 2694 2695 #: kdecore/k4aboutdata.cpp:322 2696 #, kde-format 2697 msgctxt "@item license" 2698 msgid "GNU Lesser General Public License Version 3" 2699 msgstr "GNU Lesser General Public License Version 3" 2700 2701 #: kdecore/k4aboutdata.cpp:326 2702 #, kde-format 2703 msgctxt "@item license" 2704 msgid "Custom" 2705 msgstr "স্বনির্বাচিত" 2706 2707 #: kdecore/k4aboutdata.cpp:329 2708 #, kde-format 2709 msgctxt "@item license" 2710 msgid "Not specified" 2711 msgstr "নির্ধারিত হয়নি" 2712 2713 #: kdecore/k4aboutdata.cpp:891 2714 #, kde-format 2715 msgctxt "replace this with information about your translation team" 2716 msgid "" 2717 "<p>KDE is translated into many languages thanks to the work of the " 2718 "translation teams all over the world.</p><p>For more information on KDE " 2719 "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n.kde." 2720 "org</a></p>" 2721 msgstr "" 2722 "<p>সারা পৃথিবী জুড়ে বিভিন্ন প্রকল্পের সুবাদে কে.ডি.ই. অনেকগুলি ভাষায় অনুবাদ করা " 2723 "হচ্ছে। কে.ডি.ই. বাংলায় অনুবাদ করার কাজ করছে অঙ্কুর (http://www.AnkurBangla.org/" 2724 "projects/kde/)।</p><p>কে.ডি.ই. অনুবাদ সম্বন্ধে আরো জানতে দেখুন http://l10n.kde." 2725 "org</p>" 2726 2727 #: kdecore/kcalendarsystem.cpp:108 2728 #, kde-format 2729 msgctxt "@item Calendar system" 2730 msgid "Gregorian" 2731 msgstr "গ্রেগরিয়ান" 2732 2733 #: kdecore/kcalendarsystem.cpp:110 2734 #, fuzzy, kde-format 2735 msgctxt "@item Calendar system" 2736 msgid "Coptic" 2737 msgstr "Coptic" 2738 2739 #: kdecore/kcalendarsystem.cpp:112 2740 #, fuzzy, kde-format 2741 msgctxt "@item Calendar system" 2742 msgid "Ethiopian" 2743 msgstr "Ethiopic" 2744 2745 #: kdecore/kcalendarsystem.cpp:114 2746 #, kde-format 2747 msgctxt "@item Calendar system" 2748 msgid "Hebrew" 2749 msgstr "হীব্রু" 2750 2751 #: kdecore/kcalendarsystem.cpp:116 2752 #, kde-format 2753 msgctxt "@item Calendar system" 2754 msgid "Islamic / Hijri (Civil)" 2755 msgstr "" 2756 2757 #: kdecore/kcalendarsystem.cpp:118 2758 #, kde-format 2759 msgctxt "@item Calendar system" 2760 msgid "Indian National" 2761 msgstr "" 2762 2763 #: kdecore/kcalendarsystem.cpp:120 2764 #, kde-format 2765 msgctxt "@item Calendar system" 2766 msgid "Jalali" 2767 msgstr "Jalali" 2768 2769 #: kdecore/kcalendarsystem.cpp:122 2770 #, kde-format 2771 msgctxt "@item Calendar system" 2772 msgid "Japanese" 2773 msgstr "" 2774 2775 #: kdecore/kcalendarsystem.cpp:124 2776 #, fuzzy, kde-format 2777 msgctxt "@item Calendar system" 2778 msgid "Julian" 2779 msgstr "জানুয়ারী" 2780 2781 #: kdecore/kcalendarsystem.cpp:126 2782 #, kde-format 2783 msgctxt "@item Calendar system" 2784 msgid "Taiwanese" 2785 msgstr "" 2786 2787 #: kdecore/kcalendarsystem.cpp:128 2788 #, fuzzy, kde-format 2789 #| msgid "R. Thaani" 2790 msgctxt "@item Calendar system" 2791 msgid "Thai" 2792 msgstr "রবিউস সানি" 2793 2794 #: kdecore/kcalendarsystem.cpp:131 2795 #, kde-format 2796 msgctxt "@item Calendar system" 2797 msgid "Invalid Calendar Type" 2798 msgstr "অবৈধ ক্যালেণ্ডার টাইপ" 2799 2800 #: kdecore/kcalendarsystem.cpp:1495 2801 #, kde-format 2802 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 2803 msgid "-" 2804 msgstr "" 2805 2806 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 2807 #: kio/kfilemetadataprovider.cpp:199 2808 #, kde-format 2809 msgid "Today" 2810 msgstr "আজ" 2811 2812 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 2813 #: kio/kfilemetadataprovider.cpp:202 2814 #, kde-format 2815 msgid "Yesterday" 2816 msgstr "গতকাল" 2817 2818 #: kdecore/kcalendarsystemcoptic.cpp:45 2819 #, kde-format 2820 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" 2821 msgid "Anno Martyrum" 2822 msgstr "" 2823 2824 #: kdecore/kcalendarsystemcoptic.cpp:46 2825 #, kde-format 2826 msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" 2827 msgid "AM" 2828 msgstr "" 2829 2830 #: kdecore/kcalendarsystemcoptic.cpp:47 2831 #, kde-format 2832 msgctxt "" 2833 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 2834 msgid "%Ey %EC" 2835 msgstr "" 2836 2837 #: kdecore/kcalendarsystemcoptic.cpp:153 2838 #, kde-format 2839 msgctxt "Coptic month 1 - KLocale::NarrowName" 2840 msgid "T" 2841 msgstr "" 2842 2843 #: kdecore/kcalendarsystemcoptic.cpp:155 2844 #, kde-format 2845 msgctxt "Coptic month 2 - KLocale::NarrowName" 2846 msgid "P" 2847 msgstr "" 2848 2849 #: kdecore/kcalendarsystemcoptic.cpp:157 2850 #, kde-format 2851 msgctxt "Coptic month 3 - KLocale::NarrowName" 2852 msgid "H" 2853 msgstr "" 2854 2855 #: kdecore/kcalendarsystemcoptic.cpp:159 2856 #, kde-format 2857 msgctxt "Coptic month 4 - KLocale::NarrowName" 2858 msgid "K" 2859 msgstr "" 2860 2861 #: kdecore/kcalendarsystemcoptic.cpp:161 2862 #, kde-format 2863 msgctxt "Coptic month 5 - KLocale::NarrowName" 2864 msgid "T" 2865 msgstr "" 2866 2867 #: kdecore/kcalendarsystemcoptic.cpp:163 2868 #, kde-format 2869 msgctxt "Coptic month 6 - KLocale::NarrowName" 2870 msgid "M" 2871 msgstr "" 2872 2873 #: kdecore/kcalendarsystemcoptic.cpp:165 2874 #, kde-format 2875 msgctxt "Coptic month 7 - KLocale::NarrowName" 2876 msgid "P" 2877 msgstr "" 2878 2879 #: kdecore/kcalendarsystemcoptic.cpp:167 2880 #, kde-format 2881 msgctxt "Coptic month 8 - KLocale::NarrowName" 2882 msgid "P" 2883 msgstr "" 2884 2885 #: kdecore/kcalendarsystemcoptic.cpp:169 2886 #, kde-format 2887 msgctxt "Coptic month 9 - KLocale::NarrowName" 2888 msgid "P" 2889 msgstr "" 2890 2891 #: kdecore/kcalendarsystemcoptic.cpp:171 2892 #, kde-format 2893 msgctxt "Coptic month 10 - KLocale::NarrowName" 2894 msgid "P" 2895 msgstr "" 2896 2897 #: kdecore/kcalendarsystemcoptic.cpp:173 2898 #, kde-format 2899 msgctxt "Coptic month 11 - KLocale::NarrowName" 2900 msgid "E" 2901 msgstr "" 2902 2903 #: kdecore/kcalendarsystemcoptic.cpp:175 2904 #, kde-format 2905 msgctxt "Coptic month 12 - KLocale::NarrowName" 2906 msgid "M" 2907 msgstr "" 2908 2909 #: kdecore/kcalendarsystemcoptic.cpp:177 2910 #, kde-format 2911 msgctxt "Coptic month 13 - KLocale::NarrowName" 2912 msgid "K" 2913 msgstr "" 2914 2915 #: kdecore/kcalendarsystemcoptic.cpp:186 2916 #, fuzzy, kde-format 2917 msgctxt "Coptic month 1 - KLocale::ShortName Possessive" 2918 msgid "of Tho" 2919 msgstr "of Kho" 2920 2921 #: kdecore/kcalendarsystemcoptic.cpp:188 2922 #, fuzzy, kde-format 2923 msgctxt "Coptic month 2 - KLocale::ShortName Possessive" 2924 msgid "of Pao" 2925 msgstr "of Tamuz" 2926 2927 #: kdecore/kcalendarsystemcoptic.cpp:190 2928 #, fuzzy, kde-format 2929 msgctxt "Coptic month 3 - KLocale::ShortName Possessive" 2930 msgid "of Hat" 2931 msgstr "of Shvat" 2932 2933 #: kdecore/kcalendarsystemcoptic.cpp:192 2934 #, fuzzy, kde-format 2935 msgctxt "Coptic month 4 - KLocale::ShortName Possessive" 2936 msgid "of Kia" 2937 msgstr "of Nisan" 2938 2939 #: kdecore/kcalendarsystemcoptic.cpp:194 2940 #, fuzzy, kde-format 2941 msgctxt "Coptic month 5 - KLocale::ShortName Possessive" 2942 msgid "of Tob" 2943 msgstr "ফেব্রুয়ারীর" 2944 2945 #: kdecore/kcalendarsystemcoptic.cpp:196 2946 #, fuzzy, kde-format 2947 msgctxt "Coptic month 6 - KLocale::ShortName Possessive" 2948 msgid "of Mes" 2949 msgstr "of Meh" 2950 2951 #: kdecore/kcalendarsystemcoptic.cpp:198 2952 #, fuzzy, kde-format 2953 msgctxt "Coptic month 7 - KLocale::ShortName Possessive" 2954 msgid "of Par" 2955 msgstr "মার্চের" 2956 2957 #: kdecore/kcalendarsystemcoptic.cpp:200 2958 #, fuzzy, kde-format 2959 msgctxt "Coptic month 8 - KLocale::ShortName Possessive" 2960 msgid "of Pam" 2961 msgstr "of Tamuz" 2962 2963 #: kdecore/kcalendarsystemcoptic.cpp:202 2964 #, fuzzy, kde-format 2965 msgctxt "Coptic month 9 - KLocale::ShortName Possessive" 2966 msgid "of Pas" 2967 msgstr "of Bah" 2968 2969 #: kdecore/kcalendarsystemcoptic.cpp:204 2970 #, fuzzy, kde-format 2971 msgctxt "Coptic month 10 - KLocale::ShortName Possessive" 2972 msgid "of Pan" 2973 msgstr "জানুয়ারীর" 2974 2975 #: kdecore/kcalendarsystemcoptic.cpp:206 2976 #, fuzzy, kde-format 2977 msgctxt "Coptic month 11 - KLocale::ShortName Possessive" 2978 msgid "of Epe" 2979 msgstr "ফেব্রুয়ারীর" 2980 2981 #: kdecore/kcalendarsystemcoptic.cpp:208 2982 #, fuzzy, kde-format 2983 msgctxt "Coptic month 12 - KLocale::ShortName Possessive" 2984 msgid "of Meo" 2985 msgstr "of Mor" 2986 2987 #: kdecore/kcalendarsystemcoptic.cpp:210 2988 #, fuzzy, kde-format 2989 msgctxt "Coptic month 13 - KLocale::ShortName Possessive" 2990 msgid "of Kou" 2991 msgstr "of Kho" 2992 2993 #: kdecore/kcalendarsystemcoptic.cpp:219 2994 #, fuzzy, kde-format 2995 msgctxt "Coptic month 1 - KLocale::ShortName" 2996 msgid "Tho" 2997 msgstr "সালাসা (মঙ্গল)" 2998 2999 #: kdecore/kcalendarsystemcoptic.cpp:221 3000 #, fuzzy, kde-format 3001 msgctxt "Coptic month 2 - KLocale::ShortName" 3002 msgid "Pao" 3003 msgstr "স্থগিত রাখো" 3004 3005 #: kdecore/kcalendarsystemcoptic.cpp:223 3006 #, fuzzy, kde-format 3007 msgctxt "Coptic month 3 - KLocale::ShortName" 3008 msgid "Hat" 3009 msgstr "শনি" 3010 3011 #: kdecore/kcalendarsystemcoptic.cpp:225 3012 #, fuzzy, kde-format 3013 msgctxt "Coptic month 4 - KLocale::ShortName" 3014 msgid "Kia" 3015 msgstr "খামিস (বৃহঃ)" 3016 3017 #: kdecore/kcalendarsystemcoptic.cpp:227 3018 #, fuzzy, kde-format 3019 msgctxt "Coptic month 5 - KLocale::ShortName" 3020 msgid "Tob" 3021 msgstr "কাজ (Job)" 3022 3023 #: kdecore/kcalendarsystemcoptic.cpp:229 3024 #, fuzzy, kde-format 3025 msgctxt "Coptic month 6 - KLocale::ShortName" 3026 msgid "Mes" 3027 msgstr "হ্যাঁ" 3028 3029 #: kdecore/kcalendarsystemcoptic.cpp:231 3030 #, fuzzy, kde-format 3031 msgctxt "Coptic month 7 - KLocale::ShortName" 3032 msgid "Par" 3033 msgstr "মার্চ" 3034 3035 #: kdecore/kcalendarsystemcoptic.cpp:233 3036 #, fuzzy, kde-format 3037 msgctxt "Coptic month 8 - KLocale::ShortName" 3038 msgid "Pam" 3039 msgstr "এ.এম." 3040 3041 #: kdecore/kcalendarsystemcoptic.cpp:235 3042 #, fuzzy, kde-format 3043 msgctxt "Coptic month 9 - KLocale::ShortName" 3044 msgid "Pas" 3045 msgstr "পৃষ্ঠা" 3046 3047 #: kdecore/kcalendarsystemcoptic.cpp:237 3048 #, fuzzy, kde-format 3049 msgctxt "Coptic month 10 - KLocale::ShortName" 3050 msgid "Pan" 3051 msgstr "জানুয়ারী" 3052 3053 #: kdecore/kcalendarsystemcoptic.cpp:239 3054 #, fuzzy, kde-format 3055 msgctxt "Coptic month 11 - KLocale::ShortName" 3056 msgid "Epe" 3057 msgstr "এস্কেপ" 3058 3059 #: kdecore/kcalendarsystemcoptic.cpp:241 3060 #, fuzzy, kde-format 3061 msgctxt "Coptic month 12 - KLocale::ShortName" 3062 msgid "Meo" 3063 msgstr "সোম" 3064 3065 #: kdecore/kcalendarsystemcoptic.cpp:243 3066 #, fuzzy, kde-format 3067 msgctxt "Coptic month 12 - KLocale::ShortName" 3068 msgid "Kou" 3069 msgstr "Kho" 3070 3071 #: kdecore/kcalendarsystemcoptic.cpp:252 3072 #, fuzzy, kde-format 3073 msgctxt "Coptic month 1 - KLocale::LongName Possessive" 3074 msgid "of Thoout" 3075 msgstr "of Kho" 3076 3077 #: kdecore/kcalendarsystemcoptic.cpp:254 3078 #, fuzzy, kde-format 3079 msgctxt "Coptic month 2 - KLocale::LongName Possessive" 3080 msgid "of Paope" 3081 msgstr "of Tamuz" 3082 3083 #: kdecore/kcalendarsystemcoptic.cpp:256 3084 #, fuzzy, kde-format 3085 msgctxt "Coptic month 3 - KLocale::LongName Possessive" 3086 msgid "of Hathor" 3087 msgstr "জিলহাজ" 3088 3089 #: kdecore/kcalendarsystemcoptic.cpp:258 3090 #, fuzzy, kde-format 3091 msgctxt "Coptic month 4 - KLocale::LongName Possessive" 3092 msgid "of Kiahk" 3093 msgstr "of Kho" 3094 3095 #: kdecore/kcalendarsystemcoptic.cpp:260 3096 #, fuzzy, kde-format 3097 msgctxt "Coptic month 5 - KLocale::LongName Possessive" 3098 msgid "of Tobe" 3099 msgstr "অক্টোবরের" 3100 3101 #: kdecore/kcalendarsystemcoptic.cpp:262 3102 #, fuzzy, kde-format 3103 msgctxt "Coptic month 6 - KLocale::LongName Possessive" 3104 msgid "of Meshir" 3105 msgstr "of Mehr" 3106 3107 #: kdecore/kcalendarsystemcoptic.cpp:264 3108 #, fuzzy, kde-format 3109 msgctxt "Coptic month 7 - KLocale::LongName Possessive" 3110 msgid "of Paremhotep" 3111 msgstr "প্যারামিটার" 3112 3113 #: kdecore/kcalendarsystemcoptic.cpp:266 3114 #, fuzzy, kde-format 3115 msgctxt "Coptic month 8 - KLocale::LongName Possessive" 3116 msgid "of Parmoute" 3117 msgstr "of Tamuz" 3118 3119 #: kdecore/kcalendarsystemcoptic.cpp:268 3120 #, fuzzy, kde-format 3121 msgctxt "Coptic month 9 - KLocale::LongName Possessive" 3122 msgid "of Pashons" 3123 msgstr "of Bah" 3124 3125 #: kdecore/kcalendarsystemcoptic.cpp:270 3126 #, fuzzy, kde-format 3127 msgctxt "Coptic month 10 - KLocale::LongName Possessive" 3128 msgid "of Paone" 3129 msgstr "জানুয়ারীর" 3130 3131 #: kdecore/kcalendarsystemcoptic.cpp:272 3132 #, fuzzy, kde-format 3133 msgctxt "Coptic month 11 - KLocale::LongName Possessive" 3134 msgid "of Epep" 3135 msgstr "সেপ্টেম্বরের" 3136 3137 #: kdecore/kcalendarsystemcoptic.cpp:274 3138 #, fuzzy, kde-format 3139 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3140 msgid "of Mesore" 3141 msgstr "of Mor" 3142 3143 #: kdecore/kcalendarsystemcoptic.cpp:276 3144 #, fuzzy, kde-format 3145 msgctxt "Coptic month 12 - KLocale::LongName Possessive" 3146 msgid "of Kouji nabot" 3147 msgstr "ফেব্রুয়ারীর" 3148 3149 #: kdecore/kcalendarsystemcoptic.cpp:285 3150 #, fuzzy, kde-format 3151 msgctxt "Coptic month 1 - KLocale::LongName" 3152 msgid "Thoout" 3153 msgstr "বৃহঃ" 3154 3155 #: kdecore/kcalendarsystemcoptic.cpp:287 3156 #, fuzzy, kde-format 3157 msgctxt "Coptic month 2 - KLocale::LongName" 3158 msgid "Paope" 3159 msgstr "বৈশিষ্ট্য" 3160 3161 #: kdecore/kcalendarsystemcoptic.cpp:289 3162 #, fuzzy, kde-format 3163 msgctxt "Coptic month 3 - KLocale::LongName" 3164 msgid "Hathor" 3165 msgstr "লেখক" 3166 3167 #: kdecore/kcalendarsystemcoptic.cpp:291 3168 #, fuzzy, kde-format 3169 msgctxt "Coptic month 4 - KLocale::LongName" 3170 msgid "Kiahk" 3171 msgstr "of Kho" 3172 3173 #: kdecore/kcalendarsystemcoptic.cpp:293 3174 #, fuzzy, kde-format 3175 msgctxt "Coptic month 5 - KLocale::LongName" 3176 msgid "Tobe" 3177 msgstr "কাজ (Job)" 3178 3179 #: kdecore/kcalendarsystemcoptic.cpp:295 3180 #, fuzzy, kde-format 3181 msgctxt "Coptic month 6 - KLocale::LongName" 3182 msgid "Meshir" 3183 msgstr "মেহর" 3184 3185 #: kdecore/kcalendarsystemcoptic.cpp:297 3186 #, fuzzy, kde-format 3187 msgctxt "Coptic month 7 - KLocale::LongName" 3188 msgid "Paremhotep" 3189 msgstr "প্যারামিটার" 3190 3191 #: kdecore/kcalendarsystemcoptic.cpp:299 3192 #, fuzzy, kde-format 3193 msgctxt "Coptic month 8 - KLocale::LongName" 3194 msgid "Parmoute" 3195 msgstr "প্যারামিটার" 3196 3197 #: kdecore/kcalendarsystemcoptic.cpp:301 3198 #, fuzzy, kde-format 3199 msgctxt "Coptic month 9 - KLocale::LongName" 3200 msgid "Pashons" 3201 msgstr "স্থগিত রাখো" 3202 3203 #: kdecore/kcalendarsystemcoptic.cpp:303 3204 #, fuzzy, kde-format 3205 msgctxt "Coptic month 10 - KLocale::LongName" 3206 msgid "Paone" 3207 msgstr "কিছু না" 3208 3209 #: kdecore/kcalendarsystemcoptic.cpp:305 3210 #, fuzzy, kde-format 3211 msgctxt "Coptic month 11 - KLocale::LongName" 3212 msgid "Epep" 3213 msgstr "এস্কেপ" 3214 3215 #: kdecore/kcalendarsystemcoptic.cpp:307 3216 #, fuzzy, kde-format 3217 msgctxt "Coptic month 12 - KLocale::LongName" 3218 msgid "Mesore" 3219 msgstr "&আগের মত" 3220 3221 #: kdecore/kcalendarsystemcoptic.cpp:309 3222 #, fuzzy, kde-format 3223 msgctxt "Coptic month 12 - KLocale::LongName" 3224 msgid "Kouji nabot" 3225 msgstr "ফেব্রুয়ারীর" 3226 3227 #: kdecore/kcalendarsystemcoptic.cpp:324 3228 #, kde-format 3229 msgctxt "Coptic weekday 1 - KLocale::NarrowName" 3230 msgid "P" 3231 msgstr "" 3232 3233 #: kdecore/kcalendarsystemcoptic.cpp:326 3234 #, kde-format 3235 msgctxt "Coptic weekday 2 - KLocale::NarrowName" 3236 msgid "P" 3237 msgstr "" 3238 3239 #: kdecore/kcalendarsystemcoptic.cpp:328 3240 #, kde-format 3241 msgctxt "Coptic weekday 3 - KLocale::NarrowName" 3242 msgid "P" 3243 msgstr "" 3244 3245 #: kdecore/kcalendarsystemcoptic.cpp:330 3246 #, kde-format 3247 msgctxt "Coptic weekday 4 - KLocale::NarrowName" 3248 msgid "P" 3249 msgstr "" 3250 3251 #: kdecore/kcalendarsystemcoptic.cpp:332 3252 #, kde-format 3253 msgctxt "Coptic weekday 5 - KLocale::NarrowName" 3254 msgid "P" 3255 msgstr "" 3256 3257 #: kdecore/kcalendarsystemcoptic.cpp:334 3258 #, kde-format 3259 msgctxt "Coptic weekday 6 - KLocale::NarrowName" 3260 msgid "P" 3261 msgstr "" 3262 3263 #: kdecore/kcalendarsystemcoptic.cpp:336 3264 #, kde-format 3265 msgctxt "Coptic weekday 7 - KLocale::NarrowName" 3266 msgid "T" 3267 msgstr "" 3268 3269 #: kdecore/kcalendarsystemcoptic.cpp:345 3270 #, fuzzy, kde-format 3271 msgctxt "Coptic weekday 1 - KLocale::ShortName" 3272 msgid "Pes" 3273 msgstr "পৃষ্ঠা" 3274 3275 #: kdecore/kcalendarsystemcoptic.cpp:347 3276 #, fuzzy, kde-format 3277 msgctxt "Coptic weekday 2 - KLocale::ShortName" 3278 msgid "Psh" 3279 msgstr "স্থগিত রাখো" 3280 3281 #: kdecore/kcalendarsystemcoptic.cpp:349 3282 #, fuzzy, kde-format 3283 msgctxt "Coptic weekday 3 - KLocale::ShortName" 3284 msgid "Pef" 3285 msgstr "পৃষ্ঠা" 3286 3287 #: kdecore/kcalendarsystemcoptic.cpp:351 3288 #, kde-format 3289 msgctxt "Coptic weekday 4 - KLocale::ShortName" 3290 msgid "Pti" 3291 msgstr "" 3292 3293 #: kdecore/kcalendarsystemcoptic.cpp:353 3294 #, fuzzy, kde-format 3295 msgctxt "Coptic weekday 5 - KLocale::ShortName" 3296 msgid "Pso" 3297 msgstr "স্থগিত রাখো" 3298 3299 #: kdecore/kcalendarsystemcoptic.cpp:355 3300 #, fuzzy, kde-format 3301 msgctxt "Coptic weekday 6 - KLocale::ShortName" 3302 msgid "Psa" 3303 msgstr "স্থগিত রাখো" 3304 3305 #: kdecore/kcalendarsystemcoptic.cpp:357 3306 #, kde-format 3307 msgctxt "Coptic weekday 7 - KLocale::ShortName" 3308 msgid "Tky" 3309 msgstr "" 3310 3311 #: kdecore/kcalendarsystemcoptic.cpp:365 3312 #, fuzzy, kde-format 3313 msgctxt "Coptic weekday 1 - KLocale::LongName" 3314 msgid "Pesnau" 3315 msgstr "স্থগিত রাখো" 3316 3317 #: kdecore/kcalendarsystemcoptic.cpp:367 3318 #, fuzzy, kde-format 3319 msgctxt "Coptic weekday 2 - KLocale::LongName" 3320 msgid "Pshoment" 3321 msgstr "মন্তব্য" 3322 3323 #: kdecore/kcalendarsystemcoptic.cpp:369 3324 #, kde-format 3325 msgctxt "Coptic weekday 3 - KLocale::LongName" 3326 msgid "Peftoou" 3327 msgstr "" 3328 3329 #: kdecore/kcalendarsystemcoptic.cpp:371 3330 #, kde-format 3331 msgctxt "Coptic weekday 4 - KLocale::LongName" 3332 msgid "Ptiou" 3333 msgstr "" 3334 3335 #: kdecore/kcalendarsystemcoptic.cpp:373 3336 #, fuzzy, kde-format 3337 msgctxt "Coptic weekday 5 - KLocale::LongName" 3338 msgid "Psoou" 3339 msgstr "স্থগিত রাখো" 3340 3341 #: kdecore/kcalendarsystemcoptic.cpp:375 3342 #, kde-format 3343 msgctxt "Coptic weekday 6 - KLocale::LongName" 3344 msgid "Psabbaton" 3345 msgstr "" 3346 3347 #: kdecore/kcalendarsystemcoptic.cpp:377 3348 #, kde-format 3349 msgctxt "Coptic weekday 7 - KLocale::LongName" 3350 msgid "Tkyriakē" 3351 msgstr "" 3352 3353 #: kdecore/kcalendarsystemethiopian.cpp:50 3354 #, kde-format 3355 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 3356 msgid "Amata Mehrat" 3357 msgstr "" 3358 3359 #: kdecore/kcalendarsystemethiopian.cpp:51 3360 #, kde-format 3361 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 3362 msgid "AM" 3363 msgstr "" 3364 3365 #: kdecore/kcalendarsystemethiopian.cpp:52 3366 #, kde-format 3367 msgctxt "" 3368 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 3369 msgid "%Ey %EC" 3370 msgstr "" 3371 3372 #: kdecore/kcalendarsystemethiopian.cpp:66 3373 #, kde-format 3374 msgctxt "Ethiopian month 1 - KLocale::NarrowName" 3375 msgid "M" 3376 msgstr "" 3377 3378 #: kdecore/kcalendarsystemethiopian.cpp:68 3379 #, kde-format 3380 msgctxt "Ethiopian month 2 - KLocale::NarrowName" 3381 msgid "T" 3382 msgstr "" 3383 3384 #: kdecore/kcalendarsystemethiopian.cpp:70 3385 #, kde-format 3386 msgctxt "Ethiopian month 3 - KLocale::NarrowName" 3387 msgid "H" 3388 msgstr "" 3389 3390 #: kdecore/kcalendarsystemethiopian.cpp:72 3391 #, kde-format 3392 msgctxt "Ethiopian month 4 - KLocale::NarrowName" 3393 msgid "T" 3394 msgstr "" 3395 3396 #: kdecore/kcalendarsystemethiopian.cpp:74 3397 #, kde-format 3398 msgctxt "Ethiopian month 5 - KLocale::NarrowName" 3399 msgid "T" 3400 msgstr "" 3401 3402 #: kdecore/kcalendarsystemethiopian.cpp:76 3403 #, kde-format 3404 msgctxt "Ethiopian month 6 - KLocale::NarrowName" 3405 msgid "Y" 3406 msgstr "" 3407 3408 #: kdecore/kcalendarsystemethiopian.cpp:78 3409 #, kde-format 3410 msgctxt "Ethiopian month 7 - KLocale::NarrowName" 3411 msgid "M" 3412 msgstr "" 3413 3414 #: kdecore/kcalendarsystemethiopian.cpp:80 3415 #, kde-format 3416 msgctxt "Ethiopian month 8 - KLocale::NarrowName" 3417 msgid "M" 3418 msgstr "" 3419 3420 #: kdecore/kcalendarsystemethiopian.cpp:82 3421 #, kde-format 3422 msgctxt "Ethiopian month 9 - KLocale::NarrowName" 3423 msgid "G" 3424 msgstr "" 3425 3426 #: kdecore/kcalendarsystemethiopian.cpp:84 3427 #, kde-format 3428 msgctxt "Ethiopian month 10 - KLocale::NarrowName" 3429 msgid "S" 3430 msgstr "" 3431 3432 #: kdecore/kcalendarsystemethiopian.cpp:86 3433 #, kde-format 3434 msgctxt "Ethiopian month 11 - KLocale::NarrowName" 3435 msgid "H" 3436 msgstr "" 3437 3438 #: kdecore/kcalendarsystemethiopian.cpp:88 3439 #, kde-format 3440 msgctxt "Ethiopian month 12 - KLocale::NarrowName" 3441 msgid "N" 3442 msgstr "" 3443 3444 #: kdecore/kcalendarsystemethiopian.cpp:90 3445 #, kde-format 3446 msgctxt "Ethiopian month 13 - KLocale::NarrowName" 3447 msgid "P" 3448 msgstr "" 3449 3450 #: kdecore/kcalendarsystemethiopian.cpp:99 3451 #, fuzzy, kde-format 3452 msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" 3453 msgid "of Mes" 3454 msgstr "of Meh" 3455 3456 #: kdecore/kcalendarsystemethiopian.cpp:101 3457 #, fuzzy, kde-format 3458 msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" 3459 msgid "of Teq" 3460 msgstr "of Tevet" 3461 3462 #: kdecore/kcalendarsystemethiopian.cpp:103 3463 #, fuzzy, kde-format 3464 msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" 3465 msgid "of Hed" 3466 msgstr "ফেব্রুয়ারীর" 3467 3468 #: kdecore/kcalendarsystemethiopian.cpp:105 3469 #, fuzzy, kde-format 3470 msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" 3471 msgid "of Tah" 3472 msgstr "of Bah" 3473 3474 #: kdecore/kcalendarsystemethiopian.cpp:107 3475 #, fuzzy, kde-format 3476 msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" 3477 msgid "of Ter" 3478 msgstr "of Tir" 3479 3480 #: kdecore/kcalendarsystemethiopian.cpp:109 3481 #, fuzzy, kde-format 3482 msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" 3483 msgid "of Yak" 3484 msgstr "জানুয়ারীর" 3485 3486 #: kdecore/kcalendarsystemethiopian.cpp:111 3487 #, fuzzy, kde-format 3488 msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" 3489 msgid "of Mag" 3490 msgstr "মার্চের" 3491 3492 #: kdecore/kcalendarsystemethiopian.cpp:113 3493 #, fuzzy, kde-format 3494 msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" 3495 msgid "of Miy" 3496 msgstr "মের" 3497 3498 #: kdecore/kcalendarsystemethiopian.cpp:115 3499 #, fuzzy, kde-format 3500 msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" 3501 msgid "of Gen" 3502 msgstr "জানুয়ারীর" 3503 3504 #: kdecore/kcalendarsystemethiopian.cpp:117 3505 #, fuzzy, kde-format 3506 msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" 3507 msgid "of Sen" 3508 msgstr "সেপ্টেম্বরের" 3509 3510 #: kdecore/kcalendarsystemethiopian.cpp:119 3511 #, fuzzy, kde-format 3512 msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" 3513 msgid "of Ham" 3514 msgstr "of Tamuz" 3515 3516 #: kdecore/kcalendarsystemethiopian.cpp:121 3517 #, fuzzy, kde-format 3518 msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" 3519 msgid "of Neh" 3520 msgstr "of Meh" 3521 3522 #: kdecore/kcalendarsystemethiopian.cpp:123 3523 #, fuzzy, kde-format 3524 msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" 3525 msgid "of Pag" 3526 msgstr "of Tamuz" 3527 3528 #: kdecore/kcalendarsystemethiopian.cpp:132 3529 #, fuzzy, kde-format 3530 msgctxt "Ethiopian month 1 - KLocale::ShortName" 3531 msgid "Mes" 3532 msgstr "হ্যাঁ" 3533 3534 #: kdecore/kcalendarsystemethiopian.cpp:134 3535 #, fuzzy, kde-format 3536 msgctxt "Ethiopian month 2 - KLocale::ShortName" 3537 msgid "Teq" 3538 msgstr "মঙ্গল" 3539 3540 #: kdecore/kcalendarsystemethiopian.cpp:136 3541 #, fuzzy, kde-format 3542 msgctxt "Ethiopian month 3 - KLocale::ShortName" 3543 msgid "Hed" 3544 msgstr "বুধ" 3545 3546 #: kdecore/kcalendarsystemethiopian.cpp:138 3547 #, fuzzy, kde-format 3548 msgctxt "Ethiopian month 4 - KLocale::ShortName" 3549 msgid "Tah" 3550 msgstr "কাজ" 3551 3552 #: kdecore/kcalendarsystemethiopian.cpp:140 3553 #, fuzzy, kde-format 3554 msgctxt "Ethiopian month 5 - KLocale::ShortName" 3555 msgid "Ter" 3556 msgstr "মঙ্গল" 3557 3558 #: kdecore/kcalendarsystemethiopian.cpp:142 3559 #, fuzzy, kde-format 3560 msgctxt "Ethiopian month 6 - KLocale::ShortName" 3561 msgid "Yak" 3562 msgstr "জানুয়ারীর" 3563 3564 #: kdecore/kcalendarsystemethiopian.cpp:144 3565 #, fuzzy, kde-format 3566 msgctxt "Ethiopian month 7 - KLocale::ShortName" 3567 msgid "Mag" 3568 msgstr "মার্চ" 3569 3570 #: kdecore/kcalendarsystemethiopian.cpp:146 3571 #, fuzzy, kde-format 3572 msgctxt "Ethiopian month 8 - KLocale::ShortName" 3573 msgid "Miy" 3574 msgstr "মে" 3575 3576 #: kdecore/kcalendarsystemethiopian.cpp:148 3577 #, fuzzy, kde-format 3578 msgctxt "Ethiopian month 9 - KLocale::ShortName" 3579 msgid "Gen" 3580 msgstr "সবুজ:" 3581 3582 #: kdecore/kcalendarsystemethiopian.cpp:150 3583 #, fuzzy, kde-format 3584 msgctxt "Ethiopian month 10 - KLocale::ShortName" 3585 msgid "Sen" 3586 msgstr "পাঠা&ও" 3587 3588 #: kdecore/kcalendarsystemethiopian.cpp:152 3589 #, fuzzy, kde-format 3590 msgctxt "Ethiopian month 11 - KLocale::ShortName" 3591 msgid "Ham" 3592 msgstr "এ.এম." 3593 3594 #: kdecore/kcalendarsystemethiopian.cpp:154 3595 #, fuzzy, kde-format 3596 msgctxt "Ethiopian month 12 - KLocale::ShortName" 3597 msgid "Neh" 3598 msgstr "Meh" 3599 3600 #: kdecore/kcalendarsystemethiopian.cpp:156 3601 #, fuzzy, kde-format 3602 msgctxt "Ethiopian month 13 - KLocale::ShortName" 3603 msgid "Pag" 3604 msgstr "পৃষ্ঠা" 3605 3606 #: kdecore/kcalendarsystemethiopian.cpp:165 3607 #, fuzzy, kde-format 3608 msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" 3609 msgid "of Meskerem" 3610 msgstr "of Mehr" 3611 3612 #: kdecore/kcalendarsystemethiopian.cpp:167 3613 #, fuzzy, kde-format 3614 msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" 3615 msgid "of Tequemt" 3616 msgstr "of Tevet" 3617 3618 #: kdecore/kcalendarsystemethiopian.cpp:169 3619 #, fuzzy, kde-format 3620 msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" 3621 msgid "of Hedar" 3622 msgstr "of Adar" 3623 3624 #: kdecore/kcalendarsystemethiopian.cpp:171 3625 #, fuzzy, kde-format 3626 msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" 3627 msgid "of Tahsas" 3628 msgstr "of Bahman" 3629 3630 #: kdecore/kcalendarsystemethiopian.cpp:173 3631 #, fuzzy, kde-format 3632 msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" 3633 msgid "of Ter" 3634 msgstr "of Tir" 3635 3636 #: kdecore/kcalendarsystemethiopian.cpp:175 3637 #, fuzzy, kde-format 3638 msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" 3639 msgid "of Yakatit" 3640 msgstr "of Far" 3641 3642 #: kdecore/kcalendarsystemethiopian.cpp:177 3643 #, fuzzy, kde-format 3644 msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" 3645 msgid "of Magabit" 3646 msgstr "রজবের" 3647 3648 #: kdecore/kcalendarsystemethiopian.cpp:179 3649 #, fuzzy, kde-format 3650 msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" 3651 msgid "of Miyazya" 3652 msgstr "মের" 3653 3654 #: kdecore/kcalendarsystemethiopian.cpp:181 3655 #, fuzzy, kde-format 3656 msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" 3657 msgid "of Genbot" 3658 msgstr "ফেব্রুয়ারীর" 3659 3660 #: kdecore/kcalendarsystemethiopian.cpp:183 3661 #, fuzzy, kde-format 3662 msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" 3663 msgid "of Sene" 3664 msgstr "সেপ্টেম্বরের" 3665 3666 #: kdecore/kcalendarsystemethiopian.cpp:185 3667 #, fuzzy, kde-format 3668 msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" 3669 msgid "of Hamle" 3670 msgstr "of Tamuz" 3671 3672 #: kdecore/kcalendarsystemethiopian.cpp:187 3673 #, fuzzy, kde-format 3674 msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" 3675 msgid "of Nehase" 3676 msgstr "of Sha" 3677 3678 #: kdecore/kcalendarsystemethiopian.cpp:189 3679 #, fuzzy, kde-format 3680 msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" 3681 msgid "of Pagumen" 3682 msgstr "of Tamuz" 3683 3684 #: kdecore/kcalendarsystemethiopian.cpp:198 3685 #, fuzzy, kde-format 3686 msgctxt "Ethiopian month 1 - KLocale::LongName" 3687 msgid "Meskerem" 3688 msgstr "of Mehr" 3689 3690 #: kdecore/kcalendarsystemethiopian.cpp:200 3691 #, fuzzy, kde-format 3692 msgctxt "Ethiopian month 2 - KLocale::LongName" 3693 msgid "Tequemt" 3694 msgstr "তেভেত" 3695 3696 #: kdecore/kcalendarsystemethiopian.cpp:202 3697 #, fuzzy, kde-format 3698 msgctxt "Ethiopian month 3 - KLocale::LongName" 3699 msgid "Hedar" 3700 msgstr "আদার" 3701 3702 #: kdecore/kcalendarsystemethiopian.cpp:204 3703 #, fuzzy, kde-format 3704 msgctxt "Ethiopian month 4 - KLocale::LongName" 3705 msgid "Tahsas" 3706 msgstr "কাজ" 3707 3708 #: kdecore/kcalendarsystemethiopian.cpp:206 3709 #, fuzzy, kde-format 3710 msgctxt "Ethiopian month 5 - KLocale::LongName" 3711 msgid "Ter" 3712 msgstr "মঙ্গল" 3713 3714 #: kdecore/kcalendarsystemethiopian.cpp:208 3715 #, fuzzy, kde-format 3716 msgctxt "Ethiopian month 6 - KLocale::LongName" 3717 msgid "Yakatit" 3718 msgstr "of Far" 3719 3720 #: kdecore/kcalendarsystemethiopian.cpp:210 3721 #, fuzzy, kde-format 3722 msgctxt "Ethiopian month 7 - KLocale::LongName" 3723 msgid "Magabit" 3724 msgstr "রজবের" 3725 3726 #: kdecore/kcalendarsystemethiopian.cpp:212 3727 #, fuzzy, kde-format 3728 msgctxt "Ethiopian month 8 - KLocale::LongName" 3729 msgid "Miyazya" 3730 msgstr "মের" 3731 3732 #: kdecore/kcalendarsystemethiopian.cpp:214 3733 #, fuzzy, kde-format 3734 msgctxt "Ethiopian month 9 - KLocale::LongName" 3735 msgid "Genbot" 3736 msgstr "ফেব্রুয়ারীর" 3737 3738 #: kdecore/kcalendarsystemethiopian.cpp:216 3739 #, fuzzy, kde-format 3740 msgctxt "Ethiopian month 10 - KLocale::LongName" 3741 msgid "Sene" 3742 msgstr "পাঠা&ও" 3743 3744 #: kdecore/kcalendarsystemethiopian.cpp:218 3745 #, fuzzy, kde-format 3746 msgctxt "Ethiopian month 11 - KLocale::LongName" 3747 msgid "Hamle" 3748 msgstr "নাম" 3749 3750 #: kdecore/kcalendarsystemethiopian.cpp:220 3751 #, fuzzy, kde-format 3752 msgctxt "Ethiopian month 12 - KLocale::LongName" 3753 msgid "Nehase" 3754 msgstr "নাম" 3755 3756 #: kdecore/kcalendarsystemethiopian.cpp:222 3757 #, fuzzy, kde-format 3758 msgctxt "Ethiopian month 13 - KLocale::LongName" 3759 msgid "Pagumen" 3760 msgstr "পৃষ্ঠা" 3761 3762 #: kdecore/kcalendarsystemethiopian.cpp:236 3763 #, kde-format 3764 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " 3765 msgid "S" 3766 msgstr "" 3767 3768 #: kdecore/kcalendarsystemethiopian.cpp:238 3769 #, kde-format 3770 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " 3771 msgid "M" 3772 msgstr "" 3773 3774 #: kdecore/kcalendarsystemethiopian.cpp:240 3775 #, kde-format 3776 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " 3777 msgid "R" 3778 msgstr "" 3779 3780 #: kdecore/kcalendarsystemethiopian.cpp:242 3781 #, kde-format 3782 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " 3783 msgid "H" 3784 msgstr "" 3785 3786 #: kdecore/kcalendarsystemethiopian.cpp:244 3787 #, fuzzy, kde-format 3788 #| msgid "Av" 3789 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " 3790 msgid "A" 3791 msgstr "আভ" 3792 3793 #: kdecore/kcalendarsystemethiopian.cpp:246 3794 #, kde-format 3795 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " 3796 msgid "Q" 3797 msgstr "" 3798 3799 #: kdecore/kcalendarsystemethiopian.cpp:248 3800 #, kde-format 3801 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " 3802 msgid "E" 3803 msgstr "" 3804 3805 #: kdecore/kcalendarsystemethiopian.cpp:257 3806 #, fuzzy, kde-format 3807 msgctxt "Ethiopian weekday 1 - KLocale::ShortName" 3808 msgid "Seg" 3809 msgstr "সেপ্টেম্বর" 3810 3811 #: kdecore/kcalendarsystemethiopian.cpp:259 3812 #, fuzzy, kde-format 3813 msgctxt "Ethiopian weekday 2 - KLocale::ShortName" 3814 msgid "Mak" 3815 msgstr "মার্চ" 3816 3817 #: kdecore/kcalendarsystemethiopian.cpp:261 3818 #, fuzzy, kde-format 3819 msgctxt "Ethiopian weekday 3 - KLocale::ShortName" 3820 msgid "Rob" 3821 msgstr "কাজ (Job)" 3822 3823 #: kdecore/kcalendarsystemethiopian.cpp:263 3824 #, fuzzy, kde-format 3825 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" 3826 msgid "Ham" 3827 msgstr "এ.এম." 3828 3829 #: kdecore/kcalendarsystemethiopian.cpp:265 3830 #, fuzzy, kde-format 3831 #| msgid "Arb" 3832 msgctxt "Ethiopian weekday 5 - KLocale::ShortName" 3833 msgid "Arb" 3834 msgstr "আরবা (বুধ)" 3835 3836 #: kdecore/kcalendarsystemethiopian.cpp:267 3837 #, fuzzy, kde-format 3838 msgctxt "Ethiopian weekday 6 - KLocale::ShortName" 3839 msgid "Qed" 3840 msgstr "বুধ" 3841 3842 #: kdecore/kcalendarsystemethiopian.cpp:269 3843 #, fuzzy, kde-format 3844 msgctxt "Ethiopian weekday 7 - KLocale::ShortName" 3845 msgid "Ehu" 3846 msgstr "বৃহঃ" 3847 3848 #: kdecore/kcalendarsystemethiopian.cpp:276 3849 #, fuzzy, kde-format 3850 msgctxt "Ethiopian weekday 1 - KLocale::LongName" 3851 msgid "Segno" 3852 msgstr "পাঠা&ও" 3853 3854 #: kdecore/kcalendarsystemethiopian.cpp:278 3855 #, fuzzy, kde-format 3856 msgctxt "Ethiopian weekday 2 - KLocale::LongName" 3857 msgid "Maksegno" 3858 msgstr "পাঠা&ও" 3859 3860 #: kdecore/kcalendarsystemethiopian.cpp:280 3861 #, fuzzy, kde-format 3862 msgctxt "Ethiopian weekday 3 - KLocale::LongName" 3863 msgid "Rob" 3864 msgstr "কাজ (Job)" 3865 3866 #: kdecore/kcalendarsystemethiopian.cpp:282 3867 #, fuzzy, kde-format 3868 msgctxt "Ethiopian weekday 4 - KLocale::LongName" 3869 msgid "Hamus" 3870 msgstr "স্থগিত রাখো" 3871 3872 #: kdecore/kcalendarsystemethiopian.cpp:284 3873 #, fuzzy, kde-format 3874 #| msgid "Arb" 3875 msgctxt "Ethiopian weekday 5 - KLocale::LongName" 3876 msgid "Arb" 3877 msgstr "আরবা (বুধ)" 3878 3879 #: kdecore/kcalendarsystemethiopian.cpp:286 3880 #, fuzzy, kde-format 3881 msgctxt "Ethiopian weekday 6 - KLocale::LongName" 3882 msgid "Qedame" 3883 msgstr "নাম" 3884 3885 #: kdecore/kcalendarsystemethiopian.cpp:288 3886 #, fuzzy, kde-format 3887 msgctxt "Ethiopian weekday 7 - KLocale::LongName" 3888 msgid "Ehud" 3889 msgstr "বৃহঃ" 3890 3891 #: kdecore/kcalendarsystemgregorian.cpp:53 3892 #, kde-format 3893 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 3894 msgid "Before Common Era" 3895 msgstr "" 3896 3897 #: kdecore/kcalendarsystemgregorian.cpp:54 3898 #, kde-format 3899 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 3900 msgid "BCE" 3901 msgstr "" 3902 3903 #: kdecore/kcalendarsystemgregorian.cpp:56 3904 #, kde-format 3905 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 3906 msgid "Before Christ" 3907 msgstr "" 3908 3909 #: kdecore/kcalendarsystemgregorian.cpp:57 3910 #, kde-format 3911 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 3912 msgid "BC" 3913 msgstr "" 3914 3915 #: kdecore/kcalendarsystemgregorian.cpp:59 3916 #, kde-format 3917 msgctxt "" 3918 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 3919 msgid "%Ey %EC" 3920 msgstr "" 3921 3922 #: kdecore/kcalendarsystemgregorian.cpp:63 3923 #, kde-format 3924 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 3925 msgid "Common Era" 3926 msgstr "" 3927 3928 #: kdecore/kcalendarsystemgregorian.cpp:64 3929 #, kde-format 3930 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 3931 msgid "CE" 3932 msgstr "" 3933 3934 #: kdecore/kcalendarsystemgregorian.cpp:66 3935 #: kdecore/kcalendarsystemjapanese.cpp:57 3936 #, kde-format 3937 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 3938 msgid "Anno Domini" 3939 msgstr "" 3940 3941 #: kdecore/kcalendarsystemgregorian.cpp:67 3942 #: kdecore/kcalendarsystemjapanese.cpp:58 3943 #, kde-format 3944 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 3945 msgid "AD" 3946 msgstr "" 3947 3948 #: kdecore/kcalendarsystemgregorian.cpp:69 3949 #: kdecore/kcalendarsystemjapanese.cpp:59 3950 #, kde-format 3951 msgctxt "" 3952 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 3953 msgid "%Ey %EC" 3954 msgstr "" 3955 3956 #: kdecore/kcalendarsystemgregorian.cpp:138 3957 #, kde-format 3958 msgctxt "Gregorian month 1 - KLocale::NarrowName" 3959 msgid "J" 3960 msgstr "" 3961 3962 #: kdecore/kcalendarsystemgregorian.cpp:140 3963 #, kde-format 3964 msgctxt "Gregorian month 2 - KLocale::NarrowName" 3965 msgid "F" 3966 msgstr "" 3967 3968 #: kdecore/kcalendarsystemgregorian.cpp:142 3969 #, kde-format 3970 msgctxt "Gregorian month 3 - KLocale::NarrowName" 3971 msgid "M" 3972 msgstr "" 3973 3974 #: kdecore/kcalendarsystemgregorian.cpp:144 3975 #, fuzzy, kde-format 3976 #| msgid "Av" 3977 msgctxt "Gregorian month 4 - KLocale::NarrowName" 3978 msgid "A" 3979 msgstr "আভ" 3980 3981 #: kdecore/kcalendarsystemgregorian.cpp:146 3982 #, kde-format 3983 msgctxt "Gregorian month 5 - KLocale::NarrowName" 3984 msgid "M" 3985 msgstr "" 3986 3987 #: kdecore/kcalendarsystemgregorian.cpp:148 3988 #, kde-format 3989 msgctxt "Gregorian month 6 - KLocale::NarrowName" 3990 msgid "J" 3991 msgstr "" 3992 3993 #: kdecore/kcalendarsystemgregorian.cpp:150 3994 #, kde-format 3995 msgctxt "Gregorian month 7 - KLocale::NarrowName" 3996 msgid "J" 3997 msgstr "" 3998 3999 #: kdecore/kcalendarsystemgregorian.cpp:152 4000 #, fuzzy, kde-format 4001 #| msgid "Av" 4002 msgctxt "Gregorian month 8 - KLocale::NarrowName" 4003 msgid "A" 4004 msgstr "আভ" 4005 4006 #: kdecore/kcalendarsystemgregorian.cpp:154 4007 #, kde-format 4008 msgctxt "Gregorian month 9 - KLocale::NarrowName" 4009 msgid "S" 4010 msgstr "" 4011 4012 #: kdecore/kcalendarsystemgregorian.cpp:156 4013 #, kde-format 4014 msgctxt "Gregorian month 10 - KLocale::NarrowName" 4015 msgid "O" 4016 msgstr "" 4017 4018 #: kdecore/kcalendarsystemgregorian.cpp:158 4019 #, kde-format 4020 msgctxt "Gregorian month 11 - KLocale::NarrowName" 4021 msgid "N" 4022 msgstr "" 4023 4024 #: kdecore/kcalendarsystemgregorian.cpp:160 4025 #, kde-format 4026 msgctxt "Gregorian month 12 - KLocale::NarrowName" 4027 msgid "D" 4028 msgstr "" 4029 4030 #: kdecore/kcalendarsystemgregorian.cpp:169 4031 #, fuzzy, kde-format 4032 #| msgctxt "of January" 4033 #| msgid "of Jan" 4034 msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" 4035 msgid "of Jan" 4036 msgstr "জানুয়ারীর" 4037 4038 #: kdecore/kcalendarsystemgregorian.cpp:171 4039 #, fuzzy, kde-format 4040 #| msgctxt "of February" 4041 #| msgid "of Feb" 4042 msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" 4043 msgid "of Feb" 4044 msgstr "ফেব্রুয়ারীর" 4045 4046 #: kdecore/kcalendarsystemgregorian.cpp:173 4047 #, fuzzy, kde-format 4048 #| msgctxt "of March" 4049 #| msgid "of Mar" 4050 msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" 4051 msgid "of Mar" 4052 msgstr "মার্চের" 4053 4054 #: kdecore/kcalendarsystemgregorian.cpp:175 4055 #, fuzzy, kde-format 4056 #| msgctxt "of April" 4057 #| msgid "of Apr" 4058 msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" 4059 msgid "of Apr" 4060 msgstr "এপ্রিলের" 4061 4062 #: kdecore/kcalendarsystemgregorian.cpp:177 4063 #, fuzzy, kde-format 4064 #| msgctxt "of May short" 4065 #| msgid "of May" 4066 msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" 4067 msgid "of May" 4068 msgstr "মের" 4069 4070 #: kdecore/kcalendarsystemgregorian.cpp:179 4071 #, fuzzy, kde-format 4072 #| msgctxt "of June" 4073 #| msgid "of Jun" 4074 msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" 4075 msgid "of Jun" 4076 msgstr "জুনের" 4077 4078 #: kdecore/kcalendarsystemgregorian.cpp:181 4079 #, fuzzy, kde-format 4080 #| msgctxt "of July" 4081 #| msgid "of Jul" 4082 msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" 4083 msgid "of Jul" 4084 msgstr "জুলাইয়ের" 4085 4086 #: kdecore/kcalendarsystemgregorian.cpp:183 4087 #, fuzzy, kde-format 4088 #| msgctxt "of August" 4089 #| msgid "of Aug" 4090 msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" 4091 msgid "of Aug" 4092 msgstr "আগস্টের" 4093 4094 #: kdecore/kcalendarsystemgregorian.cpp:185 4095 #, fuzzy, kde-format 4096 #| msgctxt "of September" 4097 #| msgid "of Sep" 4098 msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" 4099 msgid "of Sep" 4100 msgstr "সেপ্টেম্বরের" 4101 4102 #: kdecore/kcalendarsystemgregorian.cpp:187 4103 #, fuzzy, kde-format 4104 #| msgctxt "of October" 4105 #| msgid "of Oct" 4106 msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" 4107 msgid "of Oct" 4108 msgstr "অক্টোবরের" 4109 4110 #: kdecore/kcalendarsystemgregorian.cpp:189 4111 #, fuzzy, kde-format 4112 #| msgctxt "of November" 4113 #| msgid "of Nov" 4114 msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" 4115 msgid "of Nov" 4116 msgstr "নভেম্বরের" 4117 4118 #: kdecore/kcalendarsystemgregorian.cpp:191 4119 #, fuzzy, kde-format 4120 #| msgctxt "of December" 4121 #| msgid "of Dec" 4122 msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" 4123 msgid "of Dec" 4124 msgstr "ডিসেম্বরের" 4125 4126 #: kdecore/kcalendarsystemgregorian.cpp:200 4127 #, fuzzy, kde-format 4128 #| msgctxt "January" 4129 #| msgid "Jan" 4130 msgctxt "Gregorian month 1 - KLocale::ShortName" 4131 msgid "Jan" 4132 msgstr "জানুয়ারী" 4133 4134 #: kdecore/kcalendarsystemgregorian.cpp:202 4135 #, fuzzy, kde-format 4136 #| msgctxt "February" 4137 #| msgid "Feb" 4138 msgctxt "Gregorian month 2 - KLocale::ShortName" 4139 msgid "Feb" 4140 msgstr "ফেব্রুয়ারী" 4141 4142 #: kdecore/kcalendarsystemgregorian.cpp:204 4143 #, fuzzy, kde-format 4144 #| msgctxt "March" 4145 #| msgid "Mar" 4146 msgctxt "Gregorian month 3 - KLocale::ShortName" 4147 msgid "Mar" 4148 msgstr "মার্চ" 4149 4150 #: kdecore/kcalendarsystemgregorian.cpp:206 4151 #, fuzzy, kde-format 4152 #| msgctxt "April" 4153 #| msgid "Apr" 4154 msgctxt "Gregorian month 4 - KLocale::ShortName" 4155 msgid "Apr" 4156 msgstr "এপ্রিল" 4157 4158 #: kdecore/kcalendarsystemgregorian.cpp:208 4159 #, fuzzy, kde-format 4160 #| msgctxt "May short" 4161 #| msgid "May" 4162 msgctxt "Gregorian month 5 - KLocale::ShortName" 4163 msgid "May" 4164 msgstr "মে" 4165 4166 #: kdecore/kcalendarsystemgregorian.cpp:210 4167 #, fuzzy, kde-format 4168 #| msgctxt "June" 4169 #| msgid "Jun" 4170 msgctxt "Gregorian month 6 - KLocale::ShortName" 4171 msgid "Jun" 4172 msgstr "জুন" 4173 4174 #: kdecore/kcalendarsystemgregorian.cpp:212 4175 #, fuzzy, kde-format 4176 #| msgctxt "July" 4177 #| msgid "Jul" 4178 msgctxt "Gregorian month 7 - KLocale::ShortName" 4179 msgid "Jul" 4180 msgstr "জুলাই" 4181 4182 #: kdecore/kcalendarsystemgregorian.cpp:214 4183 #, fuzzy, kde-format 4184 #| msgctxt "August" 4185 #| msgid "Aug" 4186 msgctxt "Gregorian month 8 - KLocale::ShortName" 4187 msgid "Aug" 4188 msgstr "আগস্ট" 4189 4190 #: kdecore/kcalendarsystemgregorian.cpp:216 4191 #, fuzzy, kde-format 4192 #| msgctxt "September" 4193 #| msgid "Sep" 4194 msgctxt "Gregorian month 9 - KLocale::ShortName" 4195 msgid "Sep" 4196 msgstr "সেপ্টেম্বর" 4197 4198 #: kdecore/kcalendarsystemgregorian.cpp:218 4199 #, fuzzy, kde-format 4200 #| msgctxt "October" 4201 #| msgid "Oct" 4202 msgctxt "Gregorian month 10 - KLocale::ShortName" 4203 msgid "Oct" 4204 msgstr "অক্টোবর" 4205 4206 #: kdecore/kcalendarsystemgregorian.cpp:220 4207 #, fuzzy, kde-format 4208 #| msgctxt "November" 4209 #| msgid "Nov" 4210 msgctxt "Gregorian month 11 - KLocale::ShortName" 4211 msgid "Nov" 4212 msgstr "নভেম্বর" 4213 4214 #: kdecore/kcalendarsystemgregorian.cpp:222 4215 #, fuzzy, kde-format 4216 #| msgctxt "December" 4217 #| msgid "Dec" 4218 msgctxt "Gregorian month 12 - KLocale::ShortName" 4219 msgid "Dec" 4220 msgstr "ডিসেম্বর" 4221 4222 #: kdecore/kcalendarsystemgregorian.cpp:231 4223 #, fuzzy, kde-format 4224 #| msgid "of January" 4225 msgctxt "Gregorian month 1 - KLocale::LongName Possessive" 4226 msgid "of January" 4227 msgstr "জানুয়ারীর" 4228 4229 #: kdecore/kcalendarsystemgregorian.cpp:233 4230 #, fuzzy, kde-format 4231 #| msgid "of February" 4232 msgctxt "Gregorian month 2 - KLocale::LongName Possessive" 4233 msgid "of February" 4234 msgstr "ফেব্রুয়ারীর" 4235 4236 #: kdecore/kcalendarsystemgregorian.cpp:235 4237 #, fuzzy, kde-format 4238 #| msgid "of March" 4239 msgctxt "Gregorian month 3 - KLocale::LongName Possessive" 4240 msgid "of March" 4241 msgstr "মার্চের" 4242 4243 #: kdecore/kcalendarsystemgregorian.cpp:237 4244 #, fuzzy, kde-format 4245 #| msgid "of April" 4246 msgctxt "Gregorian month 4 - KLocale::LongName Possessive" 4247 msgid "of April" 4248 msgstr "এপ্রিলের" 4249 4250 #: kdecore/kcalendarsystemgregorian.cpp:239 4251 #, fuzzy, kde-format 4252 #| msgctxt "of May short" 4253 #| msgid "of May" 4254 msgctxt "Gregorian month 5 - KLocale::LongName Possessive" 4255 msgid "of May" 4256 msgstr "মের" 4257 4258 #: kdecore/kcalendarsystemgregorian.cpp:241 4259 #, fuzzy, kde-format 4260 #| msgid "of June" 4261 msgctxt "Gregorian month 6 - KLocale::LongName Possessive" 4262 msgid "of June" 4263 msgstr "জুনের" 4264 4265 #: kdecore/kcalendarsystemgregorian.cpp:243 4266 #, fuzzy, kde-format 4267 #| msgid "of July" 4268 msgctxt "Gregorian month 7 - KLocale::LongName Possessive" 4269 msgid "of July" 4270 msgstr "জুলাইয়ের" 4271 4272 #: kdecore/kcalendarsystemgregorian.cpp:245 4273 #, fuzzy, kde-format 4274 #| msgid "of August" 4275 msgctxt "Gregorian month 8 - KLocale::LongName Possessive" 4276 msgid "of August" 4277 msgstr "আগস্টের" 4278 4279 #: kdecore/kcalendarsystemgregorian.cpp:247 4280 #, fuzzy, kde-format 4281 #| msgid "of September" 4282 msgctxt "Gregorian month 9 - KLocale::LongName Possessive" 4283 msgid "of September" 4284 msgstr "সেপ্টেম্বরের" 4285 4286 #: kdecore/kcalendarsystemgregorian.cpp:249 4287 #, fuzzy, kde-format 4288 #| msgid "of October" 4289 msgctxt "Gregorian month 10 - KLocale::LongName Possessive" 4290 msgid "of October" 4291 msgstr "অক্টোবরের" 4292 4293 #: kdecore/kcalendarsystemgregorian.cpp:251 4294 #, fuzzy, kde-format 4295 #| msgid "of November" 4296 msgctxt "Gregorian month 11 - KLocale::LongName Possessive" 4297 msgid "of November" 4298 msgstr "নভেম্বরের" 4299 4300 #: kdecore/kcalendarsystemgregorian.cpp:253 4301 #, fuzzy, kde-format 4302 #| msgid "of December" 4303 msgctxt "Gregorian month 12 - KLocale::LongName Possessive" 4304 msgid "of December" 4305 msgstr "ডিসেম্বরের" 4306 4307 #: kdecore/kcalendarsystemgregorian.cpp:262 4308 #, fuzzy, kde-format 4309 #| msgid "January" 4310 msgctxt "Gregorian month 1 - KLocale::LongName" 4311 msgid "January" 4312 msgstr "জানুয়ারী" 4313 4314 #: kdecore/kcalendarsystemgregorian.cpp:264 4315 #, fuzzy, kde-format 4316 #| msgid "February" 4317 msgctxt "Gregorian month 2 - KLocale::LongName" 4318 msgid "February" 4319 msgstr "ফেব্রুয়ারী" 4320 4321 #: kdecore/kcalendarsystemgregorian.cpp:266 4322 #, fuzzy, kde-format 4323 #| msgctxt "March long" 4324 #| msgid "March" 4325 msgctxt "Gregorian month 3 - KLocale::LongName" 4326 msgid "March" 4327 msgstr "মার্চ" 4328 4329 #: kdecore/kcalendarsystemgregorian.cpp:268 4330 #, fuzzy, kde-format 4331 #| msgid "April" 4332 msgctxt "Gregorian month 4 - KLocale::LongName" 4333 msgid "April" 4334 msgstr "এপ্রিল" 4335 4336 #: kdecore/kcalendarsystemgregorian.cpp:270 4337 #, fuzzy, kde-format 4338 #| msgctxt "May short" 4339 #| msgid "May" 4340 msgctxt "Gregorian month 5 - KLocale::LongName" 4341 msgid "May" 4342 msgstr "মে" 4343 4344 #: kdecore/kcalendarsystemgregorian.cpp:272 4345 #, fuzzy, kde-format 4346 #| msgid "June" 4347 msgctxt "Gregorian month 6 - KLocale::LongName" 4348 msgid "June" 4349 msgstr "জুন" 4350 4351 #: kdecore/kcalendarsystemgregorian.cpp:274 4352 #, fuzzy, kde-format 4353 #| msgid "July" 4354 msgctxt "Gregorian month 7 - KLocale::LongName" 4355 msgid "July" 4356 msgstr "জুলাই" 4357 4358 #: kdecore/kcalendarsystemgregorian.cpp:276 4359 #, fuzzy, kde-format 4360 #| msgctxt "August long" 4361 #| msgid "August" 4362 msgctxt "Gregorian month 8 - KLocale::LongName" 4363 msgid "August" 4364 msgstr "আগস্ট" 4365 4366 #: kdecore/kcalendarsystemgregorian.cpp:278 4367 #, fuzzy, kde-format 4368 #| msgid "September" 4369 msgctxt "Gregorian month 9 - KLocale::LongName" 4370 msgid "September" 4371 msgstr "সেপ্টেম্বর" 4372 4373 #: kdecore/kcalendarsystemgregorian.cpp:280 4374 #, fuzzy, kde-format 4375 #| msgid "October" 4376 msgctxt "Gregorian month 10 - KLocale::LongName" 4377 msgid "October" 4378 msgstr "অক্টোবর" 4379 4380 #: kdecore/kcalendarsystemgregorian.cpp:282 4381 #, fuzzy, kde-format 4382 #| msgid "November" 4383 msgctxt "Gregorian month 11 - KLocale::LongName" 4384 msgid "November" 4385 msgstr "নভেম্বর" 4386 4387 #: kdecore/kcalendarsystemgregorian.cpp:284 4388 #, fuzzy, kde-format 4389 #| msgid "December" 4390 msgctxt "Gregorian month 12 - KLocale::LongName" 4391 msgid "December" 4392 msgstr "ডিসেম্বর" 4393 4394 #: kdecore/kcalendarsystemgregorian.cpp:297 4395 #: kdecore/kcalendarsystemhebrew.cpp:807 4396 #, kde-format 4397 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " 4398 msgid "M" 4399 msgstr "" 4400 4401 #: kdecore/kcalendarsystemgregorian.cpp:299 4402 #: kdecore/kcalendarsystemhebrew.cpp:809 4403 #, kde-format 4404 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " 4405 msgid "T" 4406 msgstr "" 4407 4408 #: kdecore/kcalendarsystemgregorian.cpp:301 4409 #: kdecore/kcalendarsystemhebrew.cpp:811 4410 #, kde-format 4411 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " 4412 msgid "W" 4413 msgstr "" 4414 4415 #: kdecore/kcalendarsystemgregorian.cpp:303 4416 #: kdecore/kcalendarsystemhebrew.cpp:813 4417 #, kde-format 4418 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " 4419 msgid "T" 4420 msgstr "" 4421 4422 #: kdecore/kcalendarsystemgregorian.cpp:305 4423 #: kdecore/kcalendarsystemhebrew.cpp:815 4424 #, kde-format 4425 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " 4426 msgid "F" 4427 msgstr "" 4428 4429 #: kdecore/kcalendarsystemgregorian.cpp:307 4430 #: kdecore/kcalendarsystemhebrew.cpp:817 4431 #, kde-format 4432 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " 4433 msgid "S" 4434 msgstr "" 4435 4436 #: kdecore/kcalendarsystemgregorian.cpp:309 4437 #: kdecore/kcalendarsystemhebrew.cpp:819 4438 #, kde-format 4439 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " 4440 msgid "S" 4441 msgstr "" 4442 4443 #: kdecore/kcalendarsystemgregorian.cpp:318 4444 #: kdecore/kcalendarsystemhebrew.cpp:828 4445 #, fuzzy, kde-format 4446 #| msgctxt "Monday" 4447 #| msgid "Mon" 4448 msgctxt "Gregorian weekday 1 - KLocale::ShortName" 4449 msgid "Mon" 4450 msgstr "সোম" 4451 4452 #: kdecore/kcalendarsystemgregorian.cpp:320 4453 #: kdecore/kcalendarsystemhebrew.cpp:830 4454 #, fuzzy, kde-format 4455 #| msgctxt "Tuesday" 4456 #| msgid "Tue" 4457 msgctxt "Gregorian weekday 2 - KLocale::ShortName" 4458 msgid "Tue" 4459 msgstr "মঙ্গল" 4460 4461 #: kdecore/kcalendarsystemgregorian.cpp:322 4462 #: kdecore/kcalendarsystemhebrew.cpp:832 4463 #, fuzzy, kde-format 4464 #| msgctxt "Wednesday" 4465 #| msgid "Wed" 4466 msgctxt "Gregorian weekday 3 - KLocale::ShortName" 4467 msgid "Wed" 4468 msgstr "বুধ" 4469 4470 #: kdecore/kcalendarsystemgregorian.cpp:324 4471 #: kdecore/kcalendarsystemhebrew.cpp:834 4472 #, fuzzy, kde-format 4473 #| msgctxt "Thursday" 4474 #| msgid "Thu" 4475 msgctxt "Gregorian weekday 4 - KLocale::ShortName" 4476 msgid "Thu" 4477 msgstr "বৃহঃ" 4478 4479 #: kdecore/kcalendarsystemgregorian.cpp:326 4480 #: kdecore/kcalendarsystemhebrew.cpp:836 4481 #, fuzzy, kde-format 4482 #| msgctxt "Friday" 4483 #| msgid "Fri" 4484 msgctxt "Gregorian weekday 5 - KLocale::ShortName" 4485 msgid "Fri" 4486 msgstr "শুক্র" 4487 4488 #: kdecore/kcalendarsystemgregorian.cpp:328 4489 #: kdecore/kcalendarsystemhebrew.cpp:838 4490 #, fuzzy, kde-format 4491 #| msgctxt "Saturday" 4492 #| msgid "Sat" 4493 msgctxt "Gregorian weekday 6 - KLocale::ShortName" 4494 msgid "Sat" 4495 msgstr "শনি" 4496 4497 #: kdecore/kcalendarsystemgregorian.cpp:330 4498 #: kdecore/kcalendarsystemhebrew.cpp:840 4499 #, fuzzy, kde-format 4500 #| msgctxt "Sunday" 4501 #| msgid "Sun" 4502 msgctxt "Gregorian weekday 7 - KLocale::ShortName" 4503 msgid "Sun" 4504 msgstr "রবি" 4505 4506 #: kdecore/kcalendarsystemgregorian.cpp:337 4507 #: kdecore/kcalendarsystemhebrew.cpp:847 4508 #, fuzzy, kde-format 4509 #| msgid "Monday" 4510 msgctxt "Gregorian weekday 1 - KLocale::LongName" 4511 msgid "Monday" 4512 msgstr "সোমবার" 4513 4514 #: kdecore/kcalendarsystemgregorian.cpp:339 4515 #: kdecore/kcalendarsystemhebrew.cpp:849 4516 #, fuzzy, kde-format 4517 #| msgid "Tuesday" 4518 msgctxt "Gregorian weekday 2 - KLocale::LongName" 4519 msgid "Tuesday" 4520 msgstr "মঙ্গলবার" 4521 4522 #: kdecore/kcalendarsystemgregorian.cpp:341 4523 #: kdecore/kcalendarsystemhebrew.cpp:851 4524 #, fuzzy, kde-format 4525 #| msgid "Wednesday" 4526 msgctxt "Gregorian weekday 3 - KLocale::LongName" 4527 msgid "Wednesday" 4528 msgstr "বুধবার" 4529 4530 #: kdecore/kcalendarsystemgregorian.cpp:343 4531 #: kdecore/kcalendarsystemhebrew.cpp:853 4532 #, fuzzy, kde-format 4533 #| msgid "Thursday" 4534 msgctxt "Gregorian weekday 4 - KLocale::LongName" 4535 msgid "Thursday" 4536 msgstr "বৃহস্পতিবার" 4537 4538 #: kdecore/kcalendarsystemgregorian.cpp:345 4539 #: kdecore/kcalendarsystemhebrew.cpp:855 4540 #, fuzzy, kde-format 4541 #| msgid "Friday" 4542 msgctxt "Gregorian weekday 5 - KLocale::LongName" 4543 msgid "Friday" 4544 msgstr "শুক্রবার" 4545 4546 #: kdecore/kcalendarsystemgregorian.cpp:347 4547 #: kdecore/kcalendarsystemhebrew.cpp:857 4548 #, fuzzy, kde-format 4549 #| msgid "Saturday" 4550 msgctxt "Gregorian weekday 6 - KLocale::LongName" 4551 msgid "Saturday" 4552 msgstr "শনিবার" 4553 4554 #: kdecore/kcalendarsystemgregorian.cpp:349 4555 #: kdecore/kcalendarsystemhebrew.cpp:859 4556 #, fuzzy, kde-format 4557 #| msgid "Sunday" 4558 msgctxt "Gregorian weekday 7 - KLocale::LongName" 4559 msgid "Sunday" 4560 msgstr "রবিবার" 4561 4562 #: kdecore/kcalendarsystemhebrew.cpp:281 4563 #, kde-format 4564 msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" 4565 msgid "Anno Mundi" 4566 msgstr "" 4567 4568 #: kdecore/kcalendarsystemhebrew.cpp:282 4569 #, kde-format 4570 msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" 4571 msgid "AM" 4572 msgstr "" 4573 4574 #: kdecore/kcalendarsystemhebrew.cpp:283 4575 #, kde-format 4576 msgctxt "" 4577 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 4578 msgid "%Ey %EC" 4579 msgstr "" 4580 4581 #: kdecore/kcalendarsystemhebrew.cpp:625 4582 #, kde-format 4583 msgctxt "Hebrew month 1 - KLocale::NarrowName" 4584 msgid "T" 4585 msgstr "" 4586 4587 #: kdecore/kcalendarsystemhebrew.cpp:627 4588 #, kde-format 4589 msgctxt "Hebrew month 2 - KLocale::NarrowName" 4590 msgid "H" 4591 msgstr "" 4592 4593 #: kdecore/kcalendarsystemhebrew.cpp:629 4594 #, kde-format 4595 msgctxt "Hebrew month 3 - KLocale::NarrowName" 4596 msgid "K" 4597 msgstr "" 4598 4599 #: kdecore/kcalendarsystemhebrew.cpp:631 4600 #, kde-format 4601 msgctxt "Hebrew month 4 - KLocale::NarrowName" 4602 msgid "T" 4603 msgstr "" 4604 4605 #: kdecore/kcalendarsystemhebrew.cpp:633 4606 #, kde-format 4607 msgctxt "Hebrew month 5 - KLocale::NarrowName" 4608 msgid "S" 4609 msgstr "" 4610 4611 #: kdecore/kcalendarsystemhebrew.cpp:635 4612 #, fuzzy, kde-format 4613 #| msgid "Av" 4614 msgctxt "Hebrew month 6 - KLocale::NarrowName" 4615 msgid "A" 4616 msgstr "আভ" 4617 4618 #: kdecore/kcalendarsystemhebrew.cpp:637 4619 #, kde-format 4620 msgctxt "Hebrew month 7 - KLocale::NarrowName" 4621 msgid "N" 4622 msgstr "" 4623 4624 #: kdecore/kcalendarsystemhebrew.cpp:639 4625 #, kde-format 4626 msgctxt "Hebrew month 8 - KLocale::NarrowName" 4627 msgid "I" 4628 msgstr "" 4629 4630 #: kdecore/kcalendarsystemhebrew.cpp:641 4631 #, kde-format 4632 msgctxt "Hebrew month 9 - KLocale::NarrowName" 4633 msgid "S" 4634 msgstr "" 4635 4636 #: kdecore/kcalendarsystemhebrew.cpp:643 4637 #, kde-format 4638 msgctxt "Hebrew month 10 - KLocale::NarrowName" 4639 msgid "T" 4640 msgstr "" 4641 4642 #: kdecore/kcalendarsystemhebrew.cpp:645 4643 #, fuzzy, kde-format 4644 #| msgid "Av" 4645 msgctxt "Hebrew month 11 - KLocale::NarrowName" 4646 msgid "A" 4647 msgstr "আভ" 4648 4649 #: kdecore/kcalendarsystemhebrew.cpp:647 4650 #, kde-format 4651 msgctxt "Hebrew month 12 - KLocale::NarrowName" 4652 msgid "E" 4653 msgstr "" 4654 4655 #: kdecore/kcalendarsystemhebrew.cpp:649 4656 #, fuzzy, kde-format 4657 #| msgid "Av" 4658 msgctxt "Hebrew month 13 - KLocale::NarrowName" 4659 msgid "A" 4660 msgstr "আভ" 4661 4662 #: kdecore/kcalendarsystemhebrew.cpp:651 4663 #, fuzzy, kde-format 4664 #| msgid "Av" 4665 msgctxt "Hebrew month 14 - KLocale::NarrowName" 4666 msgid "A" 4667 msgstr "আভ" 4668 4669 #: kdecore/kcalendarsystemhebrew.cpp:660 4670 #, fuzzy, kde-format 4671 #| msgctxt "of Tir short" 4672 #| msgid "of Tir" 4673 msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" 4674 msgid "of Tis" 4675 msgstr "of Tir" 4676 4677 #: kdecore/kcalendarsystemhebrew.cpp:662 4678 #, fuzzy, kde-format 4679 msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" 4680 msgid "of Hes" 4681 msgstr "of Meh" 4682 4683 #: kdecore/kcalendarsystemhebrew.cpp:664 4684 #, fuzzy, kde-format 4685 msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" 4686 msgid "of Kis" 4687 msgstr "of Nisan" 4688 4689 #: kdecore/kcalendarsystemhebrew.cpp:666 4690 #, fuzzy, kde-format 4691 #| msgid "of Tevet" 4692 msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" 4693 msgid "of Tev" 4694 msgstr "of Tevet" 4695 4696 #: kdecore/kcalendarsystemhebrew.cpp:668 4697 #, fuzzy, kde-format 4698 #| msgid "of Shvat" 4699 msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" 4700 msgid "of Shv" 4701 msgstr "of Shvat" 4702 4703 #: kdecore/kcalendarsystemhebrew.cpp:670 4704 #, fuzzy, kde-format 4705 #| msgid "of Adar" 4706 msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" 4707 msgid "of Ada" 4708 msgstr "of Adar" 4709 4710 #: kdecore/kcalendarsystemhebrew.cpp:672 4711 #, fuzzy, kde-format 4712 #| msgid "of Nisan" 4713 msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" 4714 msgid "of Nis" 4715 msgstr "of Nisan" 4716 4717 #: kdecore/kcalendarsystemhebrew.cpp:674 4718 #, fuzzy, kde-format 4719 #| msgid "of Iyar" 4720 msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" 4721 msgid "of Iya" 4722 msgstr "of Iyar" 4723 4724 #: kdecore/kcalendarsystemhebrew.cpp:676 4725 #, fuzzy, kde-format 4726 #| msgid "of Sivan" 4727 msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" 4728 msgid "of Siv" 4729 msgstr "of Sivan" 4730 4731 #: kdecore/kcalendarsystemhebrew.cpp:678 4732 #, fuzzy, kde-format 4733 #| msgid "of Tamuz" 4734 msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" 4735 msgid "of Tam" 4736 msgstr "of Tamuz" 4737 4738 #: kdecore/kcalendarsystemhebrew.cpp:680 4739 #, fuzzy, kde-format 4740 #| msgid "of Av" 4741 msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" 4742 msgid "of Av" 4743 msgstr "of Av" 4744 4745 #: kdecore/kcalendarsystemhebrew.cpp:682 4746 #, fuzzy, kde-format 4747 #| msgid "of Elul" 4748 msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" 4749 msgid "of Elu" 4750 msgstr "of Elul" 4751 4752 #: kdecore/kcalendarsystemhebrew.cpp:684 4753 #, fuzzy, kde-format 4754 #| msgid "of Adar" 4755 msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" 4756 msgid "of Ad1" 4757 msgstr "of Adar" 4758 4759 #: kdecore/kcalendarsystemhebrew.cpp:686 4760 #, fuzzy, kde-format 4761 #| msgid "of Adar" 4762 msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" 4763 msgid "of Ad2" 4764 msgstr "of Adar" 4765 4766 #: kdecore/kcalendarsystemhebrew.cpp:695 4767 #, fuzzy, kde-format 4768 #| msgctxt "Tir short" 4769 #| msgid "Tir" 4770 msgctxt "Hebrew month 1 - KLocale::ShortName" 4771 msgid "Tis" 4772 msgstr "Tir" 4773 4774 #: kdecore/kcalendarsystemhebrew.cpp:697 4775 #, fuzzy, kde-format 4776 msgctxt "Hebrew month 2 - KLocale::ShortName" 4777 msgid "Hes" 4778 msgstr "হ্যাঁ" 4779 4780 #: kdecore/kcalendarsystemhebrew.cpp:699 4781 #, fuzzy, kde-format 4782 #| msgid "Kislev" 4783 msgctxt "Hebrew month 3 - KLocale::ShortName" 4784 msgid "Kis" 4785 msgstr "কিসলেভ" 4786 4787 #: kdecore/kcalendarsystemhebrew.cpp:701 4788 #, fuzzy, kde-format 4789 #| msgid "Tevet" 4790 msgctxt "Hebrew month 4 - KLocale::ShortName" 4791 msgid "Tev" 4792 msgstr "তেভেত" 4793 4794 #: kdecore/kcalendarsystemhebrew.cpp:703 4795 #, fuzzy, kde-format 4796 #| msgid "Shvat" 4797 msgctxt "Hebrew month 5 - KLocale::ShortName" 4798 msgid "Shv" 4799 msgstr "শভাত" 4800 4801 #: kdecore/kcalendarsystemhebrew.cpp:705 4802 #, fuzzy, kde-format 4803 #| msgid "Adar" 4804 msgctxt "Hebrew month 6 - KLocale::ShortName" 4805 msgid "Ada" 4806 msgstr "আদার" 4807 4808 #: kdecore/kcalendarsystemhebrew.cpp:707 4809 #, fuzzy, kde-format 4810 #| msgid "Nisan" 4811 msgctxt "Hebrew month 7 - KLocale::ShortName" 4812 msgid "Nis" 4813 msgstr "নিসান" 4814 4815 #: kdecore/kcalendarsystemhebrew.cpp:709 4816 #, fuzzy, kde-format 4817 #| msgid "Iyar" 4818 msgctxt "Hebrew month 8 - KLocale::ShortName" 4819 msgid "Iya" 4820 msgstr "ইয়ার" 4821 4822 #: kdecore/kcalendarsystemhebrew.cpp:711 4823 #, fuzzy, kde-format 4824 #| msgid "Sivan" 4825 msgctxt "Hebrew month 9 - KLocale::ShortName" 4826 msgid "Siv" 4827 msgstr "সিভান" 4828 4829 #: kdecore/kcalendarsystemhebrew.cpp:713 4830 #, fuzzy, kde-format 4831 #| msgid "Tamuz" 4832 msgctxt "Hebrew month 10 - KLocale::ShortName" 4833 msgid "Tam" 4834 msgstr "তামুজ" 4835 4836 #: kdecore/kcalendarsystemhebrew.cpp:715 4837 #, fuzzy, kde-format 4838 #| msgid "Av" 4839 msgctxt "Hebrew month 11 - KLocale::ShortName" 4840 msgid "Av" 4841 msgstr "আভ" 4842 4843 #: kdecore/kcalendarsystemhebrew.cpp:717 4844 #, fuzzy, kde-format 4845 #| msgid "Elul" 4846 msgctxt "Hebrew month 12 - KLocale::ShortName" 4847 msgid "Elu" 4848 msgstr "এলুল" 4849 4850 #: kdecore/kcalendarsystemhebrew.cpp:719 4851 #, fuzzy, kde-format 4852 #| msgid "Ahd" 4853 msgctxt "Hebrew month 13 - KLocale::ShortName" 4854 msgid "Ad1" 4855 msgstr "আহাদ (রবি)" 4856 4857 #: kdecore/kcalendarsystemhebrew.cpp:721 4858 #, fuzzy, kde-format 4859 #| msgid "Ahd" 4860 msgctxt "Hebrew month 14 - KLocale::ShortName" 4861 msgid "Ad2" 4862 msgstr "আহাদ (রবি)" 4863 4864 #: kdecore/kcalendarsystemhebrew.cpp:730 4865 #, fuzzy, kde-format 4866 #| msgid "of Tishrey" 4867 msgctxt "Hebrew month 1 - KLocale::LongName Possessive" 4868 msgid "of Tishrey" 4869 msgstr "of Tishrey" 4870 4871 #: kdecore/kcalendarsystemhebrew.cpp:732 4872 #, fuzzy, kde-format 4873 #| msgid "of Heshvan" 4874 msgctxt "Hebrew month 2 - KLocale::LongName Possessive" 4875 msgid "of Heshvan" 4876 msgstr "of Heshvan" 4877 4878 #: kdecore/kcalendarsystemhebrew.cpp:734 4879 #, fuzzy, kde-format 4880 #| msgid "of Kislev" 4881 msgctxt "Hebrew month 3 - KLocale::LongName Possessive" 4882 msgid "of Kislev" 4883 msgstr "of Kislev" 4884 4885 #: kdecore/kcalendarsystemhebrew.cpp:736 4886 #, fuzzy, kde-format 4887 #| msgid "of Tevet" 4888 msgctxt "Hebrew month 4 - KLocale::LongName Possessive" 4889 msgid "of Tevet" 4890 msgstr "of Tevet" 4891 4892 #: kdecore/kcalendarsystemhebrew.cpp:738 4893 #, fuzzy, kde-format 4894 #| msgid "of Shvat" 4895 msgctxt "Hebrew month 5 - KLocale::LongName Possessive" 4896 msgid "of Shvat" 4897 msgstr "of Shvat" 4898 4899 #: kdecore/kcalendarsystemhebrew.cpp:740 4900 #, fuzzy, kde-format 4901 #| msgid "of Adar" 4902 msgctxt "Hebrew month 6 - KLocale::LongName Possessive" 4903 msgid "of Adar" 4904 msgstr "of Adar" 4905 4906 #: kdecore/kcalendarsystemhebrew.cpp:742 4907 #, fuzzy, kde-format 4908 #| msgid "of Nisan" 4909 msgctxt "Hebrew month 7 - KLocale::LongName Possessive" 4910 msgid "of Nisan" 4911 msgstr "of Nisan" 4912 4913 #: kdecore/kcalendarsystemhebrew.cpp:744 4914 #, fuzzy, kde-format 4915 #| msgid "of Iyar" 4916 msgctxt "Hebrew month 8 - KLocale::LongName Possessive" 4917 msgid "of Iyar" 4918 msgstr "of Iyar" 4919 4920 #: kdecore/kcalendarsystemhebrew.cpp:746 4921 #, fuzzy, kde-format 4922 #| msgid "of Sivan" 4923 msgctxt "Hebrew month 9 - KLocale::LongName Possessive" 4924 msgid "of Sivan" 4925 msgstr "of Sivan" 4926 4927 #: kdecore/kcalendarsystemhebrew.cpp:748 4928 #, fuzzy, kde-format 4929 #| msgid "of Tamuz" 4930 msgctxt "Hebrew month 10 - KLocale::LongName Possessive" 4931 msgid "of Tamuz" 4932 msgstr "of Tamuz" 4933 4934 #: kdecore/kcalendarsystemhebrew.cpp:750 4935 #, fuzzy, kde-format 4936 #| msgid "of Av" 4937 msgctxt "Hebrew month 11 - KLocale::LongName Possessive" 4938 msgid "of Av" 4939 msgstr "of Av" 4940 4941 #: kdecore/kcalendarsystemhebrew.cpp:752 4942 #, fuzzy, kde-format 4943 #| msgid "of Elul" 4944 msgctxt "Hebrew month 12 - KLocale::LongName Possessive" 4945 msgid "of Elul" 4946 msgstr "of Elul" 4947 4948 #: kdecore/kcalendarsystemhebrew.cpp:754 4949 #, fuzzy, kde-format 4950 #| msgid "of Adar I" 4951 msgctxt "Hebrew month 13 - KLocale::LongName Possessive" 4952 msgid "of Adar I" 4953 msgstr "of Adar I" 4954 4955 #: kdecore/kcalendarsystemhebrew.cpp:756 4956 #, fuzzy, kde-format 4957 #| msgid "of Adar II" 4958 msgctxt "Hebrew month 14 - KLocale::LongName Possessive" 4959 msgid "of Adar II" 4960 msgstr "of Adar II" 4961 4962 #: kdecore/kcalendarsystemhebrew.cpp:765 4963 #, fuzzy, kde-format 4964 #| msgid "Tishrey" 4965 msgctxt "Hebrew month 1 - KLocale::LongName" 4966 msgid "Tishrey" 4967 msgstr "তিশরে" 4968 4969 #: kdecore/kcalendarsystemhebrew.cpp:767 4970 #, fuzzy, kde-format 4971 #| msgid "Heshvan" 4972 msgctxt "Hebrew month 2 - KLocale::LongName" 4973 msgid "Heshvan" 4974 msgstr "হেশভান" 4975 4976 #: kdecore/kcalendarsystemhebrew.cpp:769 4977 #, fuzzy, kde-format 4978 #| msgid "Kislev" 4979 msgctxt "Hebrew month 3 - KLocale::LongName" 4980 msgid "Kislev" 4981 msgstr "কিসলেভ" 4982 4983 #: kdecore/kcalendarsystemhebrew.cpp:771 4984 #, fuzzy, kde-format 4985 #| msgid "Tevet" 4986 msgctxt "Hebrew month 4 - KLocale::LongName" 4987 msgid "Tevet" 4988 msgstr "তেভেত" 4989 4990 #: kdecore/kcalendarsystemhebrew.cpp:773 4991 #, fuzzy, kde-format 4992 #| msgid "Shvat" 4993 msgctxt "Hebrew month 5 - KLocale::LongName" 4994 msgid "Shvat" 4995 msgstr "শভাত" 4996 4997 #: kdecore/kcalendarsystemhebrew.cpp:775 4998 #, fuzzy, kde-format 4999 #| msgid "Adar" 5000 msgctxt "Hebrew month 6 - KLocale::LongName" 5001 msgid "Adar" 5002 msgstr "আদার" 5003 5004 #: kdecore/kcalendarsystemhebrew.cpp:777 5005 #, fuzzy, kde-format 5006 #| msgid "Nisan" 5007 msgctxt "Hebrew month 7 - KLocale::LongName" 5008 msgid "Nisan" 5009 msgstr "নিসান" 5010 5011 #: kdecore/kcalendarsystemhebrew.cpp:779 5012 #, fuzzy, kde-format 5013 #| msgid "Iyar" 5014 msgctxt "Hebrew month 8 - KLocale::LongName" 5015 msgid "Iyar" 5016 msgstr "ইয়ার" 5017 5018 #: kdecore/kcalendarsystemhebrew.cpp:781 5019 #, fuzzy, kde-format 5020 #| msgid "Sivan" 5021 msgctxt "Hebrew month 9 - KLocale::LongName" 5022 msgid "Sivan" 5023 msgstr "সিভান" 5024 5025 #: kdecore/kcalendarsystemhebrew.cpp:783 5026 #, fuzzy, kde-format 5027 #| msgid "Tamuz" 5028 msgctxt "Hebrew month 10 - KLocale::LongName" 5029 msgid "Tamuz" 5030 msgstr "তামুজ" 5031 5032 #: kdecore/kcalendarsystemhebrew.cpp:785 5033 #, fuzzy, kde-format 5034 #| msgid "Av" 5035 msgctxt "Hebrew month 11 - KLocale::LongName" 5036 msgid "Av" 5037 msgstr "আভ" 5038 5039 #: kdecore/kcalendarsystemhebrew.cpp:787 5040 #, fuzzy, kde-format 5041 #| msgid "Elul" 5042 msgctxt "Hebrew month 12 - KLocale::LongName" 5043 msgid "Elul" 5044 msgstr "এলুল" 5045 5046 #: kdecore/kcalendarsystemhebrew.cpp:789 5047 #, fuzzy, kde-format 5048 #| msgid "Adar I" 5049 msgctxt "Hebrew month 13 - KLocale::LongName" 5050 msgid "Adar I" 5051 msgstr "আদার ১" 5052 5053 #: kdecore/kcalendarsystemhebrew.cpp:791 5054 #, fuzzy, kde-format 5055 #| msgid "Adar II" 5056 msgctxt "Hebrew month 14 - KLocale::LongName" 5057 msgid "Adar II" 5058 msgstr "আদার ২" 5059 5060 #: kdecore/kcalendarsystemindiannational.cpp:66 5061 #, fuzzy, kde-format 5062 #| msgid "Safar" 5063 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" 5064 msgid "Saka Era" 5065 msgstr "সফর" 5066 5067 #: kdecore/kcalendarsystemindiannational.cpp:67 5068 #, kde-format 5069 msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" 5070 msgid "SE" 5071 msgstr "" 5072 5073 #: kdecore/kcalendarsystemindiannational.cpp:68 5074 #, kde-format 5075 msgctxt "" 5076 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 5077 "2000 SE" 5078 msgid "%Ey %EC" 5079 msgstr "" 5080 5081 #: kdecore/kcalendarsystemindiannational.cpp:158 5082 #, kde-format 5083 msgctxt "Indian National month 1 - KLocale::NarrowName" 5084 msgid "C" 5085 msgstr "" 5086 5087 #: kdecore/kcalendarsystemindiannational.cpp:160 5088 #, kde-format 5089 msgctxt "Indian National month 2 - KLocale::NarrowName" 5090 msgid "V" 5091 msgstr "" 5092 5093 #: kdecore/kcalendarsystemindiannational.cpp:162 5094 #, kde-format 5095 msgctxt "Indian National month 3 - KLocale::NarrowName" 5096 msgid "J" 5097 msgstr "" 5098 5099 #: kdecore/kcalendarsystemindiannational.cpp:164 5100 #, fuzzy, kde-format 5101 msgctxt "Indian National month 4 - KLocale::NarrowName" 5102 msgid "Ā" 5103 msgstr "of Kho" 5104 5105 #: kdecore/kcalendarsystemindiannational.cpp:166 5106 #, kde-format 5107 msgctxt "Indian National month 5 - KLocale::NarrowName" 5108 msgid "S" 5109 msgstr "" 5110 5111 #: kdecore/kcalendarsystemindiannational.cpp:168 5112 #, kde-format 5113 msgctxt "Indian National month 6 - KLocale::NarrowName" 5114 msgid "B" 5115 msgstr "" 5116 5117 #: kdecore/kcalendarsystemindiannational.cpp:170 5118 #, fuzzy, kde-format 5119 msgctxt "Indian National month 7 - KLocale::NarrowName" 5120 msgid "Ā" 5121 msgstr "of Kho" 5122 5123 #: kdecore/kcalendarsystemindiannational.cpp:172 5124 #, kde-format 5125 msgctxt "Indian National month 8 - KLocale::NarrowName" 5126 msgid "K" 5127 msgstr "" 5128 5129 #: kdecore/kcalendarsystemindiannational.cpp:174 5130 #, fuzzy, kde-format 5131 #| msgid "Av" 5132 msgctxt "Indian National month 9 - KLocale::NarrowName" 5133 msgid "A" 5134 msgstr "আভ" 5135 5136 #: kdecore/kcalendarsystemindiannational.cpp:176 5137 #, kde-format 5138 msgctxt "Indian National month 10 - KLocale::NarrowName" 5139 msgid "P" 5140 msgstr "" 5141 5142 #: kdecore/kcalendarsystemindiannational.cpp:178 5143 #, kde-format 5144 msgctxt "Indian National month 11 - KLocale::NarrowName" 5145 msgid "M" 5146 msgstr "" 5147 5148 #: kdecore/kcalendarsystemindiannational.cpp:180 5149 #, kde-format 5150 msgctxt "Indian National month 12 - KLocale::NarrowName" 5151 msgid "P" 5152 msgstr "" 5153 5154 #: kdecore/kcalendarsystemindiannational.cpp:189 5155 #, fuzzy, kde-format 5156 msgctxt "Indian National month 1 - KLocale::ShortName Possessive" 5157 msgid "of Cha" 5158 msgstr "of Sha" 5159 5160 #: kdecore/kcalendarsystemindiannational.cpp:191 5161 #, fuzzy, kde-format 5162 msgctxt "Indian National month 2 - KLocale::ShortName Possessive" 5163 msgid "of Vai" 5164 msgstr "of Far" 5165 5166 #: kdecore/kcalendarsystemindiannational.cpp:193 5167 #, fuzzy, kde-format 5168 msgctxt "Indian National month 3 - KLocale::ShortName Possessive" 5169 msgid "of Jya" 5170 msgstr "জানুয়ারীর" 5171 5172 #: kdecore/kcalendarsystemindiannational.cpp:195 5173 #, fuzzy, kde-format 5174 msgctxt "Indian National month 4 - KLocale::ShortName Possessive" 5175 msgid "of Āsh" 5176 msgstr "of Kho" 5177 5178 #: kdecore/kcalendarsystemindiannational.cpp:197 5179 #, fuzzy, kde-format 5180 msgctxt "Indian National month 5 - KLocale::ShortName Possessive" 5181 msgid "of Shr" 5182 msgstr "of Sha" 5183 5184 #: kdecore/kcalendarsystemindiannational.cpp:199 5185 #, fuzzy, kde-format 5186 msgctxt "Indian National month 6 - KLocale::ShortName Possessive" 5187 msgid "of Bhā" 5188 msgstr "of Bah" 5189 5190 #: kdecore/kcalendarsystemindiannational.cpp:201 5191 #, fuzzy, kde-format 5192 msgctxt "Indian National month 7 - KLocale::ShortName Possessive" 5193 msgid "of Āsw" 5194 msgstr "of Esf" 5195 5196 #: kdecore/kcalendarsystemindiannational.cpp:203 5197 #, fuzzy, kde-format 5198 msgctxt "Indian National month 8 - KLocale::ShortName Possessive" 5199 msgid "of Kār" 5200 msgstr "of Far" 5201 5202 #: kdecore/kcalendarsystemindiannational.cpp:205 5203 #, fuzzy, kde-format 5204 msgctxt "Indian National month 9 - KLocale::ShortName Possessive" 5205 msgid "of Agr" 5206 msgstr "এপ্রিলের" 5207 5208 #: kdecore/kcalendarsystemindiannational.cpp:207 5209 #, fuzzy, kde-format 5210 msgctxt "Indian National month 10 - KLocale::ShortName Possessive" 5211 msgid "of Pau" 5212 msgstr "of Tamuz" 5213 5214 #: kdecore/kcalendarsystemindiannational.cpp:209 5215 #, fuzzy, kde-format 5216 msgctxt "Indian National month 11 - KLocale::ShortName Possessive" 5217 msgid "of Māg" 5218 msgstr "of Mor" 5219 5220 #: kdecore/kcalendarsystemindiannational.cpp:211 5221 #, fuzzy, kde-format 5222 msgctxt "Indian National month 12 - KLocale::ShortName Possessive" 5223 msgid "of Phā" 5224 msgstr "of Kho" 5225 5226 #: kdecore/kcalendarsystemindiannational.cpp:220 5227 #, fuzzy, kde-format 5228 msgctxt "Indian National month 1 - KLocale::ShortName" 5229 msgid "Cha" 5230 msgstr "খামিস (বৃহঃ)" 5231 5232 #: kdecore/kcalendarsystemindiannational.cpp:222 5233 #, fuzzy, kde-format 5234 msgctxt "Indian National month 2 - KLocale::ShortName" 5235 msgid "Vai" 5236 msgstr "of Far" 5237 5238 #: kdecore/kcalendarsystemindiannational.cpp:224 5239 #, fuzzy, kde-format 5240 msgctxt "Indian National month 3 - KLocale::ShortName" 5241 msgid "Jya" 5242 msgstr "জানুয়ারী" 5243 5244 #: kdecore/kcalendarsystemindiannational.cpp:226 5245 #, fuzzy, kde-format 5246 msgctxt "Indian National month 4 - KLocale::ShortName" 5247 msgid "Āsh" 5248 msgstr "of Kho" 5249 5250 #: kdecore/kcalendarsystemindiannational.cpp:228 5251 #, fuzzy, kde-format 5252 msgctxt "Indian National month 5 - KLocale::ShortName" 5253 msgid "Shr" 5254 msgstr "Sha" 5255 5256 #: kdecore/kcalendarsystemindiannational.cpp:230 5257 #, fuzzy, kde-format 5258 msgctxt "Indian National month 6 - KLocale::ShortName" 5259 msgid "Bhā" 5260 msgstr "of Bah" 5261 5262 #: kdecore/kcalendarsystemindiannational.cpp:232 5263 #, fuzzy, kde-format 5264 msgctxt "Indian National month 7 - KLocale::ShortName" 5265 msgid "Āsw" 5266 msgstr "of Esf" 5267 5268 #: kdecore/kcalendarsystemindiannational.cpp:234 5269 #, fuzzy, kde-format 5270 msgctxt "Indian National month 8 - KLocale::ShortName" 5271 msgid "Kār" 5272 msgstr "of Far" 5273 5274 #: kdecore/kcalendarsystemindiannational.cpp:236 5275 #, fuzzy, kde-format 5276 msgctxt "Indian National month 9 - KLocale::ShortName" 5277 msgid "Agr" 5278 msgstr "আরবা (বুধ)" 5279 5280 #: kdecore/kcalendarsystemindiannational.cpp:238 5281 #, fuzzy, kde-format 5282 msgctxt "Indian National month 10 - KLocale::ShortName" 5283 msgid "Pau" 5284 msgstr "স্থগিত রাখো" 5285 5286 #: kdecore/kcalendarsystemindiannational.cpp:240 5287 #, fuzzy, kde-format 5288 msgctxt "Indian National month 11 - KLocale::ShortName" 5289 msgid "Māg" 5290 msgstr "of Mor" 5291 5292 #: kdecore/kcalendarsystemindiannational.cpp:242 5293 #, fuzzy, kde-format 5294 msgctxt "Indian National month 12 - KLocale::ShortName" 5295 msgid "Phā" 5296 msgstr "of Kho" 5297 5298 #: kdecore/kcalendarsystemindiannational.cpp:251 5299 #, fuzzy, kde-format 5300 msgctxt "Indian National month 1 - KLocale::LongName Possessive" 5301 msgid "of Chaitra" 5302 msgstr "মুহর্রমের" 5303 5304 #: kdecore/kcalendarsystemindiannational.cpp:253 5305 #, fuzzy, kde-format 5306 msgctxt "Indian National month 2 - KLocale::LongName Possessive" 5307 msgid "of Vaishākh" 5308 msgstr "of Far" 5309 5310 #: kdecore/kcalendarsystemindiannational.cpp:255 5311 #, fuzzy, kde-format 5312 msgctxt "Indian National month 3 - KLocale::LongName Possessive" 5313 msgid "of Jyaishtha" 5314 msgstr "of Nisan" 5315 5316 #: kdecore/kcalendarsystemindiannational.cpp:257 5317 #, fuzzy, kde-format 5318 msgctxt "Indian National month 4 - KLocale::LongName Possessive" 5319 msgid "of Āshādha" 5320 msgstr "of Kho" 5321 5322 #: kdecore/kcalendarsystemindiannational.cpp:259 5323 #, fuzzy, kde-format 5324 msgctxt "Indian National month 5 - KLocale::LongName Possessive" 5325 msgid "of Shrāvana" 5326 msgstr "of Shvat" 5327 5328 #: kdecore/kcalendarsystemindiannational.cpp:261 5329 #, fuzzy, kde-format 5330 msgctxt "Indian National month 6 - KLocale::LongName Possessive" 5331 msgid "of Bhādrapad" 5332 msgstr "of Khordad" 5333 5334 #: kdecore/kcalendarsystemindiannational.cpp:263 5335 #, fuzzy, kde-format 5336 msgctxt "Indian National month 7 - KLocale::LongName Possessive" 5337 msgid "of Āshwin" 5338 msgstr "of Heshvan" 5339 5340 #: kdecore/kcalendarsystemindiannational.cpp:265 5341 #, fuzzy, kde-format 5342 msgctxt "Indian National month 8 - KLocale::LongName Possessive" 5343 msgid "of Kārtik" 5344 msgstr "of Far" 5345 5346 #: kdecore/kcalendarsystemindiannational.cpp:267 5347 #, fuzzy, kde-format 5348 msgctxt "Indian National month 9 - KLocale::LongName Possessive" 5349 msgid "of Agrahayana" 5350 msgstr "of Bahman" 5351 5352 #: kdecore/kcalendarsystemindiannational.cpp:269 5353 #, fuzzy, kde-format 5354 msgctxt "Indian National month 10 - KLocale::LongName Possessive" 5355 msgid "of Paush" 5356 msgstr "of Bah" 5357 5358 #: kdecore/kcalendarsystemindiannational.cpp:271 5359 #, fuzzy, kde-format 5360 msgctxt "Indian National month 11 - KLocale::LongName Possessive" 5361 msgid "of Māgh" 5362 msgstr "of Meh" 5363 5364 #: kdecore/kcalendarsystemindiannational.cpp:273 5365 #, fuzzy, kde-format 5366 msgctxt "Indian National month 12 - KLocale::LongName Possessive" 5367 msgid "of Phālgun" 5368 msgstr "of Kho" 5369 5370 #: kdecore/kcalendarsystemindiannational.cpp:282 5371 #, fuzzy, kde-format 5372 msgctxt "Indian National month 1 - KLocale::LongName" 5373 msgid "Chaitra" 5374 msgstr "মুহর্রমের" 5375 5376 #: kdecore/kcalendarsystemindiannational.cpp:284 5377 #, fuzzy, kde-format 5378 msgctxt "Indian National month 2 - KLocale::LongName" 5379 msgid "Vaishākh" 5380 msgstr "of Far" 5381 5382 #: kdecore/kcalendarsystemindiannational.cpp:286 5383 #, fuzzy, kde-format 5384 msgctxt "Indian National month 3 - KLocale::LongName" 5385 msgid "Jyaishtha" 5386 msgstr "of Nisan" 5387 5388 #: kdecore/kcalendarsystemindiannational.cpp:288 5389 #, fuzzy, kde-format 5390 msgctxt "Indian National month 4 - KLocale::LongName" 5391 msgid "Āshādha" 5392 msgstr "of Kho" 5393 5394 #: kdecore/kcalendarsystemindiannational.cpp:290 5395 #, fuzzy, kde-format 5396 msgctxt "Indian National month 5 - KLocale::LongName" 5397 msgid "Shrāvana" 5398 msgstr "of Shvat" 5399 5400 #: kdecore/kcalendarsystemindiannational.cpp:292 5401 #, fuzzy, kde-format 5402 msgctxt "Indian National month 6 - KLocale::LongName" 5403 msgid "Bhādrapad" 5404 msgstr "of Khordad" 5405 5406 #: kdecore/kcalendarsystemindiannational.cpp:294 5407 #, fuzzy, kde-format 5408 msgctxt "Indian National month 7 - KLocale::LongName" 5409 msgid "Āshwin" 5410 msgstr "of Heshvan" 5411 5412 #: kdecore/kcalendarsystemindiannational.cpp:296 5413 #, fuzzy, kde-format 5414 msgctxt "Indian National month 8 - KLocale::LongName" 5415 msgid "Kārtik" 5416 msgstr "of Far" 5417 5418 #: kdecore/kcalendarsystemindiannational.cpp:298 5419 #, fuzzy, kde-format 5420 msgctxt "Indian National month 9 - KLocale::LongName" 5421 msgid "Agrahayana" 5422 msgstr "Thaana" 5423 5424 #: kdecore/kcalendarsystemindiannational.cpp:300 5425 #, fuzzy, kde-format 5426 msgctxt "Indian National month 10 - KLocale::LongName" 5427 msgid "Paush" 5428 msgstr "স্থগিত রাখো" 5429 5430 #: kdecore/kcalendarsystemindiannational.cpp:302 5431 #, fuzzy, kde-format 5432 msgctxt "Indian National month 11 - KLocale::LongName" 5433 msgid "Māgh" 5434 msgstr "of Meh" 5435 5436 #: kdecore/kcalendarsystemindiannational.cpp:304 5437 #, fuzzy, kde-format 5438 msgctxt "Indian National month 12 - KLocale::LongName" 5439 msgid "Phālgun" 5440 msgstr "of Kho" 5441 5442 #: kdecore/kcalendarsystemindiannational.cpp:317 5443 #, kde-format 5444 msgctxt "Indian National weekday 1 - KLocale::NarrowName " 5445 msgid "S" 5446 msgstr "" 5447 5448 #: kdecore/kcalendarsystemindiannational.cpp:319 5449 #, kde-format 5450 msgctxt "Indian National weekday 2 - KLocale::NarrowName " 5451 msgid "M" 5452 msgstr "" 5453 5454 #: kdecore/kcalendarsystemindiannational.cpp:321 5455 #, kde-format 5456 msgctxt "Indian National weekday 3 - KLocale::NarrowName " 5457 msgid "B" 5458 msgstr "" 5459 5460 #: kdecore/kcalendarsystemindiannational.cpp:323 5461 #, kde-format 5462 msgctxt "Indian National weekday 4 - KLocale::NarrowName " 5463 msgid "G" 5464 msgstr "" 5465 5466 #: kdecore/kcalendarsystemindiannational.cpp:325 5467 #, kde-format 5468 msgctxt "Indian National weekday 5 - KLocale::NarrowName " 5469 msgid "S" 5470 msgstr "" 5471 5472 #: kdecore/kcalendarsystemindiannational.cpp:327 5473 #, kde-format 5474 msgctxt "Indian National weekday 6 - KLocale::NarrowName " 5475 msgid "S" 5476 msgstr "" 5477 5478 #: kdecore/kcalendarsystemindiannational.cpp:329 5479 #, kde-format 5480 msgctxt "Indian National weekday 7 - KLocale::NarrowName " 5481 msgid "R" 5482 msgstr "" 5483 5484 #: kdecore/kcalendarsystemindiannational.cpp:338 5485 #, fuzzy, kde-format 5486 msgctxt "Indian National weekday 1 - KLocale::ShortName" 5487 msgid "Som" 5488 msgstr "Jom" 5489 5490 #: kdecore/kcalendarsystemindiannational.cpp:340 5491 #, kde-format 5492 msgctxt "Indian National weekday 2 - KLocale::ShortName" 5493 msgid "Mañ" 5494 msgstr "" 5495 5496 #: kdecore/kcalendarsystemindiannational.cpp:342 5497 #, fuzzy, kde-format 5498 msgctxt "Indian National weekday 3 - KLocale::ShortName" 5499 msgid "Bud" 5500 msgstr "Buhid" 5501 5502 #: kdecore/kcalendarsystemindiannational.cpp:344 5503 #, kde-format 5504 msgctxt "Indian National weekday 4 - KLocale::ShortName" 5505 msgid "Gur" 5506 msgstr "" 5507 5508 #: kdecore/kcalendarsystemindiannational.cpp:346 5509 #, fuzzy, kde-format 5510 msgctxt "Indian National weekday 5 - KLocale::ShortName" 5511 msgid "Suk" 5512 msgstr "রবি" 5513 5514 #: kdecore/kcalendarsystemindiannational.cpp:348 5515 #, fuzzy, kde-format 5516 msgctxt "Indian National weekday 6 - KLocale::ShortName" 5517 msgid "San" 5518 msgstr "সিভান" 5519 5520 #: kdecore/kcalendarsystemindiannational.cpp:350 5521 #, kde-format 5522 msgctxt "Indian National weekday 7 - KLocale::ShortName" 5523 msgid "Rav" 5524 msgstr "" 5525 5526 #: kdecore/kcalendarsystemindiannational.cpp:357 5527 #, kde-format 5528 msgctxt "Indian National weekday 1 - KLocale::LongName" 5529 msgid "Somavãra" 5530 msgstr "" 5531 5532 #: kdecore/kcalendarsystemindiannational.cpp:359 5533 #, kde-format 5534 msgctxt "Indian National weekday 2 - KLocale::LongName" 5535 msgid "Mañgalvã" 5536 msgstr "" 5537 5538 #: kdecore/kcalendarsystemindiannational.cpp:361 5539 #, kde-format 5540 msgctxt "Indian National weekday 3 - KLocale::LongName" 5541 msgid "Budhavãra" 5542 msgstr "" 5543 5544 #: kdecore/kcalendarsystemindiannational.cpp:363 5545 #, kde-format 5546 msgctxt "Indian National weekday 4 - KLocale::LongName" 5547 msgid "Guruvãra" 5548 msgstr "" 5549 5550 #: kdecore/kcalendarsystemindiannational.cpp:365 5551 #, kde-format 5552 msgctxt "Indian National weekday 5 - KLocale::LongName" 5553 msgid "Sukravãra" 5554 msgstr "" 5555 5556 #: kdecore/kcalendarsystemindiannational.cpp:367 5557 #, kde-format 5558 msgctxt "Indian National weekday 6 - KLocale::LongName" 5559 msgid "Sanivãra" 5560 msgstr "" 5561 5562 #: kdecore/kcalendarsystemindiannational.cpp:369 5563 #, kde-format 5564 msgctxt "Indian National weekday 7 - KLocale::LongName" 5565 msgid "Raviãra" 5566 msgstr "" 5567 5568 #: kdecore/kcalendarsystemislamiccivil.cpp:66 5569 #, kde-format 5570 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5571 msgid "Anno Hegirae" 5572 msgstr "" 5573 5574 #: kdecore/kcalendarsystemislamiccivil.cpp:67 5575 #, kde-format 5576 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5577 msgid "AH" 5578 msgstr "" 5579 5580 #: kdecore/kcalendarsystemislamiccivil.cpp:68 5581 #, kde-format 5582 msgctxt "" 5583 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5584 msgid "%Ey %EC" 5585 msgstr "" 5586 5587 #: kdecore/kcalendarsystemislamiccivil.cpp:166 5588 #, kde-format 5589 msgctxt "Hijri month 1 - KLocale::NarrowName" 5590 msgid "M" 5591 msgstr "" 5592 5593 #: kdecore/kcalendarsystemislamiccivil.cpp:168 5594 #, kde-format 5595 msgctxt "Hijri month 2 - KLocale::NarrowName" 5596 msgid "S" 5597 msgstr "" 5598 5599 #: kdecore/kcalendarsystemislamiccivil.cpp:170 5600 #, fuzzy, kde-format 5601 #| msgid "Av" 5602 msgctxt "Hijri month 3 - KLocale::NarrowName" 5603 msgid "A" 5604 msgstr "আভ" 5605 5606 #: kdecore/kcalendarsystemislamiccivil.cpp:172 5607 #, kde-format 5608 msgctxt "Hijri month 4 - KLocale::NarrowName" 5609 msgid "T" 5610 msgstr "" 5611 5612 #: kdecore/kcalendarsystemislamiccivil.cpp:174 5613 #, fuzzy, kde-format 5614 #| msgid "Av" 5615 msgctxt "Hijri month 5 - KLocale::NarrowName" 5616 msgid "A" 5617 msgstr "আভ" 5618 5619 #: kdecore/kcalendarsystemislamiccivil.cpp:176 5620 #, kde-format 5621 msgctxt "Hijri month 6 - KLocale::NarrowName" 5622 msgid "T" 5623 msgstr "" 5624 5625 #: kdecore/kcalendarsystemislamiccivil.cpp:178 5626 #, kde-format 5627 msgctxt "Hijri month 7 - KLocale::NarrowName" 5628 msgid "R" 5629 msgstr "" 5630 5631 #: kdecore/kcalendarsystemislamiccivil.cpp:180 5632 #, kde-format 5633 msgctxt "Hijri month 8 - KLocale::NarrowName" 5634 msgid "S" 5635 msgstr "" 5636 5637 #: kdecore/kcalendarsystemislamiccivil.cpp:182 5638 #, kde-format 5639 msgctxt "Hijri month 9 - KLocale::NarrowName" 5640 msgid "R" 5641 msgstr "" 5642 5643 #: kdecore/kcalendarsystemislamiccivil.cpp:184 5644 #, kde-format 5645 msgctxt "Hijri month 10 - KLocale::NarrowName" 5646 msgid "S" 5647 msgstr "" 5648 5649 #: kdecore/kcalendarsystemislamiccivil.cpp:186 5650 #, kde-format 5651 msgctxt "Hijri month 11 - KLocale::NarrowName" 5652 msgid "Q" 5653 msgstr "" 5654 5655 #: kdecore/kcalendarsystemislamiccivil.cpp:188 5656 #, kde-format 5657 msgctxt "Hijri month 12 - KLocale::NarrowName" 5658 msgid "H" 5659 msgstr "" 5660 5661 #: kdecore/kcalendarsystemislamiccivil.cpp:197 5662 #, fuzzy, kde-format 5663 #| msgctxt "of Mehr short" 5664 #| msgid "of Meh" 5665 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5666 msgid "of Muh" 5667 msgstr "of Meh" 5668 5669 #: kdecore/kcalendarsystemislamiccivil.cpp:199 5670 #, fuzzy, kde-format 5671 #| msgid "of Safar" 5672 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5673 msgid "of Saf" 5674 msgstr "সফরের" 5675 5676 #: kdecore/kcalendarsystemislamiccivil.cpp:201 5677 #, fuzzy, kde-format 5678 #| msgid "of R. Awal" 5679 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5680 msgid "of R.A" 5681 msgstr "রবিউল আওয়ালের" 5682 5683 #: kdecore/kcalendarsystemislamiccivil.cpp:203 5684 #, fuzzy, kde-format 5685 #| msgid "of R. Thaani" 5686 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5687 msgid "of R.T" 5688 msgstr "রবিউস সানির" 5689 5690 #: kdecore/kcalendarsystemislamiccivil.cpp:205 5691 #, fuzzy, kde-format 5692 #| msgid "of J. Awal" 5693 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5694 msgid "of J.A" 5695 msgstr "জামাদিউল আওয়ালের" 5696 5697 #: kdecore/kcalendarsystemislamiccivil.cpp:207 5698 #, fuzzy, kde-format 5699 #| msgid "of J. Thaani" 5700 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5701 msgid "of J.T" 5702 msgstr "জামাদিউস সানির" 5703 5704 #: kdecore/kcalendarsystemislamiccivil.cpp:209 5705 #, fuzzy, kde-format 5706 #| msgid "of Rajab" 5707 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5708 msgid "of Raj" 5709 msgstr "রজবের" 5710 5711 #: kdecore/kcalendarsystemislamiccivil.cpp:211 5712 #, fuzzy, kde-format 5713 #| msgctxt "of Shahrivar short" 5714 #| msgid "of Sha" 5715 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5716 msgid "of Sha" 5717 msgstr "of Sha" 5718 5719 #: kdecore/kcalendarsystemislamiccivil.cpp:213 5720 #, fuzzy, kde-format 5721 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5722 msgid "of Ram" 5723 msgstr "of Tamuz" 5724 5725 #: kdecore/kcalendarsystemislamiccivil.cpp:215 5726 #, fuzzy, kde-format 5727 #| msgctxt "of Shahrivar short" 5728 #| msgid "of Sha" 5729 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5730 msgid "of Shw" 5731 msgstr "of Sha" 5732 5733 #: kdecore/kcalendarsystemislamiccivil.cpp:217 5734 #, fuzzy, kde-format 5735 #| msgid "of Qi`dah" 5736 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5737 msgid "of Qid" 5738 msgstr "জিলকাদ" 5739 5740 #: kdecore/kcalendarsystemislamiccivil.cpp:219 5741 #, fuzzy, kde-format 5742 #| msgid "of Hijjah" 5743 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5744 msgid "of Hij" 5745 msgstr "জিলহাজ" 5746 5747 #: kdecore/kcalendarsystemislamiccivil.cpp:228 5748 #, fuzzy, kde-format 5749 #| msgctxt "Mehr short" 5750 #| msgid "Meh" 5751 msgctxt "Hijri month 1 - KLocale::ShortName" 5752 msgid "Muh" 5753 msgstr "Meh" 5754 5755 #: kdecore/kcalendarsystemislamiccivil.cpp:230 5756 #, fuzzy, kde-format 5757 #| msgid "Safar" 5758 msgctxt "Hijri month 2 - KLocale::ShortName" 5759 msgid "Saf" 5760 msgstr "সফর" 5761 5762 #: kdecore/kcalendarsystemislamiccivil.cpp:232 5763 #, fuzzy, kde-format 5764 #| msgid "R. Awal" 5765 msgctxt "Hijri month 3 - KLocale::ShortName" 5766 msgid "R.A" 5767 msgstr "রবিউল আওয়াল" 5768 5769 #: kdecore/kcalendarsystemislamiccivil.cpp:234 5770 #, kde-format 5771 msgctxt "Hijri month 4 - KLocale::ShortName" 5772 msgid "R.T" 5773 msgstr "" 5774 5775 #: kdecore/kcalendarsystemislamiccivil.cpp:236 5776 #, fuzzy, kde-format 5777 #| msgid "J. Awal" 5778 msgctxt "Hijri month 5 - KLocale::ShortName" 5779 msgid "J.A" 5780 msgstr "জামাদিউল আওয়াল" 5781 5782 #: kdecore/kcalendarsystemislamiccivil.cpp:238 5783 #, kde-format 5784 msgctxt "Hijri month 6 - KLocale::ShortName" 5785 msgid "J.T" 5786 msgstr "" 5787 5788 #: kdecore/kcalendarsystemislamiccivil.cpp:240 5789 #, fuzzy, kde-format 5790 #| msgid "Rajab" 5791 msgctxt "Hijri month 7 - KLocale::ShortName" 5792 msgid "Raj" 5793 msgstr "রজব" 5794 5795 #: kdecore/kcalendarsystemislamiccivil.cpp:242 5796 #, fuzzy, kde-format 5797 #| msgctxt "Shahrivar short" 5798 #| msgid "Sha" 5799 msgctxt "Hijri month 8 - KLocale::ShortName" 5800 msgid "Sha" 5801 msgstr "Sha" 5802 5803 #: kdecore/kcalendarsystemislamiccivil.cpp:244 5804 #, fuzzy, kde-format 5805 msgctxt "Hijri month 9 - KLocale::ShortName" 5806 msgid "Ram" 5807 msgstr "এ.এম." 5808 5809 #: kdecore/kcalendarsystemislamiccivil.cpp:246 5810 #, fuzzy, kde-format 5811 #| msgctxt "Shahrivar short" 5812 #| msgid "Sha" 5813 msgctxt "Hijri month 10 - KLocale::ShortName" 5814 msgid "Shw" 5815 msgstr "Sha" 5816 5817 #: kdecore/kcalendarsystemislamiccivil.cpp:248 5818 #, fuzzy, kde-format 5819 #| msgid "Qi`dah" 5820 msgctxt "Hijri month 11 - KLocale::ShortName" 5821 msgid "Qid" 5822 msgstr "কাদ (?)" 5823 5824 #: kdecore/kcalendarsystemislamiccivil.cpp:250 5825 #, fuzzy, kde-format 5826 #| msgctxt "@item Calendar system" 5827 #| msgid "Hijri" 5828 msgctxt "Hijri month 12 - KLocale::ShortName" 5829 msgid "Hij" 5830 msgstr "Hijri" 5831 5832 #: kdecore/kcalendarsystemislamiccivil.cpp:259 5833 #, fuzzy, kde-format 5834 #| msgid "of Muharram" 5835 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5836 msgid "of Muharram" 5837 msgstr "মুহর্রমের" 5838 5839 #: kdecore/kcalendarsystemislamiccivil.cpp:261 5840 #, fuzzy, kde-format 5841 #| msgid "of Safar" 5842 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5843 msgid "of Safar" 5844 msgstr "সফরের" 5845 5846 #: kdecore/kcalendarsystemislamiccivil.cpp:263 5847 #, fuzzy, kde-format 5848 #| msgid "of Rabi` al-Awal" 5849 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5850 msgid "of Rabi` al-Awal" 5851 msgstr "রবিউল আওয়ালের" 5852 5853 #: kdecore/kcalendarsystemislamiccivil.cpp:265 5854 #, fuzzy, kde-format 5855 #| msgid "of Rabi` al-Thaani" 5856 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5857 msgid "of Rabi` al-Thaani" 5858 msgstr "রবিউস সানির" 5859 5860 #: kdecore/kcalendarsystemislamiccivil.cpp:267 5861 #, fuzzy, kde-format 5862 #| msgid "of Jumaada al-Awal" 5863 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5864 msgid "of Jumaada al-Awal" 5865 msgstr "জামাদিউল আওয়ালের" 5866 5867 #: kdecore/kcalendarsystemislamiccivil.cpp:269 5868 #, fuzzy, kde-format 5869 #| msgid "of Jumaada al-Thaani" 5870 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5871 msgid "of Jumaada al-Thaani" 5872 msgstr "জামাদিউস সানির" 5873 5874 #: kdecore/kcalendarsystemislamiccivil.cpp:271 5875 #, fuzzy, kde-format 5876 #| msgid "of Rajab" 5877 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5878 msgid "of Rajab" 5879 msgstr "রজবের" 5880 5881 #: kdecore/kcalendarsystemislamiccivil.cpp:273 5882 #, fuzzy, kde-format 5883 #| msgid "of Sha`ban" 5884 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5885 msgid "of Sha`ban" 5886 msgstr "সাবানের" 5887 5888 #: kdecore/kcalendarsystemislamiccivil.cpp:275 5889 #, fuzzy, kde-format 5890 #| msgid "of Ramadan" 5891 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5892 msgid "of Ramadan" 5893 msgstr "রমজানের" 5894 5895 #: kdecore/kcalendarsystemislamiccivil.cpp:277 5896 #, fuzzy, kde-format 5897 #| msgid "of Shawwal" 5898 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5899 msgid "of Shawwal" 5900 msgstr "শাওয়াল" 5901 5902 #: kdecore/kcalendarsystemislamiccivil.cpp:279 5903 #, fuzzy, kde-format 5904 #| msgid "of Thu al-Qi`dah" 5905 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5906 msgid "of Thu al-Qi`dah" 5907 msgstr "জুলকিদা'র" 5908 5909 #: kdecore/kcalendarsystemislamiccivil.cpp:281 5910 #, fuzzy, kde-format 5911 #| msgid "of Thu al-Hijjah" 5912 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5913 msgid "of Thu al-Hijjah" 5914 msgstr "জিলহাজে'র" 5915 5916 #: kdecore/kcalendarsystemislamiccivil.cpp:290 5917 #, fuzzy, kde-format 5918 #| msgid "Muharram" 5919 msgctxt "Hijri month 1 - KLocale::LongName" 5920 msgid "Muharram" 5921 msgstr "মুহর্রম" 5922 5923 #: kdecore/kcalendarsystemislamiccivil.cpp:292 5924 #, fuzzy, kde-format 5925 #| msgid "Safar" 5926 msgctxt "Hijri month 2 - KLocale::LongName" 5927 msgid "Safar" 5928 msgstr "সফর" 5929 5930 #: kdecore/kcalendarsystemislamiccivil.cpp:294 5931 #, fuzzy, kde-format 5932 #| msgid "Rabi` al-Awal" 5933 msgctxt "Hijri month 3 - KLocale::LongName" 5934 msgid "Rabi` al-Awal" 5935 msgstr "রবিউল আওয়াল" 5936 5937 #: kdecore/kcalendarsystemislamiccivil.cpp:296 5938 #, fuzzy, kde-format 5939 #| msgid "Rabi` al-Thaani" 5940 msgctxt "Hijri month 4 - KLocale::LongName" 5941 msgid "Rabi` al-Thaani" 5942 msgstr "রবিউস সানি" 5943 5944 #: kdecore/kcalendarsystemislamiccivil.cpp:298 5945 #, fuzzy, kde-format 5946 #| msgid "Jumaada al-Awal" 5947 msgctxt "Hijri month 5 - KLocale::LongName" 5948 msgid "Jumaada al-Awal" 5949 msgstr "জামাদিউল আওয়াল" 5950 5951 #: kdecore/kcalendarsystemislamiccivil.cpp:300 5952 #, fuzzy, kde-format 5953 #| msgid "Jumaada al-Thaani" 5954 msgctxt "Hijri month 6 - KLocale::LongName" 5955 msgid "Jumaada al-Thaani" 5956 msgstr "জামাদিউস সানি" 5957 5958 #: kdecore/kcalendarsystemislamiccivil.cpp:302 5959 #, fuzzy, kde-format 5960 #| msgid "Rajab" 5961 msgctxt "Hijri month 7 - KLocale::LongName" 5962 msgid "Rajab" 5963 msgstr "রজব" 5964 5965 #: kdecore/kcalendarsystemislamiccivil.cpp:304 5966 #, fuzzy, kde-format 5967 #| msgid "Sha`ban" 5968 msgctxt "Hijri month 8 - KLocale::LongName" 5969 msgid "Sha`ban" 5970 msgstr "সাবান" 5971 5972 #: kdecore/kcalendarsystemislamiccivil.cpp:306 5973 #, fuzzy, kde-format 5974 #| msgid "Ramadan" 5975 msgctxt "Hijri month 9 - KLocale::LongName" 5976 msgid "Ramadan" 5977 msgstr "রমজান" 5978 5979 #: kdecore/kcalendarsystemislamiccivil.cpp:308 5980 #, fuzzy, kde-format 5981 #| msgid "Shawwal" 5982 msgctxt "Hijri month 10 - KLocale::LongName" 5983 msgid "Shawwal" 5984 msgstr "শাওয়াল" 5985 5986 #: kdecore/kcalendarsystemislamiccivil.cpp:310 5987 #, fuzzy, kde-format 5988 #| msgid "Thu al-Qi`dah" 5989 msgctxt "Hijri month 11 - KLocale::LongName" 5990 msgid "Thu al-Qi`dah" 5991 msgstr "জিলকাদ" 5992 5993 #: kdecore/kcalendarsystemislamiccivil.cpp:312 5994 #, fuzzy, kde-format 5995 #| msgid "Thu al-Hijjah" 5996 msgctxt "Hijri month 12 - KLocale::LongName" 5997 msgid "Thu al-Hijjah" 5998 msgstr "জিলহাজ" 5999 6000 #: kdecore/kcalendarsystemislamiccivil.cpp:325 6001 #, kde-format 6002 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 6003 msgid "I" 6004 msgstr "" 6005 6006 #: kdecore/kcalendarsystemislamiccivil.cpp:327 6007 #, kde-format 6008 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 6009 msgid "T" 6010 msgstr "" 6011 6012 #: kdecore/kcalendarsystemislamiccivil.cpp:329 6013 #, fuzzy, kde-format 6014 #| msgid "Av" 6015 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 6016 msgid "A" 6017 msgstr "আভ" 6018 6019 #: kdecore/kcalendarsystemislamiccivil.cpp:331 6020 #, kde-format 6021 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 6022 msgid "K" 6023 msgstr "" 6024 6025 #: kdecore/kcalendarsystemislamiccivil.cpp:333 6026 #, kde-format 6027 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 6028 msgid "J" 6029 msgstr "" 6030 6031 #: kdecore/kcalendarsystemislamiccivil.cpp:335 6032 #, kde-format 6033 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 6034 msgid "S" 6035 msgstr "" 6036 6037 #: kdecore/kcalendarsystemislamiccivil.cpp:337 6038 #, fuzzy, kde-format 6039 #| msgid "Av" 6040 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6041 msgid "A" 6042 msgstr "আভ" 6043 6044 #: kdecore/kcalendarsystemislamiccivil.cpp:346 6045 #, fuzzy, kde-format 6046 #| msgid "Ith" 6047 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6048 msgid "Ith" 6049 msgstr "ইসনাইন (সোম)" 6050 6051 #: kdecore/kcalendarsystemislamiccivil.cpp:348 6052 #, fuzzy, kde-format 6053 #| msgid "Thl" 6054 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6055 msgid "Thl" 6056 msgstr "সালাসা (মঙ্গল)" 6057 6058 #: kdecore/kcalendarsystemislamiccivil.cpp:350 6059 #, fuzzy, kde-format 6060 #| msgid "Arb" 6061 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6062 msgid "Arb" 6063 msgstr "আরবা (বুধ)" 6064 6065 #: kdecore/kcalendarsystemislamiccivil.cpp:352 6066 #, fuzzy, kde-format 6067 #| msgid "Kha" 6068 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6069 msgid "Kha" 6070 msgstr "খামিস (বৃহঃ)" 6071 6072 #: kdecore/kcalendarsystemislamiccivil.cpp:354 6073 #, fuzzy, kde-format 6074 #| msgid "Jum" 6075 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6076 msgid "Jum" 6077 msgstr "জুমা (শুক্র)" 6078 6079 #: kdecore/kcalendarsystemislamiccivil.cpp:356 6080 #, fuzzy, kde-format 6081 #| msgid "Sab" 6082 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6083 msgid "Sab" 6084 msgstr "সাব্ত (শনি)" 6085 6086 #: kdecore/kcalendarsystemislamiccivil.cpp:358 6087 #, fuzzy, kde-format 6088 #| msgid "Ahd" 6089 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6090 msgid "Ahd" 6091 msgstr "আহাদ (রবি)" 6092 6093 #: kdecore/kcalendarsystemislamiccivil.cpp:365 6094 #, fuzzy, kde-format 6095 #| msgid "Yaum al-Ithnain" 6096 msgctxt "Hijri weekday 1 - KLocale::LongName" 6097 msgid "Yaum al-Ithnain" 6098 msgstr "ইয়াওমুল ইসনাইন (সোম)" 6099 6100 #: kdecore/kcalendarsystemislamiccivil.cpp:367 6101 #, fuzzy, kde-format 6102 #| msgid "Yau al-Thulatha" 6103 msgctxt "Hijri weekday 2 - KLocale::LongName" 6104 msgid "Yau al-Thulatha" 6105 msgstr "ইয়াওমুল সালাসা (মঙ্গল)" 6106 6107 #: kdecore/kcalendarsystemislamiccivil.cpp:369 6108 #, fuzzy, kde-format 6109 #| msgid "Yaum al-Arbi'a" 6110 msgctxt "Hijri weekday 3 - KLocale::LongName" 6111 msgid "Yaum al-Arbi'a" 6112 msgstr "ইয়াওমুল আরবা (বুধ)" 6113 6114 #: kdecore/kcalendarsystemislamiccivil.cpp:371 6115 #, fuzzy, kde-format 6116 #| msgid "Yaum al-Khamees" 6117 msgctxt "Hijri weekday 4 - KLocale::LongName" 6118 msgid "Yaum al-Khamees" 6119 msgstr "ইয়াওমুল খামিস (বৃহঃ)" 6120 6121 #: kdecore/kcalendarsystemislamiccivil.cpp:373 6122 #, fuzzy, kde-format 6123 #| msgid "Yaum al-Jumma" 6124 msgctxt "Hijri weekday 5 - KLocale::LongName" 6125 msgid "Yaum al-Jumma" 6126 msgstr "ইয়াওমুল জুমা (শুক্র)" 6127 6128 #: kdecore/kcalendarsystemislamiccivil.cpp:375 6129 #, fuzzy, kde-format 6130 #| msgid "Yaum al-Sabt" 6131 msgctxt "Hijri weekday 6 - KLocale::LongName" 6132 msgid "Yaum al-Sabt" 6133 msgstr "ইয়াওমুল সাব্ত (শনি)" 6134 6135 #: kdecore/kcalendarsystemislamiccivil.cpp:377 6136 #, fuzzy, kde-format 6137 #| msgid "Yaum al-Ahad" 6138 msgctxt "Hijri weekday 7 - KLocale::LongName" 6139 msgid "Yaum al-Ahad" 6140 msgstr "ইয়াওমুল আহাদ (রবি)" 6141 6142 #: kdecore/kcalendarsystemjalali.cpp:74 6143 #, kde-format 6144 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" 6145 msgid "Anno Persico" 6146 msgstr "" 6147 6148 #: kdecore/kcalendarsystemjalali.cpp:75 6149 #, kde-format 6150 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" 6151 msgid "AP" 6152 msgstr "" 6153 6154 #: kdecore/kcalendarsystemjalali.cpp:76 6155 #, kde-format 6156 msgctxt "" 6157 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 6158 msgid "%Ey %EC" 6159 msgstr "" 6160 6161 #: kdecore/kcalendarsystemjalali.cpp:172 6162 #, kde-format 6163 msgctxt "Jalali month 1 - KLocale::NarrowName" 6164 msgid "F" 6165 msgstr "" 6166 6167 #: kdecore/kcalendarsystemjalali.cpp:174 6168 #, kde-format 6169 msgctxt "Jalali month 2 - KLocale::NarrowName" 6170 msgid "O" 6171 msgstr "" 6172 6173 #: kdecore/kcalendarsystemjalali.cpp:176 6174 #, kde-format 6175 msgctxt "Jalali month 3 - KLocale::NarrowName" 6176 msgid "K" 6177 msgstr "" 6178 6179 #: kdecore/kcalendarsystemjalali.cpp:178 6180 #, kde-format 6181 msgctxt "Jalali month 4 - KLocale::NarrowName" 6182 msgid "T" 6183 msgstr "" 6184 6185 #: kdecore/kcalendarsystemjalali.cpp:180 6186 #, kde-format 6187 msgctxt "Jalali month 5 - KLocale::NarrowName" 6188 msgid "M" 6189 msgstr "" 6190 6191 #: kdecore/kcalendarsystemjalali.cpp:182 6192 #, kde-format 6193 msgctxt "Jalali month 6 - KLocale::NarrowName" 6194 msgid "S" 6195 msgstr "" 6196 6197 #: kdecore/kcalendarsystemjalali.cpp:184 6198 #, kde-format 6199 msgctxt "Jalali month 7 - KLocale::NarrowName" 6200 msgid "M" 6201 msgstr "" 6202 6203 #: kdecore/kcalendarsystemjalali.cpp:186 6204 #, fuzzy, kde-format 6205 #| msgid "Av" 6206 msgctxt "Jalali month 8 - KLocale::NarrowName" 6207 msgid "A" 6208 msgstr "আভ" 6209 6210 #: kdecore/kcalendarsystemjalali.cpp:188 6211 #, fuzzy, kde-format 6212 #| msgid "Av" 6213 msgctxt "Jalali month 9 - KLocale::NarrowName" 6214 msgid "A" 6215 msgstr "আভ" 6216 6217 #: kdecore/kcalendarsystemjalali.cpp:190 6218 #, kde-format 6219 msgctxt "Jalali month 10 - KLocale::NarrowName" 6220 msgid "D" 6221 msgstr "" 6222 6223 #: kdecore/kcalendarsystemjalali.cpp:192 6224 #, kde-format 6225 msgctxt "Jalali month 11 - KLocale::NarrowName" 6226 msgid "B" 6227 msgstr "" 6228 6229 #: kdecore/kcalendarsystemjalali.cpp:194 6230 #, kde-format 6231 msgctxt "Jalali month 12 - KLocale::NarrowName" 6232 msgid "E" 6233 msgstr "" 6234 6235 #: kdecore/kcalendarsystemjalali.cpp:203 6236 #, fuzzy, kde-format 6237 #| msgctxt "of Farvardin short" 6238 #| msgid "of Far" 6239 msgctxt "Jalali month 1 - KLocale::ShortName Possessive" 6240 msgid "of Far" 6241 msgstr "of Far" 6242 6243 #: kdecore/kcalendarsystemjalali.cpp:205 6244 #, fuzzy, kde-format 6245 #| msgctxt "of Ordibehesht short" 6246 #| msgid "of Ord" 6247 msgctxt "Jalali month 2 - KLocale::ShortName Possessive" 6248 msgid "of Ord" 6249 msgstr "of Ord" 6250 6251 #: kdecore/kcalendarsystemjalali.cpp:207 6252 #, fuzzy, kde-format 6253 #| msgctxt "of Khordad short" 6254 #| msgid "of Kho" 6255 msgctxt "Jalali month 3 - KLocale::ShortName Possessive" 6256 msgid "of Kho" 6257 msgstr "of Kho" 6258 6259 #: kdecore/kcalendarsystemjalali.cpp:209 6260 #, fuzzy, kde-format 6261 #| msgctxt "of Tir short" 6262 #| msgid "of Tir" 6263 msgctxt "Jalali month 4 - KLocale::ShortName Possessive" 6264 msgid "of Tir" 6265 msgstr "of Tir" 6266 6267 #: kdecore/kcalendarsystemjalali.cpp:211 6268 #, fuzzy, kde-format 6269 #| msgctxt "of Mordad short" 6270 #| msgid "of Mor" 6271 msgctxt "Jalali month 5 - KLocale::ShortName Possessive" 6272 msgid "of Mor" 6273 msgstr "of Mor" 6274 6275 #: kdecore/kcalendarsystemjalali.cpp:213 6276 #, fuzzy, kde-format 6277 #| msgctxt "of Shahrivar short" 6278 #| msgid "of Sha" 6279 msgctxt "Jalali month 6 - KLocale::ShortName Possessive" 6280 msgid "of Sha" 6281 msgstr "of Sha" 6282 6283 #: kdecore/kcalendarsystemjalali.cpp:215 6284 #, fuzzy, kde-format 6285 #| msgctxt "of Mehr short" 6286 #| msgid "of Meh" 6287 msgctxt "Jalali month 7 - KLocale::ShortName Possessive" 6288 msgid "of Meh" 6289 msgstr "of Meh" 6290 6291 #: kdecore/kcalendarsystemjalali.cpp:217 6292 #, fuzzy, kde-format 6293 #| msgctxt "of Aban short" 6294 #| msgid "of Aba" 6295 msgctxt "Jalali month 8 - KLocale::ShortName Possessive" 6296 msgid "of Aba" 6297 msgstr "of Aba" 6298 6299 #: kdecore/kcalendarsystemjalali.cpp:219 6300 #, fuzzy, kde-format 6301 #| msgctxt "of Azar short" 6302 #| msgid "of Aza" 6303 msgctxt "Jalali month 9 - KLocale::ShortName Possessive" 6304 msgid "of Aza" 6305 msgstr "of Aza" 6306 6307 #: kdecore/kcalendarsystemjalali.cpp:221 6308 #, fuzzy, kde-format 6309 #| msgctxt "of Dei short" 6310 #| msgid "of Dei" 6311 msgctxt "Jalali month 10 - KLocale::ShortName Possessive" 6312 msgid "of Dei" 6313 msgstr "of Dei" 6314 6315 #: kdecore/kcalendarsystemjalali.cpp:223 6316 #, fuzzy, kde-format 6317 #| msgctxt "of Bahman short" 6318 #| msgid "of Bah" 6319 msgctxt "Jalali month 11 - KLocale::ShortName Possessive" 6320 msgid "of Bah" 6321 msgstr "of Bah" 6322 6323 #: kdecore/kcalendarsystemjalali.cpp:225 6324 #, fuzzy, kde-format 6325 #| msgctxt "of Esfand short" 6326 #| msgid "of Esf" 6327 msgctxt "Jalali month 12 - KLocale::ShortName Possessive" 6328 msgid "of Esf" 6329 msgstr "of Esf" 6330 6331 #: kdecore/kcalendarsystemjalali.cpp:234 6332 #, fuzzy, kde-format 6333 #| msgctxt "Farvardin short" 6334 #| msgid "Far" 6335 msgctxt "Jalali month 1 - KLocale::ShortName" 6336 msgid "Far" 6337 msgstr "Far" 6338 6339 #: kdecore/kcalendarsystemjalali.cpp:236 6340 #, fuzzy, kde-format 6341 #| msgctxt "Ordibehesht short" 6342 #| msgid "Ord" 6343 msgctxt "Jalali month 2 - KLocale::ShortName" 6344 msgid "Ord" 6345 msgstr "Ord" 6346 6347 #: kdecore/kcalendarsystemjalali.cpp:238 6348 #, fuzzy, kde-format 6349 #| msgctxt "Khordad short" 6350 #| msgid "Kho" 6351 msgctxt "Jalali month 3 - KLocale::ShortName" 6352 msgid "Kho" 6353 msgstr "Kho" 6354 6355 #: kdecore/kcalendarsystemjalali.cpp:240 6356 #, fuzzy, kde-format 6357 #| msgctxt "Tir short" 6358 #| msgid "Tir" 6359 msgctxt "Jalali month 4 - KLocale::ShortName" 6360 msgid "Tir" 6361 msgstr "Tir" 6362 6363 #: kdecore/kcalendarsystemjalali.cpp:242 6364 #, fuzzy, kde-format 6365 #| msgctxt "Mordad short" 6366 #| msgid "Mor" 6367 msgctxt "Jalali month 5 - KLocale::ShortName" 6368 msgid "Mor" 6369 msgstr "Mor" 6370 6371 #: kdecore/kcalendarsystemjalali.cpp:244 6372 #, fuzzy, kde-format 6373 #| msgctxt "Shahrivar short" 6374 #| msgid "Sha" 6375 msgctxt "Jalali month 6 - KLocale::ShortName" 6376 msgid "Sha" 6377 msgstr "Sha" 6378 6379 #: kdecore/kcalendarsystemjalali.cpp:246 6380 #, fuzzy, kde-format 6381 #| msgctxt "Mehr short" 6382 #| msgid "Meh" 6383 msgctxt "Jalali month 7 - KLocale::ShortName" 6384 msgid "Meh" 6385 msgstr "Meh" 6386 6387 #: kdecore/kcalendarsystemjalali.cpp:248 6388 #, fuzzy, kde-format 6389 #| msgctxt "Aban short" 6390 #| msgid "Aba" 6391 msgctxt "Jalali month 8 - KLocale::ShortName" 6392 msgid "Aba" 6393 msgstr "Aba" 6394 6395 #: kdecore/kcalendarsystemjalali.cpp:250 6396 #, fuzzy, kde-format 6397 #| msgctxt "Azar short" 6398 #| msgid "Aza" 6399 msgctxt "Jalali month 9 - KLocale::ShortName" 6400 msgid "Aza" 6401 msgstr "Aza" 6402 6403 #: kdecore/kcalendarsystemjalali.cpp:252 6404 #, fuzzy, kde-format 6405 #| msgctxt "Dei short" 6406 #| msgid "Dei" 6407 msgctxt "Jalali month 10 - KLocale::ShortName" 6408 msgid "Dei" 6409 msgstr "Dei" 6410 6411 #: kdecore/kcalendarsystemjalali.cpp:254 6412 #, fuzzy, kde-format 6413 #| msgctxt "Bahman short" 6414 #| msgid "Bah" 6415 msgctxt "Jalali month 11 - KLocale::ShortName" 6416 msgid "Bah" 6417 msgstr "Bah" 6418 6419 #: kdecore/kcalendarsystemjalali.cpp:256 6420 #, fuzzy, kde-format 6421 #| msgctxt "Esfand" 6422 #| msgid "Esf" 6423 msgctxt "Jalali month 12 - KLocale::ShortName" 6424 msgid "Esf" 6425 msgstr "Esf" 6426 6427 #: kdecore/kcalendarsystemjalali.cpp:265 6428 #, fuzzy, kde-format 6429 #| msgid "of Farvardin" 6430 msgctxt "Jalali month 1 - KLocale::LongName Possessive" 6431 msgid "of Farvardin" 6432 msgstr "of Farvardin" 6433 6434 #: kdecore/kcalendarsystemjalali.cpp:267 6435 #, fuzzy, kde-format 6436 #| msgid "of Ordibehesht" 6437 msgctxt "Jalali month 2 - KLocale::LongName Possessive" 6438 msgid "of Ordibehesht" 6439 msgstr "of Ordibehesht" 6440 6441 #: kdecore/kcalendarsystemjalali.cpp:269 6442 #, fuzzy, kde-format 6443 #| msgid "of Khordad" 6444 msgctxt "Jalali month 3 - KLocale::LongName Possessive" 6445 msgid "of Khordad" 6446 msgstr "of Khordad" 6447 6448 #: kdecore/kcalendarsystemjalali.cpp:271 6449 #, fuzzy, kde-format 6450 #| msgctxt "of Tir short" 6451 #| msgid "of Tir" 6452 msgctxt "Jalali month 4 - KLocale::LongName Possessive" 6453 msgid "of Tir" 6454 msgstr "of Tir" 6455 6456 #: kdecore/kcalendarsystemjalali.cpp:273 6457 #, fuzzy, kde-format 6458 #| msgid "of Mordad" 6459 msgctxt "Jalali month 5 - KLocale::LongName Possessive" 6460 msgid "of Mordad" 6461 msgstr "of Mordad" 6462 6463 #: kdecore/kcalendarsystemjalali.cpp:275 6464 #, fuzzy, kde-format 6465 #| msgid "of Shahrivar" 6466 msgctxt "Jalali month 6 - KLocale::LongName Possessive" 6467 msgid "of Shahrivar" 6468 msgstr "of Shahrivar" 6469 6470 #: kdecore/kcalendarsystemjalali.cpp:277 6471 #, fuzzy, kde-format 6472 #| msgid "of Mehr" 6473 msgctxt "Jalali month 7 - KLocale::LongName Possessive" 6474 msgid "of Mehr" 6475 msgstr "of Mehr" 6476 6477 #: kdecore/kcalendarsystemjalali.cpp:279 6478 #, fuzzy, kde-format 6479 #| msgid "of Aban" 6480 msgctxt "Jalali month 8 - KLocale::LongName Possessive" 6481 msgid "of Aban" 6482 msgstr "of Aban" 6483 6484 #: kdecore/kcalendarsystemjalali.cpp:281 6485 #, fuzzy, kde-format 6486 #| msgid "of Azar" 6487 msgctxt "Jalali month 9 - KLocale::LongName Possessive" 6488 msgid "of Azar" 6489 msgstr "of Azar" 6490 6491 #: kdecore/kcalendarsystemjalali.cpp:283 6492 #, fuzzy, kde-format 6493 #| msgctxt "of Dei short" 6494 #| msgid "of Dei" 6495 msgctxt "Jalali month 10 - KLocale::LongName Possessive" 6496 msgid "of Dei" 6497 msgstr "of Dei" 6498 6499 #: kdecore/kcalendarsystemjalali.cpp:285 6500 #, fuzzy, kde-format 6501 #| msgid "of Bahman" 6502 msgctxt "Jalali month 11 - KLocale::LongName Possessive" 6503 msgid "of Bahman" 6504 msgstr "of Bahman" 6505 6506 #: kdecore/kcalendarsystemjalali.cpp:287 6507 #, fuzzy, kde-format 6508 #| msgid "of Esfand" 6509 msgctxt "Jalali month 12 - KLocale::LongName Possessive" 6510 msgid "of Esfand" 6511 msgstr "of Esfand" 6512 6513 #: kdecore/kcalendarsystemjalali.cpp:296 6514 #, fuzzy, kde-format 6515 #| msgid "Farvardin" 6516 msgctxt "Jalali month 1 - KLocale::LongName" 6517 msgid "Farvardin" 6518 msgstr "ফারভারডিন" 6519 6520 #: kdecore/kcalendarsystemjalali.cpp:298 6521 #, fuzzy, kde-format 6522 #| msgid "Ordibehesht" 6523 msgctxt "Jalali month 2 - KLocale::LongName" 6524 msgid "Ordibehesht" 6525 msgstr "অর্দিবেহেশত্" 6526 6527 #: kdecore/kcalendarsystemjalali.cpp:300 6528 #, fuzzy, kde-format 6529 #| msgid "Khordad" 6530 msgctxt "Jalali month 3 - KLocale::LongName" 6531 msgid "Khordad" 6532 msgstr "খোরদাদ" 6533 6534 #: kdecore/kcalendarsystemjalali.cpp:302 6535 #, fuzzy, kde-format 6536 #| msgctxt "Tir short" 6537 #| msgid "Tir" 6538 msgctxt "Jalali month 4 - KLocale::LongName" 6539 msgid "Tir" 6540 msgstr "Tir" 6541 6542 #: kdecore/kcalendarsystemjalali.cpp:304 6543 #, fuzzy, kde-format 6544 #| msgid "Mordad" 6545 msgctxt "Jalali month 5 - KLocale::LongName" 6546 msgid "Mordad" 6547 msgstr "মোরদাদ" 6548 6549 #: kdecore/kcalendarsystemjalali.cpp:306 6550 #, fuzzy, kde-format 6551 #| msgid "Shahrivar" 6552 msgctxt "Jalali month 6 - KLocale::LongName" 6553 msgid "Shahrivar" 6554 msgstr "শাহরিভার" 6555 6556 #: kdecore/kcalendarsystemjalali.cpp:308 6557 #, fuzzy, kde-format 6558 #| msgid "Mehr" 6559 msgctxt "Jalali month 7 - KLocale::LongName" 6560 msgid "Mehr" 6561 msgstr "মেহর" 6562 6563 #: kdecore/kcalendarsystemjalali.cpp:310 6564 #, fuzzy, kde-format 6565 #| msgid "Aban" 6566 msgctxt "Jalali month 8 - KLocale::LongName" 6567 msgid "Aban" 6568 msgstr "আবান" 6569 6570 #: kdecore/kcalendarsystemjalali.cpp:312 6571 #, fuzzy, kde-format 6572 #| msgid "Azar" 6573 msgctxt "Jalali month 9 - KLocale::LongName" 6574 msgid "Azar" 6575 msgstr "আজার" 6576 6577 #: kdecore/kcalendarsystemjalali.cpp:314 6578 #, fuzzy, kde-format 6579 #| msgctxt "Dei short" 6580 #| msgid "Dei" 6581 msgctxt "Jalali month 10 - KLocale::LongName" 6582 msgid "Dei" 6583 msgstr "Dei" 6584 6585 #: kdecore/kcalendarsystemjalali.cpp:316 6586 #, fuzzy, kde-format 6587 #| msgid "Bahman" 6588 msgctxt "Jalali month 11 - KLocale::LongName" 6589 msgid "Bahman" 6590 msgstr "বাহমান" 6591 6592 #: kdecore/kcalendarsystemjalali.cpp:318 6593 #, fuzzy, kde-format 6594 #| msgid "Esfand" 6595 msgctxt "Jalali month 12 - KLocale::LongName" 6596 msgid "Esfand" 6597 msgstr "এসফান্ড" 6598 6599 #: kdecore/kcalendarsystemjalali.cpp:331 6600 #, kde-format 6601 msgctxt "Jalali weekday 1 - KLocale::NarrowName " 6602 msgid "2" 6603 msgstr "" 6604 6605 #: kdecore/kcalendarsystemjalali.cpp:333 6606 #, kde-format 6607 msgctxt "Jalali weekday 2 - KLocale::NarrowName " 6608 msgid "3" 6609 msgstr "" 6610 6611 #: kdecore/kcalendarsystemjalali.cpp:335 6612 #, kde-format 6613 msgctxt "Jalali weekday 3 - KLocale::NarrowName " 6614 msgid "4" 6615 msgstr "" 6616 6617 #: kdecore/kcalendarsystemjalali.cpp:337 6618 #, kde-format 6619 msgctxt "Jalali weekday 4 - KLocale::NarrowName " 6620 msgid "5" 6621 msgstr "" 6622 6623 #: kdecore/kcalendarsystemjalali.cpp:339 6624 #, kde-format 6625 msgctxt "Jalali weekday 5 - KLocale::NarrowName " 6626 msgid "J" 6627 msgstr "" 6628 6629 #: kdecore/kcalendarsystemjalali.cpp:341 6630 #, kde-format 6631 msgctxt "Jalali weekday 6 - KLocale::NarrowName " 6632 msgid "S" 6633 msgstr "" 6634 6635 #: kdecore/kcalendarsystemjalali.cpp:343 6636 #, kde-format 6637 msgctxt "Jalali weekday 7 - KLocale::NarrowName " 6638 msgid "1" 6639 msgstr "" 6640 6641 #: kdecore/kcalendarsystemjalali.cpp:352 6642 #, fuzzy, kde-format 6643 #| msgctxt "Do shanbe short" 6644 #| msgid "2sh" 6645 msgctxt "Jalali weekday 1 - KLocale::ShortName" 6646 msgid "2sh" 6647 msgstr "2sh" 6648 6649 #: kdecore/kcalendarsystemjalali.cpp:354 6650 #, fuzzy, kde-format 6651 #| msgctxt "Se shanbe short" 6652 #| msgid "3sh" 6653 msgctxt "Jalali weekday 2 - KLocale::ShortName" 6654 msgid "3sh" 6655 msgstr "3sh" 6656 6657 #: kdecore/kcalendarsystemjalali.cpp:356 6658 #, fuzzy, kde-format 6659 #| msgctxt "Chahar shanbe short" 6660 #| msgid "4sh" 6661 msgctxt "Jalali weekday 3 - KLocale::ShortName" 6662 msgid "4sh" 6663 msgstr "4sh" 6664 6665 #: kdecore/kcalendarsystemjalali.cpp:358 6666 #, fuzzy, kde-format 6667 #| msgctxt "Panj shanbe short" 6668 #| msgid "5sh" 6669 msgctxt "Jalali weekday 4 - KLocale::ShortName" 6670 msgid "5sh" 6671 msgstr "5sh" 6672 6673 #: kdecore/kcalendarsystemjalali.cpp:360 6674 #, fuzzy, kde-format 6675 #| msgctxt "Jumee short" 6676 #| msgid "Jom" 6677 msgctxt "Jalali weekday 5 - KLocale::ShortName" 6678 msgid "Jom" 6679 msgstr "Jom" 6680 6681 #: kdecore/kcalendarsystemjalali.cpp:362 6682 #, fuzzy, kde-format 6683 #| msgid "Shanbe" 6684 msgctxt "Jalali weekday 6 - KLocale::ShortName" 6685 msgid "Shn" 6686 msgstr "শানবে" 6687 6688 #: kdecore/kcalendarsystemjalali.cpp:364 6689 #, fuzzy, kde-format 6690 #| msgctxt "Yek-shanbe short" 6691 #| msgid "1sh" 6692 msgctxt "Jalali weekday 7 - KLocale::ShortName" 6693 msgid "1sh" 6694 msgstr "1sh" 6695 6696 #: kdecore/kcalendarsystemjalali.cpp:371 6697 #, fuzzy, kde-format 6698 #| msgid "Do shanbe" 6699 msgctxt "Jalali weekday 1 - KLocale::LongName" 6700 msgid "Do shanbe" 6701 msgstr "দো শানবে" 6702 6703 #: kdecore/kcalendarsystemjalali.cpp:373 6704 #, fuzzy, kde-format 6705 #| msgid "Se shanbe" 6706 msgctxt "Jalali weekday 2 - KLocale::LongName" 6707 msgid "Se shanbe" 6708 msgstr "সে শানবে" 6709 6710 #: kdecore/kcalendarsystemjalali.cpp:375 6711 #, fuzzy, kde-format 6712 #| msgid "Chahar shanbe" 6713 msgctxt "Jalali weekday 3 - KLocale::LongName" 6714 msgid "Chahar shanbe" 6715 msgstr "চাহার শানবে" 6716 6717 #: kdecore/kcalendarsystemjalali.cpp:377 6718 #, fuzzy, kde-format 6719 #| msgid "Panj shanbe" 6720 msgctxt "Jalali weekday 4 - KLocale::LongName" 6721 msgid "Panj shanbe" 6722 msgstr "পাঞ্জ শানবে" 6723 6724 #: kdecore/kcalendarsystemjalali.cpp:379 6725 #, fuzzy, kde-format 6726 #| msgid "Jumee" 6727 msgctxt "Jalali weekday 5 - KLocale::LongName" 6728 msgid "Jumee" 6729 msgstr "জুমি" 6730 6731 #: kdecore/kcalendarsystemjalali.cpp:381 6732 #, fuzzy, kde-format 6733 #| msgid "Shanbe" 6734 msgctxt "Jalali weekday 6 - KLocale::LongName" 6735 msgid "Shanbe" 6736 msgstr "শানবে" 6737 6738 #: kdecore/kcalendarsystemjalali.cpp:383 6739 #, fuzzy, kde-format 6740 #| msgid "Yek-shanbe" 6741 msgctxt "Jalali weekday 7 - KLocale::LongName" 6742 msgid "Yek-shanbe" 6743 msgstr "ইয়েক-শানবে" 6744 6745 #: kdecore/kcalendarsystemjapanese.cpp:62 6746 #, kde-format 6747 msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" 6748 msgid "Meiji" 6749 msgstr "" 6750 6751 #: kdecore/kcalendarsystemjapanese.cpp:64 6752 #, kde-format 6753 msgctxt "" 6754 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 6755 "e.g. Meiji 1" 6756 msgid "%EC Gannen" 6757 msgstr "" 6758 6759 #: kdecore/kcalendarsystemjapanese.cpp:66 6760 #, kde-format 6761 msgctxt "" 6762 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 6763 "e.g. Meiji 22" 6764 msgid "%EC %Ey" 6765 msgstr "" 6766 6767 #: kdecore/kcalendarsystemjapanese.cpp:69 6768 #, kde-format 6769 msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" 6770 msgid "Taishō" 6771 msgstr "" 6772 6773 #: kdecore/kcalendarsystemjapanese.cpp:71 6774 #, kde-format 6775 msgctxt "" 6776 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " 6777 "1, e.g. Taishō 1" 6778 msgid "%EC Gannen" 6779 msgstr "" 6780 6781 #: kdecore/kcalendarsystemjapanese.cpp:73 6782 #, kde-format 6783 msgctxt "" 6784 "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " 6785 "1, e.g. Taishō 22" 6786 msgid "%EC %Ey" 6787 msgstr "" 6788 6789 #: kdecore/kcalendarsystemjapanese.cpp:76 6790 #, fuzzy, kde-format 6791 #| msgctxt "Shahrivar short" 6792 #| msgid "Sha" 6793 msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" 6794 msgid "Shōwa" 6795 msgstr "Sha" 6796 6797 #: kdecore/kcalendarsystemjapanese.cpp:78 6798 #, kde-format 6799 msgctxt "" 6800 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " 6801 "e.g. Shōwa 1" 6802 msgid "%EC Gannen" 6803 msgstr "" 6804 6805 #: kdecore/kcalendarsystemjapanese.cpp:80 6806 #, kde-format 6807 msgctxt "" 6808 "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " 6809 "e.g. Shōwa 22" 6810 msgid "%EC %Ey" 6811 msgstr "" 6812 6813 #: kdecore/kcalendarsystemjapanese.cpp:83 6814 #, kde-format 6815 msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" 6816 msgid "Heisei" 6817 msgstr "" 6818 6819 #: kdecore/kcalendarsystemjapanese.cpp:85 6820 #, kde-format 6821 msgctxt "" 6822 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " 6823 "1, e.g. Heisei 1" 6824 msgid "%EC Gannen" 6825 msgstr "" 6826 6827 #: kdecore/kcalendarsystemjapanese.cpp:87 6828 #, kde-format 6829 msgctxt "" 6830 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " 6831 "1, e.g. Heisei 22" 6832 msgid "%EC %Ey" 6833 msgstr "" 6834 6835 #: kdecore/kcalendarsystemjapanese.cpp:164 6836 #, fuzzy, kde-format 6837 msgctxt "Japanese year 1 of era" 6838 msgid "Gannen" 6839 msgstr "সবুজ:" 6840 6841 #: kdecore/kcalendarsystemjulian.cpp:73 6842 #, kde-format 6843 msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" 6844 msgid "Before Common Era" 6845 msgstr "" 6846 6847 #: kdecore/kcalendarsystemjulian.cpp:74 6848 #, kde-format 6849 msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" 6850 msgid "BCE" 6851 msgstr "" 6852 6853 #: kdecore/kcalendarsystemjulian.cpp:76 6854 #, kde-format 6855 msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" 6856 msgid "Before Christ" 6857 msgstr "" 6858 6859 #: kdecore/kcalendarsystemjulian.cpp:77 6860 #, kde-format 6861 msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" 6862 msgid "BC" 6863 msgstr "" 6864 6865 #: kdecore/kcalendarsystemjulian.cpp:79 6866 #, kde-format 6867 msgctxt "" 6868 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 6869 msgid "%Ey %EC" 6870 msgstr "" 6871 6872 #: kdecore/kcalendarsystemjulian.cpp:83 6873 #, kde-format 6874 msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" 6875 msgid "Common Era" 6876 msgstr "" 6877 6878 #: kdecore/kcalendarsystemjulian.cpp:84 6879 #, kde-format 6880 msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" 6881 msgid "CE" 6882 msgstr "" 6883 6884 #: kdecore/kcalendarsystemjulian.cpp:86 6885 #, kde-format 6886 msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" 6887 msgid "Anno Domini" 6888 msgstr "" 6889 6890 #: kdecore/kcalendarsystemjulian.cpp:87 6891 #, kde-format 6892 msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" 6893 msgid "AD" 6894 msgstr "" 6895 6896 #: kdecore/kcalendarsystemjulian.cpp:89 6897 #, kde-format 6898 msgctxt "" 6899 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 6900 msgid "%Ey %EC" 6901 msgstr "" 6902 6903 #: kdecore/kcalendarsystemjulian.cpp:172 6904 #, kde-format 6905 msgctxt "Julian month 1 - KLocale::NarrowName" 6906 msgid "J" 6907 msgstr "" 6908 6909 #: kdecore/kcalendarsystemjulian.cpp:174 6910 #, kde-format 6911 msgctxt "Julian month 2 - KLocale::NarrowName" 6912 msgid "F" 6913 msgstr "" 6914 6915 #: kdecore/kcalendarsystemjulian.cpp:176 6916 #, kde-format 6917 msgctxt "Julian month 3 - KLocale::NarrowName" 6918 msgid "M" 6919 msgstr "" 6920 6921 #: kdecore/kcalendarsystemjulian.cpp:178 6922 #, fuzzy, kde-format 6923 #| msgid "Av" 6924 msgctxt "Julian month 4 - KLocale::NarrowName" 6925 msgid "A" 6926 msgstr "আভ" 6927 6928 #: kdecore/kcalendarsystemjulian.cpp:180 6929 #, kde-format 6930 msgctxt "Julian month 5 - KLocale::NarrowName" 6931 msgid "M" 6932 msgstr "" 6933 6934 #: kdecore/kcalendarsystemjulian.cpp:182 6935 #, kde-format 6936 msgctxt "Julian month 6 - KLocale::NarrowName" 6937 msgid "J" 6938 msgstr "" 6939 6940 #: kdecore/kcalendarsystemjulian.cpp:184 6941 #, kde-format 6942 msgctxt "Julian month 7 - KLocale::NarrowName" 6943 msgid "J" 6944 msgstr "" 6945 6946 #: kdecore/kcalendarsystemjulian.cpp:186 6947 #, fuzzy, kde-format 6948 #| msgid "Av" 6949 msgctxt "Julian month 8 - KLocale::NarrowName" 6950 msgid "A" 6951 msgstr "আভ" 6952 6953 #: kdecore/kcalendarsystemjulian.cpp:188 6954 #, kde-format 6955 msgctxt "Julian month 9 - KLocale::NarrowName" 6956 msgid "S" 6957 msgstr "" 6958 6959 #: kdecore/kcalendarsystemjulian.cpp:190 6960 #, kde-format 6961 msgctxt "Julian month 10 - KLocale::NarrowName" 6962 msgid "O" 6963 msgstr "" 6964 6965 #: kdecore/kcalendarsystemjulian.cpp:192 6966 #, kde-format 6967 msgctxt "Julian month 11 - KLocale::NarrowName" 6968 msgid "N" 6969 msgstr "" 6970 6971 #: kdecore/kcalendarsystemjulian.cpp:194 6972 #, kde-format 6973 msgctxt "Julian month 12 - KLocale::NarrowName" 6974 msgid "D" 6975 msgstr "" 6976 6977 #: kdecore/kcalendarsystemjulian.cpp:203 6978 #, fuzzy, kde-format 6979 #| msgctxt "of January" 6980 #| msgid "of Jan" 6981 msgctxt "Julian month 1 - KLocale::ShortName Possessive" 6982 msgid "of Jan" 6983 msgstr "জানুয়ারীর" 6984 6985 #: kdecore/kcalendarsystemjulian.cpp:205 6986 #, fuzzy, kde-format 6987 #| msgctxt "of February" 6988 #| msgid "of Feb" 6989 msgctxt "Julian month 2 - KLocale::ShortName Possessive" 6990 msgid "of Feb" 6991 msgstr "ফেব্রুয়ারীর" 6992 6993 #: kdecore/kcalendarsystemjulian.cpp:207 6994 #, fuzzy, kde-format 6995 #| msgctxt "of March" 6996 #| msgid "of Mar" 6997 msgctxt "Julian month 3 - KLocale::ShortName Possessive" 6998 msgid "of Mar" 6999 msgstr "মার্চের" 7000 7001 #: kdecore/kcalendarsystemjulian.cpp:209 7002 #, fuzzy, kde-format 7003 #| msgctxt "of April" 7004 #| msgid "of Apr" 7005 msgctxt "Julian month 4 - KLocale::ShortName Possessive" 7006 msgid "of Apr" 7007 msgstr "এপ্রিলের" 7008 7009 #: kdecore/kcalendarsystemjulian.cpp:211 7010 #, fuzzy, kde-format 7011 #| msgctxt "of May short" 7012 #| msgid "of May" 7013 msgctxt "Julian month 5 - KLocale::ShortName Possessive" 7014 msgid "of May" 7015 msgstr "মের" 7016 7017 #: kdecore/kcalendarsystemjulian.cpp:213 7018 #, fuzzy, kde-format 7019 #| msgctxt "of June" 7020 #| msgid "of Jun" 7021 msgctxt "Julian month 6 - KLocale::ShortName Possessive" 7022 msgid "of Jun" 7023 msgstr "জুনের" 7024 7025 #: kdecore/kcalendarsystemjulian.cpp:215 7026 #, fuzzy, kde-format 7027 #| msgctxt "of July" 7028 #| msgid "of Jul" 7029 msgctxt "Julian month 7 - KLocale::ShortName Possessive" 7030 msgid "of Jul" 7031 msgstr "জুলাইয়ের" 7032 7033 #: kdecore/kcalendarsystemjulian.cpp:217 7034 #, fuzzy, kde-format 7035 #| msgctxt "of August" 7036 #| msgid "of Aug" 7037 msgctxt "Julian month 8 - KLocale::ShortName Possessive" 7038 msgid "of Aug" 7039 msgstr "আগস্টের" 7040 7041 #: kdecore/kcalendarsystemjulian.cpp:219 7042 #, fuzzy, kde-format 7043 #| msgctxt "of September" 7044 #| msgid "of Sep" 7045 msgctxt "Julian month 9 - KLocale::ShortName Possessive" 7046 msgid "of Sep" 7047 msgstr "সেপ্টেম্বরের" 7048 7049 #: kdecore/kcalendarsystemjulian.cpp:221 7050 #, fuzzy, kde-format 7051 #| msgctxt "of October" 7052 #| msgid "of Oct" 7053 msgctxt "Julian month 10 - KLocale::ShortName Possessive" 7054 msgid "of Oct" 7055 msgstr "অক্টোবরের" 7056 7057 #: kdecore/kcalendarsystemjulian.cpp:223 7058 #, fuzzy, kde-format 7059 #| msgctxt "of November" 7060 #| msgid "of Nov" 7061 msgctxt "Julian month 11 - KLocale::ShortName Possessive" 7062 msgid "of Nov" 7063 msgstr "নভেম্বরের" 7064 7065 #: kdecore/kcalendarsystemjulian.cpp:225 7066 #, fuzzy, kde-format 7067 #| msgctxt "of December" 7068 #| msgid "of Dec" 7069 msgctxt "Julian month 12 - KLocale::ShortName Possessive" 7070 msgid "of Dec" 7071 msgstr "ডিসেম্বরের" 7072 7073 #: kdecore/kcalendarsystemjulian.cpp:234 7074 #, fuzzy, kde-format 7075 #| msgctxt "January" 7076 #| msgid "Jan" 7077 msgctxt "Julian month 1 - KLocale::ShortName" 7078 msgid "Jan" 7079 msgstr "জানুয়ারী" 7080 7081 #: kdecore/kcalendarsystemjulian.cpp:236 7082 #, fuzzy, kde-format 7083 #| msgctxt "February" 7084 #| msgid "Feb" 7085 msgctxt "Julian month 2 - KLocale::ShortName" 7086 msgid "Feb" 7087 msgstr "ফেব্রুয়ারী" 7088 7089 #: kdecore/kcalendarsystemjulian.cpp:238 7090 #, fuzzy, kde-format 7091 #| msgctxt "March" 7092 #| msgid "Mar" 7093 msgctxt "Julian month 3 - KLocale::ShortName" 7094 msgid "Mar" 7095 msgstr "মার্চ" 7096 7097 #: kdecore/kcalendarsystemjulian.cpp:240 7098 #, fuzzy, kde-format 7099 #| msgctxt "April" 7100 #| msgid "Apr" 7101 msgctxt "Julian month 4 - KLocale::ShortName" 7102 msgid "Apr" 7103 msgstr "এপ্রিল" 7104 7105 #: kdecore/kcalendarsystemjulian.cpp:242 7106 #, fuzzy, kde-format 7107 #| msgctxt "May short" 7108 #| msgid "May" 7109 msgctxt "Julian month 5 - KLocale::ShortName" 7110 msgid "May" 7111 msgstr "মে" 7112 7113 #: kdecore/kcalendarsystemjulian.cpp:244 7114 #, fuzzy, kde-format 7115 #| msgctxt "June" 7116 #| msgid "Jun" 7117 msgctxt "Julian month 6 - KLocale::ShortName" 7118 msgid "Jun" 7119 msgstr "জুন" 7120 7121 #: kdecore/kcalendarsystemjulian.cpp:246 7122 #, fuzzy, kde-format 7123 #| msgctxt "July" 7124 #| msgid "Jul" 7125 msgctxt "Julian month 7 - KLocale::ShortName" 7126 msgid "Jul" 7127 msgstr "জুলাই" 7128 7129 #: kdecore/kcalendarsystemjulian.cpp:248 7130 #, fuzzy, kde-format 7131 #| msgctxt "August" 7132 #| msgid "Aug" 7133 msgctxt "Julian month 8 - KLocale::ShortName" 7134 msgid "Aug" 7135 msgstr "আগস্ট" 7136 7137 #: kdecore/kcalendarsystemjulian.cpp:250 7138 #, fuzzy, kde-format 7139 #| msgctxt "September" 7140 #| msgid "Sep" 7141 msgctxt "Julian month 9 - KLocale::ShortName" 7142 msgid "Sep" 7143 msgstr "সেপ্টেম্বর" 7144 7145 #: kdecore/kcalendarsystemjulian.cpp:252 7146 #, fuzzy, kde-format 7147 #| msgctxt "October" 7148 #| msgid "Oct" 7149 msgctxt "Julian month 10 - KLocale::ShortName" 7150 msgid "Oct" 7151 msgstr "অক্টোবর" 7152 7153 #: kdecore/kcalendarsystemjulian.cpp:254 7154 #, fuzzy, kde-format 7155 #| msgctxt "November" 7156 #| msgid "Nov" 7157 msgctxt "Julian month 11 - KLocale::ShortName" 7158 msgid "Nov" 7159 msgstr "নভেম্বর" 7160 7161 #: kdecore/kcalendarsystemjulian.cpp:256 7162 #, fuzzy, kde-format 7163 #| msgctxt "December" 7164 #| msgid "Dec" 7165 msgctxt "Julian month 12 - KLocale::ShortName" 7166 msgid "Dec" 7167 msgstr "ডিসেম্বর" 7168 7169 #: kdecore/kcalendarsystemjulian.cpp:265 7170 #, fuzzy, kde-format 7171 #| msgid "of January" 7172 msgctxt "Julian month 1 - KLocale::LongName Possessive" 7173 msgid "of January" 7174 msgstr "জানুয়ারীর" 7175 7176 #: kdecore/kcalendarsystemjulian.cpp:267 7177 #, fuzzy, kde-format 7178 #| msgid "of February" 7179 msgctxt "Julian month 2 - KLocale::LongName Possessive" 7180 msgid "of February" 7181 msgstr "ফেব্রুয়ারীর" 7182 7183 #: kdecore/kcalendarsystemjulian.cpp:269 7184 #, fuzzy, kde-format 7185 #| msgid "of March" 7186 msgctxt "Julian month 3 - KLocale::LongName Possessive" 7187 msgid "of March" 7188 msgstr "মার্চের" 7189 7190 #: kdecore/kcalendarsystemjulian.cpp:271 7191 #, fuzzy, kde-format 7192 #| msgid "of April" 7193 msgctxt "Julian month 4 - KLocale::LongName Possessive" 7194 msgid "of April" 7195 msgstr "এপ্রিলের" 7196 7197 #: kdecore/kcalendarsystemjulian.cpp:273 7198 #, fuzzy, kde-format 7199 #| msgctxt "of May short" 7200 #| msgid "of May" 7201 msgctxt "Julian month 5 - KLocale::LongName Possessive" 7202 msgid "of May" 7203 msgstr "মের" 7204 7205 #: kdecore/kcalendarsystemjulian.cpp:275 7206 #, fuzzy, kde-format 7207 #| msgid "of June" 7208 msgctxt "Julian month 6 - KLocale::LongName Possessive" 7209 msgid "of June" 7210 msgstr "জুনের" 7211 7212 #: kdecore/kcalendarsystemjulian.cpp:277 7213 #, fuzzy, kde-format 7214 #| msgid "of July" 7215 msgctxt "Julian month 7 - KLocale::LongName Possessive" 7216 msgid "of July" 7217 msgstr "জুলাইয়ের" 7218 7219 #: kdecore/kcalendarsystemjulian.cpp:279 7220 #, fuzzy, kde-format 7221 #| msgid "of August" 7222 msgctxt "Julian month 8 - KLocale::LongName Possessive" 7223 msgid "of August" 7224 msgstr "আগস্টের" 7225 7226 #: kdecore/kcalendarsystemjulian.cpp:281 7227 #, fuzzy, kde-format 7228 #| msgid "of September" 7229 msgctxt "Julian month 9 - KLocale::LongName Possessive" 7230 msgid "of September" 7231 msgstr "সেপ্টেম্বরের" 7232 7233 #: kdecore/kcalendarsystemjulian.cpp:283 7234 #, fuzzy, kde-format 7235 #| msgid "of October" 7236 msgctxt "Julian month 10 - KLocale::LongName Possessive" 7237 msgid "of October" 7238 msgstr "অক্টোবরের" 7239 7240 #: kdecore/kcalendarsystemjulian.cpp:285 7241 #, fuzzy, kde-format 7242 #| msgid "of November" 7243 msgctxt "Julian month 11 - KLocale::LongName Possessive" 7244 msgid "of November" 7245 msgstr "নভেম্বরের" 7246 7247 #: kdecore/kcalendarsystemjulian.cpp:287 7248 #, fuzzy, kde-format 7249 #| msgid "of December" 7250 msgctxt "Julian month 12 - KLocale::LongName Possessive" 7251 msgid "of December" 7252 msgstr "ডিসেম্বরের" 7253 7254 #: kdecore/kcalendarsystemjulian.cpp:296 7255 #, fuzzy, kde-format 7256 #| msgid "January" 7257 msgctxt "Julian month 1 - KLocale::LongName" 7258 msgid "January" 7259 msgstr "জানুয়ারী" 7260 7261 #: kdecore/kcalendarsystemjulian.cpp:298 7262 #, fuzzy, kde-format 7263 #| msgid "February" 7264 msgctxt "Julian month 2 - KLocale::LongName" 7265 msgid "February" 7266 msgstr "ফেব্রুয়ারী" 7267 7268 #: kdecore/kcalendarsystemjulian.cpp:300 7269 #, fuzzy, kde-format 7270 #| msgctxt "March long" 7271 #| msgid "March" 7272 msgctxt "Julian month 3 - KLocale::LongName" 7273 msgid "March" 7274 msgstr "মার্চ" 7275 7276 #: kdecore/kcalendarsystemjulian.cpp:302 7277 #, fuzzy, kde-format 7278 #| msgid "April" 7279 msgctxt "Julian month 4 - KLocale::LongName" 7280 msgid "April" 7281 msgstr "এপ্রিল" 7282 7283 #: kdecore/kcalendarsystemjulian.cpp:304 7284 #, fuzzy, kde-format 7285 #| msgctxt "May short" 7286 #| msgid "May" 7287 msgctxt "Julian month 5 - KLocale::LongName" 7288 msgid "May" 7289 msgstr "মে" 7290 7291 #: kdecore/kcalendarsystemjulian.cpp:306 7292 #, fuzzy, kde-format 7293 #| msgid "June" 7294 msgctxt "Julian month 6 - KLocale::LongName" 7295 msgid "June" 7296 msgstr "জুন" 7297 7298 #: kdecore/kcalendarsystemjulian.cpp:308 7299 #, fuzzy, kde-format 7300 #| msgid "July" 7301 msgctxt "Julian month 7 - KLocale::LongName" 7302 msgid "July" 7303 msgstr "জুলাই" 7304 7305 #: kdecore/kcalendarsystemjulian.cpp:310 7306 #, fuzzy, kde-format 7307 #| msgctxt "August long" 7308 #| msgid "August" 7309 msgctxt "Julian month 8 - KLocale::LongName" 7310 msgid "August" 7311 msgstr "আগস্ট" 7312 7313 #: kdecore/kcalendarsystemjulian.cpp:312 7314 #, fuzzy, kde-format 7315 #| msgid "September" 7316 msgctxt "Julian month 9 - KLocale::LongName" 7317 msgid "September" 7318 msgstr "সেপ্টেম্বর" 7319 7320 #: kdecore/kcalendarsystemjulian.cpp:314 7321 #, fuzzy, kde-format 7322 #| msgid "October" 7323 msgctxt "Julian month 10 - KLocale::LongName" 7324 msgid "October" 7325 msgstr "অক্টোবর" 7326 7327 #: kdecore/kcalendarsystemjulian.cpp:316 7328 #, fuzzy, kde-format 7329 #| msgid "November" 7330 msgctxt "Julian month 11 - KLocale::LongName" 7331 msgid "November" 7332 msgstr "নভেম্বর" 7333 7334 #: kdecore/kcalendarsystemjulian.cpp:318 7335 #, fuzzy, kde-format 7336 #| msgid "December" 7337 msgctxt "Julian month 12 - KLocale::LongName" 7338 msgid "December" 7339 msgstr "ডিসেম্বর" 7340 7341 #: kdecore/kcalendarsystemjulian.cpp:331 7342 #, kde-format 7343 msgctxt "Julian weekday 1 - KLocale::NarrowName " 7344 msgid "M" 7345 msgstr "" 7346 7347 #: kdecore/kcalendarsystemjulian.cpp:333 7348 #, kde-format 7349 msgctxt "Julian weekday 2 - KLocale::NarrowName " 7350 msgid "T" 7351 msgstr "" 7352 7353 #: kdecore/kcalendarsystemjulian.cpp:335 7354 #, kde-format 7355 msgctxt "Julian weekday 3 - KLocale::NarrowName " 7356 msgid "W" 7357 msgstr "" 7358 7359 #: kdecore/kcalendarsystemjulian.cpp:337 7360 #, kde-format 7361 msgctxt "Julian weekday 4 - KLocale::NarrowName " 7362 msgid "T" 7363 msgstr "" 7364 7365 #: kdecore/kcalendarsystemjulian.cpp:339 7366 #, kde-format 7367 msgctxt "Julian weekday 5 - KLocale::NarrowName " 7368 msgid "F" 7369 msgstr "" 7370 7371 #: kdecore/kcalendarsystemjulian.cpp:341 7372 #, kde-format 7373 msgctxt "Julian weekday 6 - KLocale::NarrowName " 7374 msgid "S" 7375 msgstr "" 7376 7377 #: kdecore/kcalendarsystemjulian.cpp:343 7378 #, kde-format 7379 msgctxt "Julian weekday 7 - KLocale::NarrowName " 7380 msgid "S" 7381 msgstr "" 7382 7383 #: kdecore/kcalendarsystemjulian.cpp:352 7384 #, fuzzy, kde-format 7385 #| msgctxt "Monday" 7386 #| msgid "Mon" 7387 msgctxt "Julian weekday 1 - KLocale::ShortName" 7388 msgid "Mon" 7389 msgstr "সোম" 7390 7391 #: kdecore/kcalendarsystemjulian.cpp:354 7392 #, fuzzy, kde-format 7393 #| msgctxt "Tuesday" 7394 #| msgid "Tue" 7395 msgctxt "Julian weekday 2 - KLocale::ShortName" 7396 msgid "Tue" 7397 msgstr "মঙ্গল" 7398 7399 #: kdecore/kcalendarsystemjulian.cpp:356 7400 #, fuzzy, kde-format 7401 #| msgctxt "Wednesday" 7402 #| msgid "Wed" 7403 msgctxt "Julian weekday 3 - KLocale::ShortName" 7404 msgid "Wed" 7405 msgstr "বুধ" 7406 7407 #: kdecore/kcalendarsystemjulian.cpp:358 7408 #, fuzzy, kde-format 7409 #| msgctxt "Thursday" 7410 #| msgid "Thu" 7411 msgctxt "Julian weekday 4 - KLocale::ShortName" 7412 msgid "Thu" 7413 msgstr "বৃহঃ" 7414 7415 #: kdecore/kcalendarsystemjulian.cpp:360 7416 #, fuzzy, kde-format 7417 #| msgctxt "Friday" 7418 #| msgid "Fri" 7419 msgctxt "Julian weekday 5 - KLocale::ShortName" 7420 msgid "Fri" 7421 msgstr "শুক্র" 7422 7423 #: kdecore/kcalendarsystemjulian.cpp:362 7424 #, fuzzy, kde-format 7425 #| msgctxt "Saturday" 7426 #| msgid "Sat" 7427 msgctxt "Julian weekday 6 - KLocale::ShortName" 7428 msgid "Sat" 7429 msgstr "শনি" 7430 7431 #: kdecore/kcalendarsystemjulian.cpp:364 7432 #, fuzzy, kde-format 7433 #| msgctxt "Sunday" 7434 #| msgid "Sun" 7435 msgctxt "Julian weekday 7 - KLocale::ShortName" 7436 msgid "Sun" 7437 msgstr "রবি" 7438 7439 #: kdecore/kcalendarsystemjulian.cpp:371 7440 #, fuzzy, kde-format 7441 #| msgid "Monday" 7442 msgctxt "Julian weekday 1 - KLocale::LongName" 7443 msgid "Monday" 7444 msgstr "সোমবার" 7445 7446 #: kdecore/kcalendarsystemjulian.cpp:373 7447 #, fuzzy, kde-format 7448 #| msgid "Tuesday" 7449 msgctxt "Julian weekday 2 - KLocale::LongName" 7450 msgid "Tuesday" 7451 msgstr "মঙ্গলবার" 7452 7453 #: kdecore/kcalendarsystemjulian.cpp:375 7454 #, fuzzy, kde-format 7455 #| msgid "Wednesday" 7456 msgctxt "Julian weekday 3 - KLocale::LongName" 7457 msgid "Wednesday" 7458 msgstr "বুধবার" 7459 7460 #: kdecore/kcalendarsystemjulian.cpp:377 7461 #, fuzzy, kde-format 7462 #| msgid "Thursday" 7463 msgctxt "Julian weekday 4 - KLocale::LongName" 7464 msgid "Thursday" 7465 msgstr "বৃহস্পতিবার" 7466 7467 #: kdecore/kcalendarsystemjulian.cpp:379 7468 #, fuzzy, kde-format 7469 #| msgid "Friday" 7470 msgctxt "Julian weekday 5 - KLocale::LongName" 7471 msgid "Friday" 7472 msgstr "শুক্রবার" 7473 7474 #: kdecore/kcalendarsystemjulian.cpp:381 7475 #, fuzzy, kde-format 7476 #| msgid "Saturday" 7477 msgctxt "Julian weekday 6 - KLocale::LongName" 7478 msgid "Saturday" 7479 msgstr "শনিবার" 7480 7481 #: kdecore/kcalendarsystemjulian.cpp:383 7482 #, fuzzy, kde-format 7483 #| msgid "Sunday" 7484 msgctxt "Julian weekday 7 - KLocale::LongName" 7485 msgid "Sunday" 7486 msgstr "রবিবার" 7487 7488 #: kdecore/kcalendarsystemminguo.cpp:57 7489 #, kde-format 7490 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" 7491 msgid "Republic of China Era" 7492 msgstr "" 7493 7494 #: kdecore/kcalendarsystemminguo.cpp:58 7495 #, kde-format 7496 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" 7497 msgid "ROC" 7498 msgstr "" 7499 7500 #: kdecore/kcalendarsystemminguo.cpp:59 7501 #, kde-format 7502 msgctxt "" 7503 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 7504 msgid "%EC %Ey" 7505 msgstr "" 7506 7507 #: kdecore/kcalendarsystemthai.cpp:58 7508 #, kde-format 7509 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" 7510 msgid "Buddhist Era" 7511 msgstr "" 7512 7513 #: kdecore/kcalendarsystemthai.cpp:59 7514 #, kde-format 7515 msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" 7516 msgid "BE" 7517 msgstr "" 7518 7519 #: kdecore/kcalendarsystemthai.cpp:60 7520 #, kde-format 7521 msgctxt "" 7522 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 7523 msgid "%Ey %EC" 7524 msgstr "" 7525 7526 #: kdecore/kcmdlineargs.cpp:278 7527 #, kde-format 7528 msgid "Use the X-server display 'displayname'" 7529 msgstr "'displayname' নামক এক্স-সার্ভার ডিস্প্লে ব্যবহার করো" 7530 7531 #: kdecore/kcmdlineargs.cpp:281 7532 #, kde-format 7533 msgid "Restore the application for the given 'sessionId'" 7534 msgstr "প্রদত্ত 'sessionId'-র অ্যাপলিকেশনটি পুনঃস্থাপিত করো" 7535 7536 #: kdecore/kcmdlineargs.cpp:282 7537 #, kde-format 7538 msgid "" 7539 "Causes the application to install a private color\n" 7540 "map on an 8-bit display" 7541 msgstr "" 7542 "এর ফলে অ্যাপলিকেশনটি ৮-বিট ডিসপ্লে-তে একটি প্রাইভেট\n" 7543 "কালার ম্যাপ ইনস্টল করে" 7544 7545 #: kdecore/kcmdlineargs.cpp:283 7546 #, fuzzy, kde-format 7547 msgid "" 7548 "Limits the number of colors allocated in the color\n" 7549 "cube on an 8-bit display, if the application is\n" 7550 "using the QApplication::ManyColor color\n" 7551 "specification" 7552 msgstr "" 7553 "রংএর সীমা সংখ্যা একটি ৮-বিট প্রদর্শন করা রং\n" 7554 "ঘনক্ষেত্রে বরাদ্দ করেছিল, যদি অ্যাপলিকেশন\n" 7555 "QApplication ব্যবহার করছে:: ManyColor রং\n" 7556 "সুনির্দিষ্ট বিবরণ" 7557 7558 #: kdecore/kcmdlineargs.cpp:284 7559 #, kde-format 7560 msgid "tells Qt to never grab the mouse or the keyboard" 7561 msgstr "কিউ-টি (Qt)-কে জানায় কখনো মাউস বা কীবোর্ড 'গ্র্যাব' না করতে" 7562 7563 #: kdecore/kcmdlineargs.cpp:285 7564 #, kde-format 7565 msgid "" 7566 "running under a debugger can cause an implicit\n" 7567 "-nograb, use -dograb to override" 7568 msgstr "" 7569 "ডিবাগার সমেত চালালে হয়ত আলাদা করে\n" 7570 " -dograb করতে হতে পারে" 7571 7572 #: kdecore/kcmdlineargs.cpp:286 7573 #, kde-format 7574 msgid "switches to synchronous mode for debugging" 7575 msgstr "ডিবাগিং-এর জন্য synchronous মোড-এ চলে যায়" 7576 7577 #: kdecore/kcmdlineargs.cpp:288 7578 #, kde-format 7579 msgid "defines the application font" 7580 msgstr "অ্যাপলিকেশনে ব্যবহৃত ফন্ট নির্ধারণ করে" 7581 7582 #: kdecore/kcmdlineargs.cpp:290 7583 #, kde-format 7584 msgid "" 7585 "sets the default background color and an\n" 7586 "application palette (light and dark shades are\n" 7587 "calculated)" 7588 msgstr "" 7589 "পটভূমির ডিফল্ট রং এবং একটি অ্যাপলিকেশন\n" 7590 "প্যালেট নির্ধারণ করে (হাল্কা ও গাঢ় শেডগুলি\n" 7591 "গণনা করা হয়)" 7592 7593 #: kdecore/kcmdlineargs.cpp:292 7594 #, kde-format 7595 msgid "sets the default foreground color" 7596 msgstr "পুরোভূমির ডিফল্ট রং নির্ধারণ করে" 7597 7598 #: kdecore/kcmdlineargs.cpp:294 7599 #, kde-format 7600 msgid "sets the default button color" 7601 msgstr "বাটনের ডিফল্ট রং নির্ধারণকরে" 7602 7603 #: kdecore/kcmdlineargs.cpp:295 7604 #, kde-format 7605 msgid "sets the application name" 7606 msgstr "অ্যাপলিকেশন-এর নাম নির্ধারণ করে" 7607 7608 #: kdecore/kcmdlineargs.cpp:296 7609 #, kde-format 7610 msgid "sets the application title (caption)" 7611 msgstr "অ্যাপলিকেশন-এর শিরোনাম (ক্যাপশন) নির্ধারণ করে" 7612 7613 #: kdecore/kcmdlineargs.cpp:297 7614 #, kde-format 7615 msgid "load the testability framework" 7616 msgstr "টেস্টেবিলিটি ফ্রেমওয়ার্ক লোড করো" 7617 7618 #: kdecore/kcmdlineargs.cpp:299 7619 #, kde-format 7620 msgid "" 7621 "forces the application to use a TrueColor visual on\n" 7622 "an 8-bit display" 7623 msgstr "" 7624 "অ্যাপলিকেশনটিকে একটি ৮-বিট ডিসপ্লে-তে ট্রু-কালার\n" 7625 "ভিসুয়াল ব্যবহার করতে বাধ্য করে" 7626 7627 #: kdecore/kcmdlineargs.cpp:300 7628 #, kde-format 7629 msgid "" 7630 "sets XIM (X Input Method) input style. Possible\n" 7631 "values are onthespot, overthespot, offthespot and\n" 7632 "root" 7633 msgstr "" 7634 "XIM (এক্স ইনপুট মেথড) ইনপুট স্টাইল নিরধারণ করে। সম্ভাব্য \n" 7635 "মান হচ্ছে onthespot, overthespot, offthespot এবং\n" 7636 "root" 7637 7638 #: kdecore/kcmdlineargs.cpp:301 7639 #, kde-format 7640 msgid "set XIM server" 7641 msgstr "XIM (এক্স ইনপুট মেথড) সার্ভার নির্ধারণ করো" 7642 7643 #: kdecore/kcmdlineargs.cpp:302 7644 #, kde-format 7645 msgid "disable XIM" 7646 msgstr "XIM (এক্স ইনপুট মেথড) নিষ্ক্রিয় করো" 7647 7648 #: kdecore/kcmdlineargs.cpp:304 7649 #, kde-format 7650 msgid "mirrors the whole layout of widgets" 7651 msgstr "উইজেটসমূহের বিন্যাস উল্টে ফেলে (আয়নায় দেখার মত করে)" 7652 7653 #: kdecore/kcmdlineargs.cpp:305 7654 #, kde-format 7655 msgid "applies the Qt stylesheet to the application widgets" 7656 msgstr "অ্যাপলিকেশন উইজেটে-এ কিউ-টি স্টাইলশীট প্রয়োগ করে" 7657 7658 #: kdecore/kcmdlineargs.cpp:306 7659 #, kde-format 7660 msgid "" 7661 "use a different graphics system instead of the default one, options are " 7662 "raster and opengl (experimental)" 7663 msgstr "" 7664 "ডিফল্ট-এর পরিবর্তে অন্য একটি graphics system ব্যবহার করো; raster অথবা opengl " 7665 "(পরীক্ষামূলক)" 7666 7667 #: kdecore/kcmdlineargs.cpp:307 7668 #, kde-format 7669 msgid "" 7670 "QML JS debugger information. Application must be\n" 7671 "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" 7672 "enabled" 7673 msgstr "" 7674 7675 #: kdecore/kcmdlineargs.cpp:308 7676 #, kde-format 7677 msgid "The windowing system platform (e.g. xcb or wayland)" 7678 msgstr "" 7679 7680 #: kdecore/kcmdlineargs.cpp:310 7681 #, kde-format 7682 msgid "Use 'caption' as name in the titlebar" 7683 msgstr "শিরোনাম হিসেবে 'caption' ব্যবহার করো" 7684 7685 #: kdecore/kcmdlineargs.cpp:311 7686 #, kde-format 7687 msgid "Use 'icon' as the application icon" 7688 msgstr "অ্যাপলিকেশন আইকন হিসেবে 'icon' ব্যবহার করো" 7689 7690 #: kdecore/kcmdlineargs.cpp:312 7691 #, kde-format 7692 msgid "Use alternative configuration file" 7693 msgstr "বিকল্প কনফিগারেশন ফাইল ব্যবহার করো" 7694 7695 #: kdecore/kcmdlineargs.cpp:313 7696 #, kde-format 7697 msgid "Disable crash handler, to get core dumps" 7698 msgstr "কোর ডাম্প পেতে ক্র্যাশ হ্যাণ্ডলার নিষ্ক্রিয় করো" 7699 7700 #: kdecore/kcmdlineargs.cpp:315 7701 #, kde-format 7702 msgid "Waits for a WM_NET compatible windowmanager" 7703 msgstr "WM_NET সমর্থিত উইণ্ডো ম্যানেজারের জন্য অপেক্ষা করে" 7704 7705 #: kdecore/kcmdlineargs.cpp:317 7706 #, kde-format 7707 msgid "sets the application GUI style" 7708 msgstr "অ্যাপলিকেশনের গুই স্টাইল নির্ধারণ করে" 7709 7710 #: kdecore/kcmdlineargs.cpp:318 7711 #, fuzzy, kde-format 7712 msgid "" 7713 "sets the client geometry of the main widget - see man X for the argument " 7714 "format (usually WidthxHeight+XPos+YPos)" 7715 msgstr "" 7716 "প্রধান উইজেটের গ্রাহক জ্যামিতি নিযুক্ত করো- প্রেরিত মান ফরম্যাটের জন্য মানুষ এক্স দেখো" 7717 7718 #: kdecore/kcmdlineargs.cpp:436 7719 #, kde-format 7720 msgid "KDE Application" 7721 msgstr "কে.ডি.ই. অ্যাপলিকেশন" 7722 7723 #: kdecore/kcmdlineargs.cpp:497 7724 #, kde-format 7725 msgid "Qt" 7726 msgstr "কিউ-টি (Qt)" 7727 7728 #: kdecore/kcmdlineargs.cpp:500 7729 #, kde-format 7730 msgid "KDE" 7731 msgstr "কে.ডি.ই." 7732 7733 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 7734 #, fuzzy, kde-format 7735 msgid "Unknown option '%1'." 7736 msgstr "অজ্ঞাত প্রোটোকল '%1'।" 7737 7738 #: kdecore/kcmdlineargs.cpp:841 7739 #, kde-format 7740 msgctxt "@info:shell %1 is cmdoption name" 7741 msgid "'%1' missing." 7742 msgstr "'%1' পাওয়া যাচ্ছে না।" 7743 7744 #: kdecore/kcmdlineargs.cpp:895 7745 #, fuzzy, kde-format 7746 #| msgctxt "" 7747 #| "@info:shell message on appcmd --version; do not translate 'Development " 7748 #| "Platform'%3 application name, other %n version strings" 7749 #| msgid "" 7750 #| "Qt: %1\n" 7751 #| "KDE Development Platform: %2\n" 7752 #| "%3: %4\n" 7753 msgctxt "" 7754 "@info:shell message on appcmd --version; do not translate 'Development " 7755 "Platform'%3 application name, other %n version strings" 7756 msgid "" 7757 "Qt: %1\n" 7758 "KDE Frameworks: %2\n" 7759 "%3: %4\n" 7760 msgstr "" 7761 "কিউ-টি: %1\n" 7762 "কে.ডি.ই. ডেভেলপমেন্ট প্ল্যাটফর্ম: %2\n" 7763 "%3: %4\n" 7764 7765 #: kdecore/kcmdlineargs.cpp:921 7766 #, kde-format 7767 msgctxt "the 2nd argument is a list of name+address, one on each line" 7768 msgid "" 7769 "%1 was written by\n" 7770 "%2" 7771 msgstr "" 7772 "%1 লিখেছেন\n" 7773 "%2" 7774 7775 #: kdecore/kcmdlineargs.cpp:924 7776 #, kde-format 7777 msgid "This application was written by somebody who wants to remain anonymous." 7778 msgstr "" 7779 7780 #: kdecore/kcmdlineargs.cpp:929 7781 #, kde-format 7782 msgid "Please use http://bugs.kde.org to report bugs.\n" 7783 msgstr "" 7784 7785 #: kdecore/kcmdlineargs.cpp:931 7786 #, kde-format 7787 msgid "Please report bugs to %1.\n" 7788 msgstr "" 7789 7790 #: kdecore/kcmdlineargs.cpp:961 7791 #, kde-format 7792 msgid "Unexpected argument '%1'." 7793 msgstr "" 7794 7795 #: kdecore/kcmdlineargs.cpp:1074 7796 #, kde-format 7797 msgid "Use --help to get a list of available command line options." 7798 msgstr "" 7799 7800 #: kdecore/kcmdlineargs.cpp:1096 7801 #, kde-format 7802 msgid "[options] " 7803 msgstr "" 7804 7805 #: kdecore/kcmdlineargs.cpp:1101 7806 #, kde-format 7807 msgid "[%1-options]" 7808 msgstr "" 7809 7810 #: kdecore/kcmdlineargs.cpp:1122 7811 #, kde-format 7812 msgid "Usage: %1 %2\n" 7813 msgstr "" 7814 7815 #: kdecore/kcmdlineargs.cpp:1125 7816 #, kde-format 7817 msgid "" 7818 "\n" 7819 "Generic options:\n" 7820 msgstr "" 7821 7822 #: kdecore/kcmdlineargs.cpp:1127 7823 #, kde-format 7824 msgid "Show help about options" 7825 msgstr "" 7826 7827 #: kdecore/kcmdlineargs.cpp:1133 7828 #, kde-format 7829 msgid "Show %1 specific options" 7830 msgstr "" 7831 7832 #: kdecore/kcmdlineargs.cpp:1140 7833 #, kde-format 7834 msgid "Show all options" 7835 msgstr "" 7836 7837 #: kdecore/kcmdlineargs.cpp:1141 7838 #, kde-format 7839 msgid "Show author information" 7840 msgstr "" 7841 7842 #: kdecore/kcmdlineargs.cpp:1142 7843 #, kde-format 7844 msgid "Show version information" 7845 msgstr "" 7846 7847 #: kdecore/kcmdlineargs.cpp:1143 7848 #, kde-format 7849 msgid "Show license information" 7850 msgstr "" 7851 7852 #: kdecore/kcmdlineargs.cpp:1144 7853 #, kde-format 7854 msgid "End of options" 7855 msgstr "" 7856 7857 #: kdecore/kcmdlineargs.cpp:1164 7858 #, kde-format 7859 msgid "" 7860 "\n" 7861 "%1 options:\n" 7862 msgstr "" 7863 7864 #: kdecore/kcmdlineargs.cpp:1166 7865 #, kde-format 7866 msgid "" 7867 "\n" 7868 "Options:\n" 7869 msgstr "" 7870 7871 #: kdecore/kcmdlineargs.cpp:1219 7872 #, kde-format 7873 msgid "" 7874 "\n" 7875 "Arguments:\n" 7876 msgstr "" 7877 7878 #: kdecore/kcmdlineargs.cpp:1580 7879 #, kde-format 7880 msgid "The files/URLs opened by the application will be deleted after use" 7881 msgstr "অ্যাপলিকেশন যে সব ফাইল/ইউ-আর-এল খুলবে, তা ব্যবহারের পর মুছে ফেলা হবে" 7882 7883 #: kdecore/kcmdlineargs.cpp:1581 7884 #, kde-format 7885 msgid "KDE-tempfile" 7886 msgstr "KDE-tempfile" 7887 7888 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7889 #: kdecore/kdatetime.cpp:2985 7890 #, fuzzy, kde-format 7891 msgid "am" 7892 msgstr "এ.এম." 7893 7894 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 7895 #: kdecore/kdatetime.cpp:2990 7896 #, kde-format 7897 msgid "pm" 7898 msgstr "পি.এম." 7899 7900 #: kdecore/klibloader.cpp:100 7901 #, kde-format 7902 msgid "Library \"%1\" not found" 7903 msgstr "লাইব্রেরী \"%1\" পাওয়া যায়নি" 7904 7905 #: kdecore/klocale_kde.cpp:785 7906 #, kde-format 7907 msgctxt "digit set" 7908 msgid "Arabic-Indic" 7909 msgstr "আরবী-ভারতীয়" 7910 7911 #: kdecore/klocale_kde.cpp:788 7912 #, kde-format 7913 msgctxt "digit set" 7914 msgid "Bengali" 7915 msgstr "বাংলা" 7916 7917 #: kdecore/klocale_kde.cpp:791 7918 #, kde-format 7919 msgctxt "digit set" 7920 msgid "Devanagari" 7921 msgstr "দেবনাগরী" 7922 7923 #: kdecore/klocale_kde.cpp:794 7924 #, kde-format 7925 msgctxt "digit set" 7926 msgid "Eastern Arabic-Indic" 7927 msgstr "পূর্ব আরবী-ভারতীয়" 7928 7929 #: kdecore/klocale_kde.cpp:797 7930 #, kde-format 7931 msgctxt "digit set" 7932 msgid "Gujarati" 7933 msgstr "গুজরাতী" 7934 7935 #: kdecore/klocale_kde.cpp:800 7936 #, kde-format 7937 msgctxt "digit set" 7938 msgid "Gurmukhi" 7939 msgstr "গুরুমুখী" 7940 7941 #: kdecore/klocale_kde.cpp:803 7942 #, kde-format 7943 msgctxt "digit set" 7944 msgid "Kannada" 7945 msgstr "কন্নড়" 7946 7947 #: kdecore/klocale_kde.cpp:806 7948 #, kde-format 7949 msgctxt "digit set" 7950 msgid "Khmer" 7951 msgstr "খমের" 7952 7953 #: kdecore/klocale_kde.cpp:809 7954 #, kde-format 7955 msgctxt "digit set" 7956 msgid "Malayalam" 7957 msgstr "মালায়লম" 7958 7959 #: kdecore/klocale_kde.cpp:812 7960 #, kde-format 7961 msgctxt "digit set" 7962 msgid "Oriya" 7963 msgstr "ওড়িয়া" 7964 7965 #: kdecore/klocale_kde.cpp:815 7966 #, kde-format 7967 msgctxt "digit set" 7968 msgid "Tamil" 7969 msgstr "তামিল" 7970 7971 #: kdecore/klocale_kde.cpp:818 7972 #, kde-format 7973 msgctxt "digit set" 7974 msgid "Telugu" 7975 msgstr "তেলেগু" 7976 7977 #: kdecore/klocale_kde.cpp:821 7978 #, fuzzy, kde-format 7979 #| msgid "R. Thaani" 7980 msgctxt "digit set" 7981 msgid "Thai" 7982 msgstr "রবিউস সানি" 7983 7984 #: kdecore/klocale_kde.cpp:824 7985 #, kde-format 7986 msgctxt "digit set" 7987 msgid "Arabic" 7988 msgstr "আরবী" 7989 7990 #: kdecore/klocale_kde.cpp:829 7991 #, kde-format 7992 msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" 7993 msgid "%1 (%2)" 7994 msgstr "%1 (%2)" 7995 7996 #. i18n: comments below, they are used by the 7997 #. translators. 7998 #. This prefix is shared by all current dialects. 7999 #. i18n: Dumb message, avoid any markup or scripting. 8000 #: kdecore/klocale_kde.cpp:1327 8001 #, kde-format 8002 msgctxt "size in bytes" 8003 msgid "%1 B" 8004 msgstr "%1 বাইট" 8005 8006 #. i18n: Dumb message, avoid any markup or scripting. 8007 #: kdecore/klocale_kde.cpp:1332 8008 #, kde-format 8009 msgctxt "size in 1000 bytes" 8010 msgid "%1 kB" 8011 msgstr "%1 কিলোবাইট" 8012 8013 #. i18n: Dumb message, avoid any markup or scripting. 8014 #: kdecore/klocale_kde.cpp:1334 8015 #, kde-format 8016 msgctxt "size in 10^6 bytes" 8017 msgid "%1 MB" 8018 msgstr "%1 মেগাবাইট" 8019 8020 #. i18n: Dumb message, avoid any markup or scripting. 8021 #: kdecore/klocale_kde.cpp:1336 8022 #, kde-format 8023 msgctxt "size in 10^9 bytes" 8024 msgid "%1 GB" 8025 msgstr "%1 গিগাবাইট" 8026 8027 #. i18n: Dumb message, avoid any markup or scripting. 8028 #: kdecore/klocale_kde.cpp:1338 8029 #, kde-format 8030 msgctxt "size in 10^12 bytes" 8031 msgid "%1 TB" 8032 msgstr "%1 TB" 8033 8034 #. i18n: Dumb message, avoid any markup or scripting. 8035 #: kdecore/klocale_kde.cpp:1340 8036 #, kde-format 8037 msgctxt "size in 10^15 bytes" 8038 msgid "%1 PB" 8039 msgstr "%1 PB" 8040 8041 #. i18n: Dumb message, avoid any markup or scripting. 8042 #: kdecore/klocale_kde.cpp:1342 8043 #, kde-format 8044 msgctxt "size in 10^18 bytes" 8045 msgid "%1 EB" 8046 msgstr "%1 EB" 8047 8048 #. i18n: Dumb message, avoid any markup or scripting. 8049 #: kdecore/klocale_kde.cpp:1344 8050 #, kde-format 8051 msgctxt "size in 10^21 bytes" 8052 msgid "%1 ZB" 8053 msgstr "%1 ZB" 8054 8055 #. i18n: Dumb message, avoid any markup or scripting. 8056 #: kdecore/klocale_kde.cpp:1346 8057 #, kde-format 8058 msgctxt "size in 10^24 bytes" 8059 msgid "%1 YB" 8060 msgstr "%1 YB" 8061 8062 #. i18n: Dumb message, avoid any markup or scripting. 8063 #: kdecore/klocale_kde.cpp:1351 8064 #, kde-format 8065 msgctxt "memory size in 1024 bytes" 8066 msgid "%1 KB" 8067 msgstr "%1 কিলোবাইট" 8068 8069 #. i18n: Dumb message, avoid any markup or scripting. 8070 #: kdecore/klocale_kde.cpp:1353 8071 #, kde-format 8072 msgctxt "memory size in 2^20 bytes" 8073 msgid "%1 MB" 8074 msgstr "%1 মেগাবাইট" 8075 8076 #. i18n: Dumb message, avoid any markup or scripting. 8077 #: kdecore/klocale_kde.cpp:1355 8078 #, kde-format 8079 msgctxt "memory size in 2^30 bytes" 8080 msgid "%1 GB" 8081 msgstr "%1 গিগাবাইট" 8082 8083 #. i18n: Dumb message, avoid any markup or scripting. 8084 #: kdecore/klocale_kde.cpp:1357 8085 #, kde-format 8086 msgctxt "memory size in 2^40 bytes" 8087 msgid "%1 TB" 8088 msgstr "%1 TB" 8089 8090 #. i18n: Dumb message, avoid any markup or scripting. 8091 #: kdecore/klocale_kde.cpp:1359 8092 #, kde-format 8093 msgctxt "memory size in 2^50 bytes" 8094 msgid "%1 PB" 8095 msgstr "%1 PB" 8096 8097 #. i18n: Dumb message, avoid any markup or scripting. 8098 #: kdecore/klocale_kde.cpp:1361 8099 #, kde-format 8100 msgctxt "memory size in 2^60 bytes" 8101 msgid "%1 EB" 8102 msgstr "%1 EB" 8103 8104 #. i18n: Dumb message, avoid any markup or scripting. 8105 #: kdecore/klocale_kde.cpp:1363 8106 #, kde-format 8107 msgctxt "memory size in 2^70 bytes" 8108 msgid "%1 ZB" 8109 msgstr "%1 ZB" 8110 8111 #. i18n: Dumb message, avoid any markup or scripting. 8112 #: kdecore/klocale_kde.cpp:1365 8113 #, kde-format 8114 msgctxt "memory size in 2^80 bytes" 8115 msgid "%1 YB" 8116 msgstr "%1 YB" 8117 8118 #. i18n: Dumb message, avoid any markup or scripting. 8119 #: kdecore/klocale_kde.cpp:1371 8120 #, kde-format 8121 msgctxt "size in 1024 bytes" 8122 msgid "%1 KiB" 8123 msgstr "%1 কিলোবাইট" 8124 8125 #. i18n: Dumb message, avoid any markup or scripting. 8126 #: kdecore/klocale_kde.cpp:1373 8127 #, kde-format 8128 msgctxt "size in 2^20 bytes" 8129 msgid "%1 MiB" 8130 msgstr "%1 মেগাবাইট" 8131 8132 #. i18n: Dumb message, avoid any markup or scripting. 8133 #: kdecore/klocale_kde.cpp:1375 8134 #, kde-format 8135 msgctxt "size in 2^30 bytes" 8136 msgid "%1 GiB" 8137 msgstr "%1 গিগাবাইট" 8138 8139 #. i18n: Dumb message, avoid any markup or scripting. 8140 #: kdecore/klocale_kde.cpp:1377 8141 #, kde-format 8142 msgctxt "size in 2^40 bytes" 8143 msgid "%1 TiB" 8144 msgstr "%1 TiB" 8145 8146 #. i18n: Dumb message, avoid any markup or scripting. 8147 #: kdecore/klocale_kde.cpp:1379 8148 #, kde-format 8149 msgctxt "size in 2^50 bytes" 8150 msgid "%1 PiB" 8151 msgstr "%1 PiB" 8152 8153 #. i18n: Dumb message, avoid any markup or scripting. 8154 #: kdecore/klocale_kde.cpp:1381 8155 #, kde-format 8156 msgctxt "size in 2^60 bytes" 8157 msgid "%1 EiB" 8158 msgstr "%1 EiB" 8159 8160 #. i18n: Dumb message, avoid any markup or scripting. 8161 #: kdecore/klocale_kde.cpp:1383 8162 #, kde-format 8163 msgctxt "size in 2^70 bytes" 8164 msgid "%1 ZiB" 8165 msgstr "%1 ZiB" 8166 8167 #. i18n: Dumb message, avoid any markup or scripting. 8168 #: kdecore/klocale_kde.cpp:1385 8169 #, kde-format 8170 msgctxt "size in 2^80 bytes" 8171 msgid "%1 YiB" 8172 msgstr "%1 YiB" 8173 8174 #: kdecore/klocale_kde.cpp:1472 8175 #, kde-format 8176 msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" 8177 msgid "%1 days" 8178 msgstr "%1 দিন" 8179 8180 #: kdecore/klocale_kde.cpp:1475 8181 #, kde-format 8182 msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" 8183 msgid "%1 hours" 8184 msgstr "%1 ঘন্টা" 8185 8186 #: kdecore/klocale_kde.cpp:1478 8187 #, kde-format 8188 msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" 8189 msgid "%1 minutes" 8190 msgstr "%1 মিনিট" 8191 8192 #: kdecore/klocale_kde.cpp:1481 8193 #, kde-format 8194 msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" 8195 msgid "%1 seconds" 8196 msgstr "%1 সেকণ্ড" 8197 8198 #: kdecore/klocale_kde.cpp:1484 8199 #, kde-format 8200 msgctxt "@item:intext" 8201 msgid "%1 millisecond" 8202 msgid_plural "%1 milliseconds" 8203 msgstr[0] "" 8204 msgstr[1] "" 8205 8206 #: kdecore/klocale_kde.cpp:1491 8207 #, kde-format 8208 msgctxt "@item:intext" 8209 msgid "1 day" 8210 msgid_plural "%1 days" 8211 msgstr[0] "" 8212 msgstr[1] "" 8213 8214 #: kdecore/klocale_kde.cpp:1493 8215 #, kde-format 8216 msgctxt "@item:intext" 8217 msgid "1 hour" 8218 msgid_plural "%1 hours" 8219 msgstr[0] "" 8220 msgstr[1] "" 8221 8222 #: kdecore/klocale_kde.cpp:1495 8223 #, kde-format 8224 msgctxt "@item:intext" 8225 msgid "1 minute" 8226 msgid_plural "%1 minutes" 8227 msgstr[0] "" 8228 msgstr[1] "" 8229 8230 #: kdecore/klocale_kde.cpp:1497 8231 #, kde-format 8232 msgctxt "@item:intext" 8233 msgid "1 second" 8234 msgid_plural "%1 seconds" 8235 msgstr[0] "" 8236 msgstr[1] "" 8237 8238 #: kdecore/klocale_kde.cpp:1521 8239 #, kde-format 8240 msgctxt "" 8241 "@item:intext days and hours. This uses the previous item:intext messages. If " 8242 "this does not fit the grammar of your language please contact the i18n team " 8243 "to solve the problem" 8244 msgid "%1 and %2" 8245 msgstr "%1 এবং %2" 8246 8247 #: kdecore/klocale_kde.cpp:1527 8248 #, kde-format 8249 msgctxt "" 8250 "@item:intext hours and minutes. This uses the previous item:intext messages. " 8251 "If this does not fit the grammar of your language please contact the i18n " 8252 "team to solve the problem" 8253 msgid "%1 and %2" 8254 msgstr "%1 এবং %2" 8255 8256 #: kdecore/klocale_kde.cpp:1534 8257 #, kde-format 8258 msgctxt "" 8259 "@item:intext minutes and seconds. This uses the previous item:intext " 8260 "messages. If this does not fit the grammar of your language please contact " 8261 "the i18n team to solve the problem" 8262 msgid "%1 and %2" 8263 msgstr "%1 এবং %2" 8264 8265 #: kdecore/klocale_kde.cpp:2153 8266 #, kde-format 8267 msgctxt "Before Noon KLocale::LongName" 8268 msgid "Ante Meridiem" 8269 msgstr "পূর্বাহ্ন" 8270 8271 #: kdecore/klocale_kde.cpp:2154 8272 #, fuzzy, kde-format 8273 #| msgid "Av" 8274 msgctxt "Before Noon KLocale::ShortName" 8275 msgid "AM" 8276 msgstr "আভ" 8277 8278 #: kdecore/klocale_kde.cpp:2155 8279 #, fuzzy, kde-format 8280 #| msgid "Av" 8281 msgctxt "Before Noon KLocale::NarrowName" 8282 msgid "A" 8283 msgstr "আভ" 8284 8285 #: kdecore/klocale_kde.cpp:2158 8286 #, kde-format 8287 msgctxt "After Noon KLocale::LongName" 8288 msgid "Post Meridiem" 8289 msgstr "অপরাহ্ন" 8290 8291 #: kdecore/klocale_kde.cpp:2159 8292 #, kde-format 8293 msgctxt "After Noon KLocale::ShortName" 8294 msgid "PM" 8295 msgstr "পি.এম." 8296 8297 #: kdecore/klocale_kde.cpp:2160 8298 #, kde-format 8299 msgctxt "After Noon KLocale::NarrowName" 8300 msgid "P" 8301 msgstr "পি" 8302 8303 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 8304 #, kde-format 8305 msgctxt "concatenation of dates and time" 8306 msgid "%1 %2" 8307 msgstr "%1 %2" 8308 8309 #: kdecore/klocale_kde.cpp:2267 8310 #, kde-format 8311 msgctxt "concatenation of date/time and time zone" 8312 msgid "%1 %2" 8313 msgstr "%1 %2" 8314 8315 #: kdecore/ksavefile.cpp:99 8316 #, kde-format 8317 msgid "No target filename has been given." 8318 msgstr "" 8319 8320 #: kdecore/ksavefile.cpp:106 8321 #, kde-format 8322 msgid "Already opened." 8323 msgstr "" 8324 8325 #: kdecore/ksavefile.cpp:135 8326 #, kde-format 8327 msgid "Insufficient permissions in target directory." 8328 msgstr "" 8329 8330 #: kdecore/ksavefile.cpp:139 8331 #, kde-format 8332 msgid "Unable to open temporary file." 8333 msgstr "" 8334 8335 #: kdecore/ksavefile.cpp:249 8336 #, kde-format 8337 msgid "Synchronization to disk failed" 8338 msgstr "" 8339 8340 #: kdecore/ksavefile.cpp:280 8341 #, kde-format 8342 msgid "Error during rename." 8343 msgstr "" 8344 8345 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 8346 #, kde-format 8347 msgid "Timed out trying to connect to remote host" 8348 msgstr "প্রত্যন্ত হোস্টে সংযোগ করাকালীন টাইম-আউট" 8349 8350 #: kdecore/netsupp.cpp:866 8351 #, kde-format 8352 msgid "address family for nodename not supported" 8353 msgstr "address family for nodename not supported" 8354 8355 #: kdecore/netsupp.cpp:868 8356 #, kde-format 8357 msgid "invalid value for 'ai_flags'" 8358 msgstr "invalid value for 'ai_flags'" 8359 8360 #: kdecore/netsupp.cpp:870 8361 #, kde-format 8362 msgid "'ai_family' not supported" 8363 msgstr "'ai_family' not supported" 8364 8365 #: kdecore/netsupp.cpp:872 8366 #, kde-format 8367 msgid "no address associated with nodename" 8368 msgstr "no address associated with nodename" 8369 8370 #: kdecore/netsupp.cpp:874 8371 #, kde-format 8372 msgid "servname not supported for ai_socktype" 8373 msgstr "servname not supported for ai_socktype" 8374 8375 #: kdecore/netsupp.cpp:875 8376 #, kde-format 8377 msgid "'ai_socktype' not supported" 8378 msgstr "'ai_socktype' not supported" 8379 8380 #: kdecore/netsupp.cpp:876 8381 #, kde-format 8382 msgid "system error" 8383 msgstr "system error" 8384 8385 #: kdecore/qtest_kde.h:85 kdecore/qtest_kde.h:136 8386 #, kde-format 8387 msgid "KDE Test Program" 8388 msgstr "কে.ডি.ই. টেস্ট প্রোগ্রাম" 8389 8390 #: kdecore/TIMEZONES:1 8391 #, kde-format 8392 msgid "Africa/Abidjan" 8393 msgstr "আফ্রিকা/আবিদয়ান" 8394 8395 #: kdecore/TIMEZONES:2 8396 #, kde-format 8397 msgid "Africa/Accra" 8398 msgstr "আফ্রিকা/আকরা" 8399 8400 #: kdecore/TIMEZONES:3 8401 #, kde-format 8402 msgid "Africa/Addis_Ababa" 8403 msgstr "আফ্রিকা/আদিস_আবাবা" 8404 8405 #: kdecore/TIMEZONES:4 8406 #, kde-format 8407 msgid "Africa/Algiers" 8408 msgstr "আফ্রিকা/অ্যালজিয়ার্স" 8409 8410 #: kdecore/TIMEZONES:5 8411 #, fuzzy, kde-format 8412 msgid "Africa/Asmara" 8413 msgstr "আফ্রিকা/আসমেরা" 8414 8415 #: kdecore/TIMEZONES:6 8416 #, kde-format 8417 msgid "Africa/Asmera" 8418 msgstr "আফ্রিকা/আসমেরা" 8419 8420 #: kdecore/TIMEZONES:7 8421 #, kde-format 8422 msgid "Africa/Bamako" 8423 msgstr "আফ্রিকা/বামাকো" 8424 8425 #: kdecore/TIMEZONES:8 8426 #, kde-format 8427 msgid "Africa/Bangui" 8428 msgstr "আফ্রিকা/বানগুই" 8429 8430 #: kdecore/TIMEZONES:9 8431 #, kde-format 8432 msgid "Africa/Banjul" 8433 msgstr "আফ্রিকা/বানজুল" 8434 8435 #: kdecore/TIMEZONES:10 8436 #, kde-format 8437 msgid "Africa/Bissau" 8438 msgstr "আফ্রিকা/বিসাউ" 8439 8440 #: kdecore/TIMEZONES:11 8441 #, kde-format 8442 msgid "Africa/Blantyre" 8443 msgstr "আফ্রিকা/ব্লানটায়ার" 8444 8445 #: kdecore/TIMEZONES:12 8446 #, kde-format 8447 msgid "Africa/Brazzaville" 8448 msgstr "আফ্রিকা/ব্রাজাভিল" 8449 8450 #: kdecore/TIMEZONES:13 8451 #, kde-format 8452 msgid "Africa/Bujumbura" 8453 msgstr "আফ্রিকা/বুজুম্বুরা" 8454 8455 #: kdecore/TIMEZONES:14 8456 #, kde-format 8457 msgid "Africa/Cairo" 8458 msgstr "আফ্রিকা/কায়রো" 8459 8460 #: kdecore/TIMEZONES:15 8461 #, kde-format 8462 msgid "Africa/Casablanca" 8463 msgstr "আফ্রিকা/কাসাব্লাংকা" 8464 8465 #: kdecore/TIMEZONES:16 8466 #, kde-format 8467 msgid "Africa/Ceuta" 8468 msgstr "আফ্রিকা/কেউটা" 8469 8470 #. i18n: comment to the previous timezone 8471 #: kdecore/TIMEZONES:18 8472 #, kde-format 8473 msgid "Ceuta & Melilla" 8474 msgstr "" 8475 8476 #. i18n: comment to the previous timezone 8477 #: kdecore/TIMEZONES:20 8478 #, kde-format 8479 msgid "Ceuta, Melilla" 8480 msgstr "" 8481 8482 #: kdecore/TIMEZONES:21 8483 #, kde-format 8484 msgid "Africa/Conakry" 8485 msgstr "আফ্রিকা/কোনাকরি" 8486 8487 #: kdecore/TIMEZONES:22 8488 #, kde-format 8489 msgid "Africa/Dakar" 8490 msgstr "আফ্রিকা/ডাকার" 8491 8492 #: kdecore/TIMEZONES:23 8493 #, kde-format 8494 msgid "Africa/Dar_es_Salaam" 8495 msgstr "আফ্রিকা/দার_এস_সালাম" 8496 8497 #: kdecore/TIMEZONES:24 8498 #, kde-format 8499 msgid "Africa/Djibouti" 8500 msgstr "আফ্রিকা/জিবোউতি" 8501 8502 #: kdecore/TIMEZONES:25 8503 #, kde-format 8504 msgid "Africa/Douala" 8505 msgstr "আফ্রিকা/ডুয়ালা" 8506 8507 #: kdecore/TIMEZONES:26 8508 #, kde-format 8509 msgid "Africa/El_Aaiun" 8510 msgstr "আফ্রিকা/এল_আইয়ুন" 8511 8512 #: kdecore/TIMEZONES:27 8513 #, kde-format 8514 msgid "Africa/Freetown" 8515 msgstr "আফ্রিকা/ফ্রিটাউন" 8516 8517 #: kdecore/TIMEZONES:28 8518 #, kde-format 8519 msgid "Africa/Gaborone" 8520 msgstr "আফ্রিকা/গাবোরোন" 8521 8522 #: kdecore/TIMEZONES:29 8523 #, kde-format 8524 msgid "Africa/Harare" 8525 msgstr "আফ্রিকা/হারারে" 8526 8527 #: kdecore/TIMEZONES:30 8528 #, kde-format 8529 msgid "Africa/Johannesburg" 8530 msgstr "আফ্রিকা/জোহানেসবার্গ" 8531 8532 #: kdecore/TIMEZONES:31 8533 #, fuzzy, kde-format 8534 #| msgid "Africa/Ceuta" 8535 msgid "Africa/Juba" 8536 msgstr "আফ্রিকা/কেউটা" 8537 8538 #: kdecore/TIMEZONES:32 8539 #, kde-format 8540 msgid "Africa/Kampala" 8541 msgstr "আফ্রিকা/কামপালা" 8542 8543 #: kdecore/TIMEZONES:33 8544 #, kde-format 8545 msgid "Africa/Khartoum" 8546 msgstr "আফ্রিকা/খারতুম" 8547 8548 #: kdecore/TIMEZONES:34 8549 #, kde-format 8550 msgid "Africa/Kigali" 8551 msgstr "আফ্রিকা/কিগালি" 8552 8553 #: kdecore/TIMEZONES:35 8554 #, kde-format 8555 msgid "Africa/Kinshasa" 8556 msgstr "আফ্রিকা/কিনশাসা" 8557 8558 #. i18n: comment to the previous timezone 8559 #: kdecore/TIMEZONES:37 8560 #, kde-format 8561 msgid "west Dem. Rep. of Congo" 8562 msgstr "" 8563 8564 #. i18n: comment to the previous timezone 8565 #: kdecore/TIMEZONES:39 8566 #, kde-format 8567 msgid "Dem. Rep. of Congo (west)" 8568 msgstr "" 8569 8570 #: kdecore/TIMEZONES:40 8571 #, kde-format 8572 msgid "Africa/Lagos" 8573 msgstr "আফ্রিকা/লাগোস" 8574 8575 #: kdecore/TIMEZONES:41 8576 #, kde-format 8577 msgid "Africa/Libreville" 8578 msgstr "আফ্রিকা/লিব্রেভিল" 8579 8580 #: kdecore/TIMEZONES:42 8581 #, kde-format 8582 msgid "Africa/Lome" 8583 msgstr "আফ্রিকা/লোম" 8584 8585 #: kdecore/TIMEZONES:43 8586 #, kde-format 8587 msgid "Africa/Luanda" 8588 msgstr "আফ্রিকা/লুয়াণ্ডা" 8589 8590 #: kdecore/TIMEZONES:44 8591 #, kde-format 8592 msgid "Africa/Lubumbashi" 8593 msgstr "আফ্রিকা/লুবুমবাশি" 8594 8595 #. i18n: comment to the previous timezone 8596 #: kdecore/TIMEZONES:46 8597 #, kde-format 8598 msgid "east Dem. Rep. of Congo" 8599 msgstr "" 8600 8601 #. i18n: comment to the previous timezone 8602 #: kdecore/TIMEZONES:48 8603 #, kde-format 8604 msgid "Dem. Rep. of Congo (east)" 8605 msgstr "" 8606 8607 #: kdecore/TIMEZONES:49 8608 #, kde-format 8609 msgid "Africa/Lusaka" 8610 msgstr "আফ্রিকা/লুসাকা" 8611 8612 #: kdecore/TIMEZONES:50 8613 #, kde-format 8614 msgid "Africa/Malabo" 8615 msgstr "আফ্রিকা/মালাবো" 8616 8617 #: kdecore/TIMEZONES:51 8618 #, kde-format 8619 msgid "Africa/Maputo" 8620 msgstr "আফ্রিকা/মাপুটো" 8621 8622 #: kdecore/TIMEZONES:52 8623 #, kde-format 8624 msgid "Africa/Maseru" 8625 msgstr "আফ্রিকা/মাসেরু" 8626 8627 #: kdecore/TIMEZONES:53 8628 #, kde-format 8629 msgid "Africa/Mbabane" 8630 msgstr "আফ্রিকা/ম্বাবানে" 8631 8632 #: kdecore/TIMEZONES:54 8633 #, kde-format 8634 msgid "Africa/Mogadishu" 8635 msgstr "আফ্রিকা/মোগাডিশু" 8636 8637 #: kdecore/TIMEZONES:55 8638 #, kde-format 8639 msgid "Africa/Monrovia" 8640 msgstr "আফ্রিকা/মনরোভিয়া" 8641 8642 #: kdecore/TIMEZONES:56 8643 #, kde-format 8644 msgid "Africa/Nairobi" 8645 msgstr "আফ্রিকা/নাইরোবি" 8646 8647 #: kdecore/TIMEZONES:57 8648 #, fuzzy, kde-format 8649 msgid "Africa/Ndjamena" 8650 msgstr "আফ্রিকা/" 8651 8652 #: kdecore/TIMEZONES:58 8653 #, kde-format 8654 msgid "Africa/Niamey" 8655 msgstr "আফ্রিকা/নিয়ামে" 8656 8657 #: kdecore/TIMEZONES:59 8658 #, fuzzy, kde-format 8659 msgid "Africa/Nouakchott" 8660 msgstr "আফ্রিকা/" 8661 8662 #: kdecore/TIMEZONES:60 8663 #, kde-format 8664 msgid "Africa/Ouagadougou" 8665 msgstr "আফ্রিকা/উয়াগাডুগু" 8666 8667 #: kdecore/TIMEZONES:61 8668 #, kde-format 8669 msgid "Africa/Porto-Novo" 8670 msgstr "আফ্রিকা/পোর্টো-নোভো" 8671 8672 #: kdecore/TIMEZONES:62 8673 #, fuzzy, kde-format 8674 msgid "Africa/Pretoria" 8675 msgstr "আফ্রিকা/কেউটা" 8676 8677 #: kdecore/TIMEZONES:63 8678 #, kde-format 8679 msgid "Africa/Sao_Tome" 8680 msgstr "আফ্রিকা/সাও_টোমে" 8681 8682 #: kdecore/TIMEZONES:64 8683 #, kde-format 8684 msgid "Africa/Timbuktu" 8685 msgstr "আফ্রিকা/টিমবাকটু" 8686 8687 #: kdecore/TIMEZONES:65 8688 #, kde-format 8689 msgid "Africa/Tripoli" 8690 msgstr "আফ্রিকা/ট্রিপোলি" 8691 8692 #: kdecore/TIMEZONES:66 8693 #, kde-format 8694 msgid "Africa/Tunis" 8695 msgstr "আফ্রিকা/টিউনিস" 8696 8697 #: kdecore/TIMEZONES:67 8698 #, fuzzy, kde-format 8699 msgid "Africa/Windhoek" 8700 msgstr "আফ্রিকা/" 8701 8702 #: kdecore/TIMEZONES:68 8703 #, kde-format 8704 msgid "America/Adak" 8705 msgstr "আমেরিকা/আডাক" 8706 8707 #. i18n: comment to the previous timezone 8708 #: kdecore/TIMEZONES:70 kdecore/TIMEZONES:137 kdecore/TIMEZONES:1410 8709 #, kde-format 8710 msgid "Aleutian Islands" 8711 msgstr "" 8712 8713 #: kdecore/TIMEZONES:71 8714 #, kde-format 8715 msgid "America/Anchorage" 8716 msgstr "আমেরিকা/অ্যাংকোরেজ" 8717 8718 #. i18n: comment to the previous timezone 8719 #: kdecore/TIMEZONES:73 kdecore/TIMEZONES:1407 8720 #, kde-format 8721 msgid "Alaska Time" 8722 msgstr "" 8723 8724 #. i18n: comment to the previous timezone 8725 #: kdecore/TIMEZONES:75 8726 #, kde-format 8727 msgid "Alaska (most areas)" 8728 msgstr "" 8729 8730 #: kdecore/TIMEZONES:76 8731 #, kde-format 8732 msgid "America/Anguilla" 8733 msgstr "আমেরিকা/অ্যাঙ্গুইলা" 8734 8735 #: kdecore/TIMEZONES:77 8736 #, kde-format 8737 msgid "America/Antigua" 8738 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8739 8740 #: kdecore/TIMEZONES:78 8741 #, kde-format 8742 msgid "America/Araguaina" 8743 msgstr "আমেরিকা/আরাগুয়েনা" 8744 8745 #. i18n: comment to the previous timezone 8746 #: kdecore/TIMEZONES:80 8747 #, kde-format 8748 msgid "Tocantins" 8749 msgstr "" 8750 8751 #: kdecore/TIMEZONES:81 8752 #, kde-format 8753 msgid "America/Argentina/Buenos_Aires" 8754 msgstr "আমেরিকা/আর্জেন্টিনা/বুয়েনস_এয়ারেস" 8755 8756 #. i18n: comment to the previous timezone 8757 #: kdecore/TIMEZONES:83 kdecore/TIMEZONES:169 8758 #, kde-format 8759 msgid "Buenos Aires (BA, CF)" 8760 msgstr "" 8761 8762 #: kdecore/TIMEZONES:84 8763 #, kde-format 8764 msgid "America/Argentina/Catamarca" 8765 msgstr "আমেরিকা/আর্জেন্টিনা/কাটামার্কা" 8766 8767 #. i18n: comment to the previous timezone 8768 #: kdecore/TIMEZONES:86 kdecore/TIMEZONES:91 kdecore/TIMEZONES:189 8769 #, kde-format 8770 msgid "Catamarca (CT), Chubut (CH)" 8771 msgstr "" 8772 8773 #. i18n: comment to the previous timezone 8774 #: kdecore/TIMEZONES:88 8775 #, kde-format 8776 msgid "Catamarca (CT); Chubut (CH)" 8777 msgstr "" 8778 8779 #: kdecore/TIMEZONES:89 8780 #, fuzzy, kde-format 8781 msgid "America/Argentina/ComodRivadavia" 8782 msgstr "আমেরিকা/কর্ডোবা" 8783 8784 #: kdecore/TIMEZONES:92 8785 #, kde-format 8786 msgid "America/Argentina/Cordoba" 8787 msgstr "আমেরিকা/আর্জেন্টিনা/কর্ডোবা" 8788 8789 #. i18n: comment to the previous timezone 8790 #: kdecore/TIMEZONES:94 kdecore/TIMEZONES:209 kdecore/TIMEZONES:556 8791 #, kde-format 8792 msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" 8793 msgstr "" 8794 8795 #. i18n: comment to the previous timezone 8796 #: kdecore/TIMEZONES:96 8797 #, kde-format 8798 msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" 8799 msgstr "" 8800 8801 #. i18n: comment to the previous timezone 8802 #: kdecore/TIMEZONES:98 8803 #, kde-format 8804 msgid "Argentina (most areas: CB, CC, CN, ER, FM, MN, SE, SF)" 8805 msgstr "" 8806 8807 #: kdecore/TIMEZONES:99 8808 #, fuzzy, kde-format 8809 msgid "America/Argentina/Jujuy" 8810 msgstr "আমেরিকা/" 8811 8812 #. i18n: comment to the previous timezone 8813 #: kdecore/TIMEZONES:101 kdecore/TIMEZONES:366 8814 #, kde-format 8815 msgid "Jujuy (JY)" 8816 msgstr "" 8817 8818 #: kdecore/TIMEZONES:102 8819 #, fuzzy, kde-format 8820 msgid "America/Argentina/La_Rioja" 8821 msgstr "আমেরিকা/আরাগুয়েনা" 8822 8823 #. i18n: comment to the previous timezone 8824 #: kdecore/TIMEZONES:104 8825 #, kde-format 8826 msgid "La Rioja (LR)" 8827 msgstr "" 8828 8829 #: kdecore/TIMEZONES:105 8830 #, kde-format 8831 msgid "America/Argentina/Mendoza" 8832 msgstr "আমেরিকা/আর্জেন্টিনা/মেণ্ডোজা" 8833 8834 #. i18n: comment to the previous timezone 8835 #: kdecore/TIMEZONES:107 kdecore/TIMEZONES:420 8836 #, kde-format 8837 msgid "Mendoza (MZ)" 8838 msgstr "" 8839 8840 #: kdecore/TIMEZONES:108 8841 #, fuzzy, kde-format 8842 msgid "America/Argentina/Rio_Gallegos" 8843 msgstr "আমেরিকা/ইণ্ডিয়ানা/ম্যারেংগো" 8844 8845 #. i18n: comment to the previous timezone 8846 #: kdecore/TIMEZONES:110 8847 #, kde-format 8848 msgid "Santa Cruz (SC)" 8849 msgstr "" 8850 8851 #: kdecore/TIMEZONES:111 8852 #, fuzzy, kde-format 8853 msgid "America/Argentina/Salta" 8854 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8855 8856 #. i18n: comment to the previous timezone 8857 #: kdecore/TIMEZONES:113 8858 #, kde-format 8859 msgid "(SA, LP, NQ, RN)" 8860 msgstr "" 8861 8862 #. i18n: comment to the previous timezone 8863 #: kdecore/TIMEZONES:115 8864 #, kde-format 8865 msgid "Salta (SA, LP, NQ, RN)" 8866 msgstr "" 8867 8868 #: kdecore/TIMEZONES:116 8869 #, fuzzy, kde-format 8870 msgid "America/Argentina/San_Juan" 8871 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8872 8873 #. i18n: comment to the previous timezone 8874 #: kdecore/TIMEZONES:118 8875 #, kde-format 8876 msgid "San Juan (SJ)" 8877 msgstr "" 8878 8879 #: kdecore/TIMEZONES:119 8880 #, fuzzy, kde-format 8881 msgid "America/Argentina/San_Luis" 8882 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8883 8884 #. i18n: comment to the previous timezone 8885 #: kdecore/TIMEZONES:121 8886 #, kde-format 8887 msgid "San Luis (SL)" 8888 msgstr "" 8889 8890 #: kdecore/TIMEZONES:122 8891 #, fuzzy, kde-format 8892 msgid "America/Argentina/Tucuman" 8893 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8894 8895 #. i18n: comment to the previous timezone 8896 #: kdecore/TIMEZONES:124 8897 #, kde-format 8898 msgid "Tucuman (TM)" 8899 msgstr "" 8900 8901 #: kdecore/TIMEZONES:125 8902 #, fuzzy, kde-format 8903 msgid "America/Argentina/Ushuaia" 8904 msgstr "আমেরিকা/আরাগুয়েনা" 8905 8906 #. i18n: comment to the previous timezone 8907 #: kdecore/TIMEZONES:127 8908 #, kde-format 8909 msgid "Tierra del Fuego (TF)" 8910 msgstr "" 8911 8912 #: kdecore/TIMEZONES:128 8913 #, kde-format 8914 msgid "America/Aruba" 8915 msgstr "আমেরিকা/আরুবা" 8916 8917 #: kdecore/TIMEZONES:129 8918 #, fuzzy, kde-format 8919 msgid "America/Asuncion" 8920 msgstr "আমেরিকা/" 8921 8922 #: kdecore/TIMEZONES:130 8923 #, fuzzy, kde-format 8924 msgid "America/Atikokan" 8925 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8926 8927 #. i18n: comment to the previous timezone 8928 #: kdecore/TIMEZONES:132 kdecore/TIMEZONES:206 8929 #, kde-format 8930 msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" 8931 msgstr "" 8932 8933 #. i18n: comment to the previous timezone 8934 #: kdecore/TIMEZONES:134 8935 #, kde-format 8936 msgid "EST - ON (Atikokan); NU (Coral H)" 8937 msgstr "" 8938 8939 #: kdecore/TIMEZONES:135 8940 #, fuzzy, kde-format 8941 msgid "America/Atka" 8942 msgstr "আমেরিকা/অ্যান্টিগুয়া" 8943 8944 #: kdecore/TIMEZONES:138 8945 #, kde-format 8946 msgid "America/Bahia" 8947 msgstr "আমেরিকা/বাহিয়া" 8948 8949 #. i18n: comment to the previous timezone 8950 #: kdecore/TIMEZONES:140 8951 #, kde-format 8952 msgid "Bahia" 8953 msgstr "" 8954 8955 #: kdecore/TIMEZONES:141 8956 #, fuzzy, kde-format 8957 #| msgid "America/Bahia" 8958 msgid "America/Bahia_Banderas" 8959 msgstr "আমেরিকা/বাহিয়া" 8960 8961 #. i18n: comment to the previous timezone 8962 #: kdecore/TIMEZONES:143 8963 #, kde-format 8964 msgid "Mexican Central Time - Bahia de Banderas" 8965 msgstr "" 8966 8967 #. i18n: comment to the previous timezone 8968 #: kdecore/TIMEZONES:145 8969 #, kde-format 8970 msgid "Central Time - Bahia de Banderas" 8971 msgstr "" 8972 8973 #: kdecore/TIMEZONES:146 8974 #, kde-format 8975 msgid "America/Barbados" 8976 msgstr "আমেরিকা/বার্বাডোস" 8977 8978 #: kdecore/TIMEZONES:147 8979 #, kde-format 8980 msgid "America/Belem" 8981 msgstr "আমেরিকা/বেলেম" 8982 8983 #. i18n: comment to the previous timezone 8984 #: kdecore/TIMEZONES:149 8985 #, kde-format 8986 msgid "Amapa, E Para" 8987 msgstr "" 8988 8989 #. i18n: comment to the previous timezone 8990 #: kdecore/TIMEZONES:151 8991 #, kde-format 8992 msgid "Para (east); Amapa" 8993 msgstr "" 8994 8995 #: kdecore/TIMEZONES:152 8996 #, kde-format 8997 msgid "America/Belize" 8998 msgstr "আমেরিকা/বেলিজ" 8999 9000 #: kdecore/TIMEZONES:153 9001 #, fuzzy, kde-format 9002 msgid "America/Blanc-Sablon" 9003 msgstr "আমেরিকা/ক্যানকুন" 9004 9005 #. i18n: comment to the previous timezone 9006 #: kdecore/TIMEZONES:155 9007 #, kde-format 9008 msgid "Atlantic Standard Time - Quebec - Lower North Shore" 9009 msgstr "" 9010 9011 #. i18n: comment to the previous timezone 9012 #: kdecore/TIMEZONES:157 9013 #, kde-format 9014 msgid "AST - QC (Lower North Shore)" 9015 msgstr "" 9016 9017 #: kdecore/TIMEZONES:158 9018 #, kde-format 9019 msgid "America/Boa_Vista" 9020 msgstr "আমেরিকা/বোয়া_ভিস্তা" 9021 9022 #. i18n: comment to the previous timezone 9023 #: kdecore/TIMEZONES:160 9024 #, kde-format 9025 msgid "Roraima" 9026 msgstr "" 9027 9028 #: kdecore/TIMEZONES:161 9029 #, kde-format 9030 msgid "America/Bogota" 9031 msgstr "আমেরিকা/বোগোটা" 9032 9033 #: kdecore/TIMEZONES:162 9034 #, kde-format 9035 msgid "America/Boise" 9036 msgstr "আমেরিকা/বয়েস" 9037 9038 #. i18n: comment to the previous timezone 9039 #: kdecore/TIMEZONES:164 9040 #, kde-format 9041 msgid "Mountain Time - south Idaho & east Oregon" 9042 msgstr "" 9043 9044 #. i18n: comment to the previous timezone 9045 #: kdecore/TIMEZONES:166 9046 #, kde-format 9047 msgid "Mountain - ID (south); OR (east)" 9048 msgstr "" 9049 9050 #: kdecore/TIMEZONES:167 9051 #, kde-format 9052 msgid "America/Buenos_Aires" 9053 msgstr "আমেরিকা/বুয়েনস_এয়ারেস" 9054 9055 #: kdecore/TIMEZONES:170 9056 #, fuzzy, kde-format 9057 msgid "America/Calgary" 9058 msgstr "আমেরিকা/কেম্যান" 9059 9060 #. i18n: comment to the previous timezone 9061 #: kdecore/TIMEZONES:172 kdecore/TIMEZONES:248 kdecore/TIMEZONES:1114 9062 #, kde-format 9063 msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" 9064 msgstr "" 9065 9066 #: kdecore/TIMEZONES:173 9067 #, kde-format 9068 msgid "America/Cambridge_Bay" 9069 msgstr "আমেরিকা/কেমব্রিজ_বে" 9070 9071 #. i18n: comment to the previous timezone 9072 #: kdecore/TIMEZONES:175 9073 #, kde-format 9074 msgid "Mountain Time - west Nunavut" 9075 msgstr "" 9076 9077 #. i18n: comment to the previous timezone 9078 #: kdecore/TIMEZONES:177 9079 #, kde-format 9080 msgid "Mountain - NU (west)" 9081 msgstr "" 9082 9083 #: kdecore/TIMEZONES:178 9084 #, kde-format 9085 msgid "America/Campo_Grande" 9086 msgstr "আমেরিকা/ক্যাম্পো_গ্রান্ডে" 9087 9088 #. i18n: comment to the previous timezone 9089 #: kdecore/TIMEZONES:180 9090 #, kde-format 9091 msgid "Mato Grosso do Sul" 9092 msgstr "" 9093 9094 #: kdecore/TIMEZONES:181 9095 #, kde-format 9096 msgid "America/Cancun" 9097 msgstr "আমেরিকা/ক্যানকুন" 9098 9099 #. i18n: comment to the previous timezone 9100 #: kdecore/TIMEZONES:183 9101 #, kde-format 9102 msgid "Central Time - Quintana Roo" 9103 msgstr "" 9104 9105 #. i18n: comment to the previous timezone 9106 #: kdecore/TIMEZONES:185 9107 #, kde-format 9108 msgid "Eastern Standard Time - Quintana Roo" 9109 msgstr "" 9110 9111 #: kdecore/TIMEZONES:186 9112 #, kde-format 9113 msgid "America/Caracas" 9114 msgstr "আমেরিকা/কারাকাস" 9115 9116 #: kdecore/TIMEZONES:187 9117 #, kde-format 9118 msgid "America/Catamarca" 9119 msgstr "আমেরিকা/কাটামার্কা" 9120 9121 #: kdecore/TIMEZONES:190 9122 #, kde-format 9123 msgid "America/Cayenne" 9124 msgstr "আমেরিকা/কেয়েন" 9125 9126 #: kdecore/TIMEZONES:191 9127 #, kde-format 9128 msgid "America/Cayman" 9129 msgstr "আমেরিকা/কেম্যান" 9130 9131 #: kdecore/TIMEZONES:192 9132 #, kde-format 9133 msgid "America/Chicago" 9134 msgstr "আমেরিকা/চিকাগো" 9135 9136 #. i18n: comment to the previous timezone 9137 #: kdecore/TIMEZONES:194 kdecore/TIMEZONES:438 kdecore/TIMEZONES:1416 9138 #, kde-format 9139 msgid "Central Time" 9140 msgstr "" 9141 9142 #. i18n: comment to the previous timezone 9143 #: kdecore/TIMEZONES:196 9144 #, kde-format 9145 msgid "Central (most areas)" 9146 msgstr "" 9147 9148 #: kdecore/TIMEZONES:197 9149 #, kde-format 9150 msgid "America/Chihuahua" 9151 msgstr "আমেরিকা/চিহুয়াহা" 9152 9153 #. i18n: comment to the previous timezone 9154 #: kdecore/TIMEZONES:199 9155 #, kde-format 9156 msgid "Mountain Time - Chihuahua" 9157 msgstr "" 9158 9159 #. i18n: comment to the previous timezone 9160 #: kdecore/TIMEZONES:201 9161 #, kde-format 9162 msgid "Mexican Mountain Time - Chihuahua away from US border" 9163 msgstr "" 9164 9165 #. i18n: comment to the previous timezone 9166 #: kdecore/TIMEZONES:203 9167 #, kde-format 9168 msgid "Mountain Time - Chihuahua (most areas)" 9169 msgstr "" 9170 9171 #: kdecore/TIMEZONES:204 9172 #, fuzzy, kde-format 9173 msgid "America/Coral_Harbour" 9174 msgstr "আমেরিকা/কুরাকাও" 9175 9176 #: kdecore/TIMEZONES:207 9177 #, kde-format 9178 msgid "America/Cordoba" 9179 msgstr "আমেরিকা/কর্ডোবা" 9180 9181 #: kdecore/TIMEZONES:210 9182 #, kde-format 9183 msgid "America/Costa_Rica" 9184 msgstr "আমেরিকা/কোস্টা_রিকা" 9185 9186 #: kdecore/TIMEZONES:211 9187 #, fuzzy, kde-format 9188 msgid "America/Creston" 9189 msgstr "আফ্রিকা/ফ্রিটাউন" 9190 9191 #. i18n: comment to the previous timezone 9192 #: kdecore/TIMEZONES:213 9193 #, kde-format 9194 msgid "Mountain Standard Time - Creston, British Columbia" 9195 msgstr "" 9196 9197 #. i18n: comment to the previous timezone 9198 #: kdecore/TIMEZONES:215 9199 #, kde-format 9200 msgid "MST - BC (Creston)" 9201 msgstr "" 9202 9203 #: kdecore/TIMEZONES:216 9204 #, kde-format 9205 msgid "America/Cuiaba" 9206 msgstr "আমেরিকা/কুইয়াবা" 9207 9208 #. i18n: comment to the previous timezone 9209 #: kdecore/TIMEZONES:218 9210 #, kde-format 9211 msgid "Mato Grosso" 9212 msgstr "" 9213 9214 #: kdecore/TIMEZONES:219 9215 #, kde-format 9216 msgid "America/Curacao" 9217 msgstr "আমেরিকা/কুরাকাও" 9218 9219 #: kdecore/TIMEZONES:220 9220 #, kde-format 9221 msgid "America/Danmarkshavn" 9222 msgstr "আমেরিকা/ডানমার্কশওয়ান" 9223 9224 #. i18n: comment to the previous timezone 9225 #: kdecore/TIMEZONES:222 9226 #, kde-format 9227 msgid "east coast, north of Scoresbysund" 9228 msgstr "" 9229 9230 #. i18n: comment to the previous timezone 9231 #: kdecore/TIMEZONES:224 9232 #, kde-format 9233 msgid "National Park (east coast)" 9234 msgstr "" 9235 9236 #: kdecore/TIMEZONES:225 9237 #, kde-format 9238 msgid "America/Dawson" 9239 msgstr "আমেরিকা/ডসন" 9240 9241 #. i18n: comment to the previous timezone 9242 #: kdecore/TIMEZONES:227 9243 #, kde-format 9244 msgid "Pacific Time - north Yukon" 9245 msgstr "" 9246 9247 #. i18n: comment to the previous timezone 9248 #: kdecore/TIMEZONES:229 9249 #, kde-format 9250 msgid "MST - Yukon (west)" 9251 msgstr "" 9252 9253 #: kdecore/TIMEZONES:230 9254 #, kde-format 9255 msgid "America/Dawson_Creek" 9256 msgstr "আমেরিকা/ডসন_ক্রীক" 9257 9258 #. i18n: comment to the previous timezone 9259 #: kdecore/TIMEZONES:232 9260 #, kde-format 9261 msgid "" 9262 "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" 9263 msgstr "" 9264 9265 #. i18n: comment to the previous timezone 9266 #: kdecore/TIMEZONES:234 9267 #, kde-format 9268 msgid "MST - BC (Dawson Cr, Ft St John)" 9269 msgstr "" 9270 9271 #: kdecore/TIMEZONES:235 9272 #, kde-format 9273 msgid "America/Denver" 9274 msgstr "আমেরিকা/ডেনভার" 9275 9276 #. i18n: comment to the previous timezone 9277 #: kdecore/TIMEZONES:237 kdecore/TIMEZONES:1292 kdecore/TIMEZONES:1434 9278 #, kde-format 9279 msgid "Mountain Time" 9280 msgstr "" 9281 9282 #. i18n: comment to the previous timezone 9283 #: kdecore/TIMEZONES:239 9284 #, kde-format 9285 msgid "Mountain (most areas)" 9286 msgstr "" 9287 9288 #: kdecore/TIMEZONES:240 9289 #, kde-format 9290 msgid "America/Detroit" 9291 msgstr "আমেরিকা/ডেট্রয়েট" 9292 9293 #. i18n: comment to the previous timezone 9294 #: kdecore/TIMEZONES:242 kdecore/TIMEZONES:1431 9295 #, kde-format 9296 msgid "Eastern Time - Michigan - most locations" 9297 msgstr "" 9298 9299 #. i18n: comment to the previous timezone 9300 #: kdecore/TIMEZONES:244 9301 #, kde-format 9302 msgid "Eastern - MI (most areas)" 9303 msgstr "" 9304 9305 #: kdecore/TIMEZONES:245 9306 #, kde-format 9307 msgid "America/Dominica" 9308 msgstr "আমেরিকা/ডমিনিকা" 9309 9310 #: kdecore/TIMEZONES:246 9311 #, kde-format 9312 msgid "America/Edmonton" 9313 msgstr "আমেরিকা/এডমন্টন" 9314 9315 #. i18n: comment to the previous timezone 9316 #: kdecore/TIMEZONES:250 9317 #, kde-format 9318 msgid "Mountain - AB; BC (E); SK (W)" 9319 msgstr "" 9320 9321 #: kdecore/TIMEZONES:251 9322 #, fuzzy, kde-format 9323 msgid "America/Eirunepe" 9324 msgstr "আমেরিকা/" 9325 9326 #. i18n: comment to the previous timezone 9327 #: kdecore/TIMEZONES:253 9328 #, kde-format 9329 msgid "W Amazonas" 9330 msgstr "" 9331 9332 #. i18n: comment to the previous timezone 9333 #: kdecore/TIMEZONES:255 9334 #, kde-format 9335 msgid "Amazonas (west)" 9336 msgstr "" 9337 9338 #: kdecore/TIMEZONES:256 9339 #, kde-format 9340 msgid "America/El_Salvador" 9341 msgstr "আমেরিকা/এল_সালভাডোর" 9342 9343 #: kdecore/TIMEZONES:257 9344 #, fuzzy, kde-format 9345 msgid "America/Ensenada" 9346 msgstr "আমেরিকা/গ্রেনাডা" 9347 9348 #. i18n: comment to the previous timezone 9349 #: kdecore/TIMEZONES:259 kdecore/TIMEZONES:390 kdecore/TIMEZONES:620 9350 #: kdecore/TIMEZONES:1277 kdecore/TIMEZONES:1437 9351 #, fuzzy, kde-format 9352 msgid "Pacific Time" 9353 msgstr "প্যাসিফিক/" 9354 9355 #: kdecore/TIMEZONES:260 9356 #, fuzzy, kde-format 9357 #| msgid "America/Porto_Velho" 9358 msgid "America/Fort_Nelson" 9359 msgstr "আমেরিকা/পোর্টো_ভেলহো" 9360 9361 #. i18n: comment to the previous timezone 9362 #: kdecore/TIMEZONES:262 9363 #, kde-format 9364 msgid "MST - BC (Ft Nelson)" 9365 msgstr "" 9366 9367 #: kdecore/TIMEZONES:263 9368 #, fuzzy, kde-format 9369 msgid "America/Fort_Wayne" 9370 msgstr "আমেরিকা/ফোর্টালেসা" 9371 9372 #. i18n: comment to the previous timezone 9373 #: kdecore/TIMEZONES:265 kdecore/TIMEZONES:308 kdecore/TIMEZONES:352 9374 #: kdecore/TIMEZONES:1419 9375 #, kde-format 9376 msgid "Eastern Time - Indiana - most locations" 9377 msgstr "" 9378 9379 #: kdecore/TIMEZONES:266 9380 #, kde-format 9381 msgid "America/Fortaleza" 9382 msgstr "আমেরিকা/ফোর্টালেসা" 9383 9384 #. i18n: comment to the previous timezone 9385 #: kdecore/TIMEZONES:268 9386 #, kde-format 9387 msgid "NE Brazil (MA, PI, CE, RN, PB)" 9388 msgstr "" 9389 9390 #. i18n: comment to the previous timezone 9391 #: kdecore/TIMEZONES:270 9392 #, kde-format 9393 msgid "Brazil (northeast: MA, PI, CE, RN, PB)" 9394 msgstr "" 9395 9396 #: kdecore/TIMEZONES:271 9397 #, fuzzy, kde-format 9398 msgid "America/Fredericton" 9399 msgstr "আফ্রিকা/ফ্রিটাউন" 9400 9401 #. i18n: comment to the previous timezone 9402 #: kdecore/TIMEZONES:273 kdecore/TIMEZONES:299 kdecore/TIMEZONES:1102 9403 #, kde-format 9404 msgid "Atlantic Time - Nova Scotia (most places), PEI" 9405 msgstr "" 9406 9407 #: kdecore/TIMEZONES:274 9408 #, kde-format 9409 msgid "America/Glace_Bay" 9410 msgstr "আমেরিকা/গ্লেস_বে" 9411 9412 #. i18n: comment to the previous timezone 9413 #: kdecore/TIMEZONES:276 9414 #, kde-format 9415 msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" 9416 msgstr "" 9417 9418 #. i18n: comment to the previous timezone 9419 #: kdecore/TIMEZONES:278 9420 #, fuzzy, kde-format 9421 #| msgid "Atlantic/Cape_Verde" 9422 msgid "Atlantic - NS (Cape Breton)" 9423 msgstr "অ্যাটলান্টিক/কেপ_ভার্ডি" 9424 9425 #: kdecore/TIMEZONES:279 9426 #, kde-format 9427 msgid "America/Godthab" 9428 msgstr "আমেরিকা/গোতাব" 9429 9430 #. i18n: comment to the previous timezone 9431 #: kdecore/TIMEZONES:281 kdecore/TIMEZONES:567 kdecore/TIMEZONES:719 9432 #: kdecore/TIMEZONES:953 kdecore/TIMEZONES:958 kdecore/TIMEZONES:1129 9433 #: kdecore/TIMEZONES:1170 kdecore/TIMEZONES:1286 kdecore/TIMEZONES:1299 9434 #: kdecore/TIMEZONES:1350 9435 #, kde-format 9436 msgid "most locations" 9437 msgstr "" 9438 9439 #: kdecore/TIMEZONES:282 9440 #, kde-format 9441 msgid "America/Goose_Bay" 9442 msgstr "আমেরিকা/গুস_বে" 9443 9444 #. i18n: comment to the previous timezone 9445 #: kdecore/TIMEZONES:284 9446 #, kde-format 9447 msgid "Atlantic Time - Labrador - most locations" 9448 msgstr "" 9449 9450 #. i18n: comment to the previous timezone 9451 #: kdecore/TIMEZONES:286 9452 #, kde-format 9453 msgid "Atlantic - Labrador (most areas)" 9454 msgstr "" 9455 9456 #: kdecore/TIMEZONES:287 9457 #, kde-format 9458 msgid "America/Grand_Turk" 9459 msgstr "আমেরিকা/গ্র্যান্ড_টার্ক" 9460 9461 #: kdecore/TIMEZONES:288 9462 #, kde-format 9463 msgid "America/Grenada" 9464 msgstr "আমেরিকা/গ্রেনাডা" 9465 9466 #: kdecore/TIMEZONES:289 9467 #, fuzzy, kde-format 9468 msgid "America/Guadeloupe" 9469 msgstr "আমেরিকা/" 9470 9471 #: kdecore/TIMEZONES:290 9472 #, kde-format 9473 msgid "America/Guatemala" 9474 msgstr "আমেরিকা/গুয়াতেমালা" 9475 9476 #: kdecore/TIMEZONES:291 9477 #, fuzzy, kde-format 9478 msgid "America/Guayaquil" 9479 msgstr "আমেরিকা/" 9480 9481 #. i18n: comment to the previous timezone 9482 #: kdecore/TIMEZONES:293 kdecore/TIMEZONES:1178 kdecore/TIMEZONES:1186 9483 #: kdecore/TIMEZONES:1400 9484 #, kde-format 9485 msgid "mainland" 9486 msgstr "" 9487 9488 #. i18n: comment to the previous timezone 9489 #: kdecore/TIMEZONES:295 9490 #, kde-format 9491 msgid "Ecuador (mainland)" 9492 msgstr "" 9493 9494 #: kdecore/TIMEZONES:296 9495 #, kde-format 9496 msgid "America/Guyana" 9497 msgstr "আমেরিকা/গায়ানা" 9498 9499 #: kdecore/TIMEZONES:297 9500 #, kde-format 9501 msgid "America/Halifax" 9502 msgstr "আমেরিকা/হ্যালিফ্যাক্স" 9503 9504 #. i18n: comment to the previous timezone 9505 #: kdecore/TIMEZONES:301 9506 #, kde-format 9507 msgid "Atlantic - NS (most areas); PE" 9508 msgstr "" 9509 9510 #: kdecore/TIMEZONES:302 9511 #, kde-format 9512 msgid "America/Havana" 9513 msgstr "আমেরিকা/হাভানা" 9514 9515 #: kdecore/TIMEZONES:303 9516 #, kde-format 9517 msgid "America/Hermosillo" 9518 msgstr "আমেরিকা/হার্মোসিলো" 9519 9520 #. i18n: comment to the previous timezone 9521 #: kdecore/TIMEZONES:305 9522 #, kde-format 9523 msgid "Mountain Standard Time - Sonora" 9524 msgstr "" 9525 9526 #: kdecore/TIMEZONES:306 9527 #, fuzzy, kde-format 9528 msgid "America/Indiana/Indianapolis" 9529 msgstr "আমেরিকা/ইণ্ডিয়ানাপলিস" 9530 9531 #. i18n: comment to the previous timezone 9532 #: kdecore/TIMEZONES:310 9533 #, kde-format 9534 msgid "Eastern - IN (most areas)" 9535 msgstr "" 9536 9537 #: kdecore/TIMEZONES:311 9538 #, kde-format 9539 msgid "America/Indiana/Knox" 9540 msgstr "আমেরিকা/ইণ্ডিয়ানা/নক্স" 9541 9542 #. i18n: comment to the previous timezone 9543 #: kdecore/TIMEZONES:313 kdecore/TIMEZONES:384 kdecore/TIMEZONES:1428 9544 #, kde-format 9545 msgid "Eastern Time - Indiana - Starke County" 9546 msgstr "" 9547 9548 #. i18n: comment to the previous timezone 9549 #: kdecore/TIMEZONES:315 9550 #, kde-format 9551 msgid "Central Time - Indiana - Starke County" 9552 msgstr "" 9553 9554 #. i18n: comment to the previous timezone 9555 #: kdecore/TIMEZONES:317 9556 #, kde-format 9557 msgid "Central - IN (Starke)" 9558 msgstr "" 9559 9560 #: kdecore/TIMEZONES:318 9561 #, kde-format 9562 msgid "America/Indiana/Marengo" 9563 msgstr "আমেরিকা/ইণ্ডিয়ানা/ম্যারেংগো" 9564 9565 #. i18n: comment to the previous timezone 9566 #: kdecore/TIMEZONES:320 9567 #, kde-format 9568 msgid "Eastern Time - Indiana - Crawford County" 9569 msgstr "" 9570 9571 #. i18n: comment to the previous timezone 9572 #: kdecore/TIMEZONES:322 9573 #, kde-format 9574 msgid "Eastern - IN (Crawford)" 9575 msgstr "" 9576 9577 #: kdecore/TIMEZONES:323 9578 #, fuzzy, kde-format 9579 msgid "America/Indiana/Petersburg" 9580 msgstr "আমেরিকা/ইণ্ডিয়ানা/ম্যারেংগো" 9581 9582 #. i18n: comment to the previous timezone 9583 #: kdecore/TIMEZONES:325 9584 #, kde-format 9585 msgid "Central Time - Indiana - Pike County" 9586 msgstr "" 9587 9588 #. i18n: comment to the previous timezone 9589 #: kdecore/TIMEZONES:327 9590 #, kde-format 9591 msgid "Eastern Time - Indiana - Pike County" 9592 msgstr "" 9593 9594 #. i18n: comment to the previous timezone 9595 #: kdecore/TIMEZONES:329 9596 #, kde-format 9597 msgid "Eastern - IN (Pike)" 9598 msgstr "" 9599 9600 #: kdecore/TIMEZONES:330 9601 #, fuzzy, kde-format 9602 msgid "America/Indiana/Tell_City" 9603 msgstr "আমেরিকা/ইণ্ডিয়ানা/ভেভে" 9604 9605 #. i18n: comment to the previous timezone 9606 #: kdecore/TIMEZONES:332 9607 #, kde-format 9608 msgid "Central Time - Indiana - Perry County" 9609 msgstr "" 9610 9611 #. i18n: comment to the previous timezone 9612 #: kdecore/TIMEZONES:334 9613 #, kde-format 9614 msgid "Central - IN (Perry)" 9615 msgstr "" 9616 9617 #: kdecore/TIMEZONES:335 9618 #, kde-format 9619 msgid "America/Indiana/Vevay" 9620 msgstr "আমেরিকা/ইণ্ডিয়ানা/ভেভে" 9621 9622 #. i18n: comment to the previous timezone 9623 #: kdecore/TIMEZONES:337 9624 #, kde-format 9625 msgid "Eastern Time - Indiana - Switzerland County" 9626 msgstr "" 9627 9628 #. i18n: comment to the previous timezone 9629 #: kdecore/TIMEZONES:339 9630 #, kde-format 9631 msgid "Eastern - IN (Switzerland)" 9632 msgstr "" 9633 9634 #: kdecore/TIMEZONES:340 9635 #, fuzzy, kde-format 9636 msgid "America/Indiana/Vincennes" 9637 msgstr "আমেরিকা/ইণ্ডিয়ানা/ভেভে" 9638 9639 #. i18n: comment to the previous timezone 9640 #: kdecore/TIMEZONES:342 9641 #, kde-format 9642 msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" 9643 msgstr "" 9644 9645 #. i18n: comment to the previous timezone 9646 #: kdecore/TIMEZONES:344 9647 #, kde-format 9648 msgid "Eastern - IN (Da, Du, K, Mn)" 9649 msgstr "" 9650 9651 #: kdecore/TIMEZONES:345 9652 #, fuzzy, kde-format 9653 msgid "America/Indiana/Winamac" 9654 msgstr "আমেরিকা/ইণ্ডিয়ানা/নক্স" 9655 9656 #. i18n: comment to the previous timezone 9657 #: kdecore/TIMEZONES:347 9658 #, kde-format 9659 msgid "Eastern Time - Indiana - Pulaski County" 9660 msgstr "" 9661 9662 #. i18n: comment to the previous timezone 9663 #: kdecore/TIMEZONES:349 9664 #, kde-format 9665 msgid "Eastern - IN (Pulaski)" 9666 msgstr "" 9667 9668 #: kdecore/TIMEZONES:350 9669 #, kde-format 9670 msgid "America/Indianapolis" 9671 msgstr "আমেরিকা/ইণ্ডিয়ানাপলিস" 9672 9673 #: kdecore/TIMEZONES:353 9674 #, kde-format 9675 msgid "America/Inuvik" 9676 msgstr "আমেরিকা/ইনুভিক" 9677 9678 #. i18n: comment to the previous timezone 9679 #: kdecore/TIMEZONES:355 9680 #, kde-format 9681 msgid "Mountain Time - west Northwest Territories" 9682 msgstr "" 9683 9684 #. i18n: comment to the previous timezone 9685 #: kdecore/TIMEZONES:357 9686 #, kde-format 9687 msgid "Mountain - NT (west)" 9688 msgstr "" 9689 9690 #: kdecore/TIMEZONES:358 9691 #, kde-format 9692 msgid "America/Iqaluit" 9693 msgstr "আমেরিকা/ইকালুইট" 9694 9695 #. i18n: comment to the previous timezone 9696 #: kdecore/TIMEZONES:360 9697 #, kde-format 9698 msgid "Eastern Time - east Nunavut - most locations" 9699 msgstr "" 9700 9701 #. i18n: comment to the previous timezone 9702 #: kdecore/TIMEZONES:362 9703 #, kde-format 9704 msgid "Eastern - NU (most east areas)" 9705 msgstr "" 9706 9707 #: kdecore/TIMEZONES:363 9708 #, kde-format 9709 msgid "America/Jamaica" 9710 msgstr "আমেরিকা/জামাইকা" 9711 9712 #: kdecore/TIMEZONES:364 9713 #, fuzzy, kde-format 9714 msgid "America/Jujuy" 9715 msgstr "আমেরিকা/" 9716 9717 #: kdecore/TIMEZONES:367 9718 #, kde-format 9719 msgid "America/Juneau" 9720 msgstr "আমেরিকা/জুনো" 9721 9722 #. i18n: comment to the previous timezone 9723 #: kdecore/TIMEZONES:369 9724 #, kde-format 9725 msgid "Alaska Time - Alaska panhandle" 9726 msgstr "" 9727 9728 #. i18n: comment to the previous timezone 9729 #: kdecore/TIMEZONES:371 9730 #, kde-format 9731 msgid "Alaska - Juneau area" 9732 msgstr "" 9733 9734 #: kdecore/TIMEZONES:372 9735 #, fuzzy, kde-format 9736 msgid "America/Kentucky/Louisville" 9737 msgstr "আমেরিকা/লুইভিল" 9738 9739 #. i18n: comment to the previous timezone 9740 #: kdecore/TIMEZONES:374 kdecore/TIMEZONES:395 9741 #, fuzzy, kde-format 9742 msgid "Eastern Time - Kentucky - Louisville area" 9743 msgstr "আমেরিকা/লুইভিল" 9744 9745 #. i18n: comment to the previous timezone 9746 #: kdecore/TIMEZONES:376 9747 #, fuzzy, kde-format 9748 msgid "Eastern - KY (Louisville area)" 9749 msgstr "আমেরিকা/লুইভিল" 9750 9751 #: kdecore/TIMEZONES:377 9752 #, kde-format 9753 msgid "America/Kentucky/Monticello" 9754 msgstr "আমেরিকা/কেনটাকি/মন্টিচেলো" 9755 9756 #. i18n: comment to the previous timezone 9757 #: kdecore/TIMEZONES:379 9758 #, kde-format 9759 msgid "Eastern Time - Kentucky - Wayne County" 9760 msgstr "" 9761 9762 #. i18n: comment to the previous timezone 9763 #: kdecore/TIMEZONES:381 9764 #, kde-format 9765 msgid "Eastern - KY (Wayne)" 9766 msgstr "" 9767 9768 #: kdecore/TIMEZONES:382 9769 #, fuzzy, kde-format 9770 msgid "America/Knox_IN" 9771 msgstr "আমেরিকা/ইণ্ডিয়ানা/নক্স" 9772 9773 #: kdecore/TIMEZONES:385 9774 #, fuzzy, kde-format 9775 #| msgid "America/Grenada" 9776 msgid "America/Kralendijk" 9777 msgstr "আমেরিকা/গ্রেনাডা" 9778 9779 #: kdecore/TIMEZONES:386 9780 #, kde-format 9781 msgid "America/La_Paz" 9782 msgstr "আমেরিকা/লা_পাজ" 9783 9784 #: kdecore/TIMEZONES:387 9785 #, kde-format 9786 msgid "America/Lima" 9787 msgstr "আমেরিকা/লিমা" 9788 9789 #: kdecore/TIMEZONES:388 9790 #, kde-format 9791 msgid "America/Los_Angeles" 9792 msgstr "আমেরিকা/লস_অ্যাঞ্জেলেস" 9793 9794 #. i18n: comment to the previous timezone 9795 #: kdecore/TIMEZONES:392 9796 #, fuzzy, kde-format 9797 msgid "Pacific" 9798 msgstr "প্যাসিফিক/য়াপ" 9799 9800 #: kdecore/TIMEZONES:393 9801 #, kde-format 9802 msgid "America/Louisville" 9803 msgstr "আমেরিকা/লুইভিল" 9804 9805 #: kdecore/TIMEZONES:396 9806 #, fuzzy, kde-format 9807 #| msgid "America/Port-au-Prince" 9808 msgid "America/Lower_Princes" 9809 msgstr "আমেরিকা/পোর্ট-অ-প্রিন্স" 9810 9811 #: kdecore/TIMEZONES:397 9812 #, kde-format 9813 msgid "America/Maceio" 9814 msgstr "আমেরিকা/ম্যাসিও" 9815 9816 #. i18n: comment to the previous timezone 9817 #: kdecore/TIMEZONES:399 9818 #, kde-format 9819 msgid "Alagoas, Sergipe" 9820 msgstr "" 9821 9822 #: kdecore/TIMEZONES:400 9823 #, kde-format 9824 msgid "America/Managua" 9825 msgstr "আমেরিকা/মানাগুয়া" 9826 9827 #: kdecore/TIMEZONES:401 9828 #, kde-format 9829 msgid "America/Manaus" 9830 msgstr "আমেরিকা/মানাউস" 9831 9832 #. i18n: comment to the previous timezone 9833 #: kdecore/TIMEZONES:403 kdecore/TIMEZONES:1099 9834 #, kde-format 9835 msgid "E Amazonas" 9836 msgstr "" 9837 9838 #. i18n: comment to the previous timezone 9839 #: kdecore/TIMEZONES:405 9840 #, kde-format 9841 msgid "Amazonas (east)" 9842 msgstr "" 9843 9844 #: kdecore/TIMEZONES:406 9845 #, fuzzy, kde-format 9846 msgid "America/Marigot" 9847 msgstr "আমেরিকা/ম্যাসিও" 9848 9849 #: kdecore/TIMEZONES:407 9850 #, kde-format 9851 msgid "America/Martinique" 9852 msgstr "আমেরিকা/মার্টিনিক" 9853 9854 #: kdecore/TIMEZONES:408 9855 #, fuzzy, kde-format 9856 #| msgid "America/Manaus" 9857 msgid "America/Matamoros" 9858 msgstr "আমেরিকা/মানাউস" 9859 9860 #. i18n: comment to the previous timezone 9861 #: kdecore/TIMEZONES:410 9862 #, kde-format 9863 msgid "" 9864 "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" 9865 msgstr "" 9866 9867 #. i18n: comment to the previous timezone 9868 #: kdecore/TIMEZONES:412 9869 #, kde-format 9870 msgid "Central Time US - Coahuila, Nuevo Leon, Tamaulipas (US border)" 9871 msgstr "" 9872 9873 #: kdecore/TIMEZONES:413 9874 #, kde-format 9875 msgid "America/Mazatlan" 9876 msgstr "আমেরিকা/মাজাটলান" 9877 9878 #. i18n: comment to the previous timezone 9879 #: kdecore/TIMEZONES:415 kdecore/TIMEZONES:1280 9880 #, kde-format 9881 msgid "Mountain Time - S Baja, Nayarit, Sinaloa" 9882 msgstr "" 9883 9884 #. i18n: comment to the previous timezone 9885 #: kdecore/TIMEZONES:417 9886 #, kde-format 9887 msgid "Mountain Time - Baja California Sur, Nayarit, Sinaloa" 9888 msgstr "" 9889 9890 #: kdecore/TIMEZONES:418 9891 #, kde-format 9892 msgid "America/Mendoza" 9893 msgstr "আমেরিকা/মেণ্ডোজা" 9894 9895 #: kdecore/TIMEZONES:421 9896 #, kde-format 9897 msgid "America/Menominee" 9898 msgstr "আমেরিকা/মেনোমিনি" 9899 9900 #. i18n: comment to the previous timezone 9901 #: kdecore/TIMEZONES:423 9902 #, kde-format 9903 msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" 9904 msgstr "" 9905 9906 #. i18n: comment to the previous timezone 9907 #: kdecore/TIMEZONES:425 9908 #, kde-format 9909 msgid "Central - MI (Wisconsin border)" 9910 msgstr "" 9911 9912 #: kdecore/TIMEZONES:426 9913 #, kde-format 9914 msgid "America/Merida" 9915 msgstr "আমেরিকা/মেরিডা" 9916 9917 #. i18n: comment to the previous timezone 9918 #: kdecore/TIMEZONES:428 9919 #, kde-format 9920 msgid "Central Time - Campeche, Yucatan" 9921 msgstr "" 9922 9923 #: kdecore/TIMEZONES:429 9924 #, fuzzy, kde-format 9925 #| msgid "America/Mazatlan" 9926 msgid "America/Metlakatla" 9927 msgstr "আমেরিকা/মাজাটলান" 9928 9929 #. i18n: comment to the previous timezone 9930 #: kdecore/TIMEZONES:431 9931 #, kde-format 9932 msgid "Metlakatla Time - Annette Island" 9933 msgstr "" 9934 9935 #. i18n: comment to the previous timezone 9936 #: kdecore/TIMEZONES:433 9937 #, kde-format 9938 msgid "Alaska - Annette Island" 9939 msgstr "" 9940 9941 #: kdecore/TIMEZONES:434 9942 #, kde-format 9943 msgid "America/Mexico_City" 9944 msgstr "আমেরিকা/মেক্সিকো_সিটি" 9945 9946 #. i18n: comment to the previous timezone 9947 #: kdecore/TIMEZONES:436 kdecore/TIMEZONES:1283 9948 #, kde-format 9949 msgid "Central Time - most locations" 9950 msgstr "" 9951 9952 #: kdecore/TIMEZONES:439 9953 #, fuzzy, kde-format 9954 msgid "America/Miquelon" 9955 msgstr "আমেরিকা/" 9956 9957 #: kdecore/TIMEZONES:440 9958 #, fuzzy, kde-format 9959 msgid "America/Moncton" 9960 msgstr "আমেরিকা/এডমন্টন" 9961 9962 #. i18n: comment to the previous timezone 9963 #: kdecore/TIMEZONES:442 9964 #, kde-format 9965 msgid "Atlantic Time - New Brunswick" 9966 msgstr "" 9967 9968 #. i18n: comment to the previous timezone 9969 #: kdecore/TIMEZONES:444 9970 #, kde-format 9971 msgid "Atlantic - New Brunswick" 9972 msgstr "" 9973 9974 #: kdecore/TIMEZONES:445 9975 #, kde-format 9976 msgid "America/Monterrey" 9977 msgstr "আমেরিকা/মনটেরে" 9978 9979 #. i18n: comment to the previous timezone 9980 #: kdecore/TIMEZONES:447 9981 #, kde-format 9982 msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" 9983 msgstr "" 9984 9985 #. i18n: comment to the previous timezone 9986 #: kdecore/TIMEZONES:449 9987 #, kde-format 9988 msgid "" 9989 "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " 9990 "US border" 9991 msgstr "" 9992 9993 #. i18n: comment to the previous timezone 9994 #: kdecore/TIMEZONES:451 9995 #, kde-format 9996 msgid "Central Time - Durango; Coahuila, Nuevo Leon, Tamaulipas (most areas)" 9997 msgstr "" 9998 9999 #: kdecore/TIMEZONES:452 10000 #, kde-format 10001 msgid "America/Montevideo" 10002 msgstr "আমেরিকা/মন্টিভিডিও" 10003 10004 #: kdecore/TIMEZONES:453 10005 #, kde-format 10006 msgid "America/Montreal" 10007 msgstr "আমেরিকা/মনট্রিয়াল" 10008 10009 #. i18n: comment to the previous timezone 10010 #: kdecore/TIMEZONES:455 kdecore/TIMEZONES:501 10011 #, kde-format 10012 msgid "Eastern Time - Quebec - most locations" 10013 msgstr "" 10014 10015 #: kdecore/TIMEZONES:456 10016 #, kde-format 10017 msgid "America/Montserrat" 10018 msgstr "আমেরিকা/মোনটেসরাট" 10019 10020 #: kdecore/TIMEZONES:457 10021 #, kde-format 10022 msgid "America/Nassau" 10023 msgstr "আমেরিকা/নাসাউ" 10024 10025 #: kdecore/TIMEZONES:458 10026 #, kde-format 10027 msgid "America/New_York" 10028 msgstr "আমেরিকা/নিউ_ইয়র্ক" 10029 10030 #. i18n: comment to the previous timezone 10031 #: kdecore/TIMEZONES:460 kdecore/TIMEZONES:1422 10032 #, kde-format 10033 msgid "Eastern Time" 10034 msgstr "" 10035 10036 #. i18n: comment to the previous timezone 10037 #: kdecore/TIMEZONES:462 10038 #, kde-format 10039 msgid "Eastern (most areas)" 10040 msgstr "" 10041 10042 #: kdecore/TIMEZONES:463 10043 #, kde-format 10044 msgid "America/Nipigon" 10045 msgstr "আমেরিকা/নিপিগন" 10046 10047 #. i18n: comment to the previous timezone 10048 #: kdecore/TIMEZONES:465 10049 #, kde-format 10050 msgid "" 10051 "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" 10052 msgstr "" 10053 10054 #. i18n: comment to the previous timezone 10055 #: kdecore/TIMEZONES:467 10056 #, kde-format 10057 msgid "Eastern - ON, QC (no DST 1967-73)" 10058 msgstr "" 10059 10060 #: kdecore/TIMEZONES:468 10061 #, kde-format 10062 msgid "America/Nome" 10063 msgstr "আমেরিকা/নোম" 10064 10065 #. i18n: comment to the previous timezone 10066 #: kdecore/TIMEZONES:470 10067 #, kde-format 10068 msgid "Alaska Time - west Alaska" 10069 msgstr "" 10070 10071 #. i18n: comment to the previous timezone 10072 #: kdecore/TIMEZONES:472 10073 #, kde-format 10074 msgid "Alaska (west)" 10075 msgstr "" 10076 10077 #: kdecore/TIMEZONES:473 10078 #, kde-format 10079 msgid "America/Noronha" 10080 msgstr "আমেরিকা/নোরোনহা" 10081 10082 #. i18n: comment to the previous timezone 10083 #: kdecore/TIMEZONES:475 kdecore/TIMEZONES:1093 10084 #, fuzzy, kde-format 10085 msgid "Atlantic islands" 10086 msgstr "অ্যাটলান্টিক/ক্যানারি" 10087 10088 #: kdecore/TIMEZONES:476 10089 #, fuzzy, kde-format 10090 #| msgid "America/North_Dakota/Center" 10091 msgid "America/North_Dakota/Beulah" 10092 msgstr "আমেরিকা/নর্থ_ডাকোটা/সেন্টার" 10093 10094 #. i18n: comment to the previous timezone 10095 #: kdecore/TIMEZONES:478 10096 #, kde-format 10097 msgid "Central Time - North Dakota - Mercer County" 10098 msgstr "" 10099 10100 #. i18n: comment to the previous timezone 10101 #: kdecore/TIMEZONES:480 10102 #, kde-format 10103 msgid "Central - ND (Mercer)" 10104 msgstr "" 10105 10106 #: kdecore/TIMEZONES:481 10107 #, kde-format 10108 msgid "America/North_Dakota/Center" 10109 msgstr "আমেরিকা/নর্থ_ডাকোটা/সেন্টার" 10110 10111 #. i18n: comment to the previous timezone 10112 #: kdecore/TIMEZONES:483 10113 #, kde-format 10114 msgid "Central Time - North Dakota - Oliver County" 10115 msgstr "" 10116 10117 #. i18n: comment to the previous timezone 10118 #: kdecore/TIMEZONES:485 10119 #, kde-format 10120 msgid "Central - ND (Oliver)" 10121 msgstr "" 10122 10123 #: kdecore/TIMEZONES:486 10124 #, fuzzy, kde-format 10125 msgid "America/North_Dakota/New_Salem" 10126 msgstr "আমেরিকা/নর্থ_ডাকোটা/সেন্টার" 10127 10128 #. i18n: comment to the previous timezone 10129 #: kdecore/TIMEZONES:488 10130 #, kde-format 10131 msgid "Central Time - North Dakota - Morton County (except Mandan area)" 10132 msgstr "" 10133 10134 #. i18n: comment to the previous timezone 10135 #: kdecore/TIMEZONES:490 10136 #, kde-format 10137 msgid "Central - ND (Morton rural)" 10138 msgstr "" 10139 10140 #: kdecore/TIMEZONES:491 10141 #, fuzzy, kde-format 10142 msgid "America/Nuuk" 10143 msgstr "আমেরিকা/" 10144 10145 #. i18n: comment to the previous timezone 10146 #: kdecore/TIMEZONES:493 10147 #, kde-format 10148 msgid "Greenland (most areas)" 10149 msgstr "" 10150 10151 #: kdecore/TIMEZONES:494 10152 #, fuzzy, kde-format 10153 #| msgid "America/Managua" 10154 msgid "America/Ojinaga" 10155 msgstr "আমেরিকা/মানাগুয়া" 10156 10157 #. i18n: comment to the previous timezone 10158 #: kdecore/TIMEZONES:496 10159 #, kde-format 10160 msgid "US Mountain Time - Chihuahua near US border" 10161 msgstr "" 10162 10163 #. i18n: comment to the previous timezone 10164 #: kdecore/TIMEZONES:498 10165 #, kde-format 10166 msgid "Mountain Time US - Chihuahua (US border)" 10167 msgstr "" 10168 10169 #: kdecore/TIMEZONES:499 10170 #, fuzzy, kde-format 10171 msgid "America/Ontario" 10172 msgstr "আমেরিকা/রোসারিও" 10173 10174 #: kdecore/TIMEZONES:502 10175 #, kde-format 10176 msgid "America/Panama" 10177 msgstr "আমেরিকা/প্যানামা" 10178 10179 #: kdecore/TIMEZONES:503 10180 #, fuzzy, kde-format 10181 msgid "America/Pangnirtung" 10182 msgstr "আমেরিকা/" 10183 10184 #. i18n: comment to the previous timezone 10185 #: kdecore/TIMEZONES:505 10186 #, kde-format 10187 msgid "Eastern Time - Pangnirtung, Nunavut" 10188 msgstr "" 10189 10190 #. i18n: comment to the previous timezone 10191 #: kdecore/TIMEZONES:507 10192 #, kde-format 10193 msgid "Eastern - NU (Pangnirtung)" 10194 msgstr "" 10195 10196 #: kdecore/TIMEZONES:508 10197 #, kde-format 10198 msgid "America/Paramaribo" 10199 msgstr "আমেরিকা/পারামারিবো" 10200 10201 #: kdecore/TIMEZONES:509 10202 #, kde-format 10203 msgid "America/Phoenix" 10204 msgstr "আমেরিকা/ফিনিক্স" 10205 10206 #. i18n: comment to the previous timezone 10207 #: kdecore/TIMEZONES:511 kdecore/TIMEZONES:1413 10208 #, kde-format 10209 msgid "Mountain Standard Time - Arizona" 10210 msgstr "" 10211 10212 #. i18n: comment to the previous timezone 10213 #: kdecore/TIMEZONES:513 10214 #, kde-format 10215 msgid "MST - Arizona (except Navajo)" 10216 msgstr "" 10217 10218 #: kdecore/TIMEZONES:514 10219 #, kde-format 10220 msgid "America/Port-au-Prince" 10221 msgstr "আমেরিকা/পোর্ট-অ-প্রিন্স" 10222 10223 #: kdecore/TIMEZONES:515 10224 #, kde-format 10225 msgid "America/Port_of_Spain" 10226 msgstr "আমেরিকা/পোর্ট_অফ_স্পেন" 10227 10228 #: kdecore/TIMEZONES:516 10229 #, fuzzy, kde-format 10230 msgid "America/Porto_Acre" 10231 msgstr "আমেরিকা/পোর্টো_ভেলহো" 10232 10233 #. i18n: comment to the previous timezone 10234 #: kdecore/TIMEZONES:518 kdecore/TIMEZONES:553 kdecore/TIMEZONES:1090 10235 #, kde-format 10236 msgid "Acre" 10237 msgstr "" 10238 10239 #: kdecore/TIMEZONES:519 10240 #, kde-format 10241 msgid "America/Porto_Velho" 10242 msgstr "আমেরিকা/পোর্টো_ভেলহো" 10243 10244 #. i18n: comment to the previous timezone 10245 #: kdecore/TIMEZONES:521 10246 #, kde-format 10247 msgid "Rondonia" 10248 msgstr "" 10249 10250 #: kdecore/TIMEZONES:522 10251 #, kde-format 10252 msgid "America/Puerto_Rico" 10253 msgstr "আমেরিকা/পুয়ের্তো_রিকো" 10254 10255 #: kdecore/TIMEZONES:523 10256 #, fuzzy, kde-format 10257 #| msgid "America/Buenos_Aires" 10258 msgid "America/Punta_Arenas" 10259 msgstr "আমেরিকা/বুয়েনস_এয়ারেস" 10260 10261 #. i18n: comment to the previous timezone 10262 #: kdecore/TIMEZONES:525 10263 #, kde-format 10264 msgid "Region of Magallanes" 10265 msgstr "" 10266 10267 #: kdecore/TIMEZONES:526 10268 #, kde-format 10269 msgid "America/Rainy_River" 10270 msgstr "আমেরিকা/রেইনি_রিভার" 10271 10272 #. i18n: comment to the previous timezone 10273 #: kdecore/TIMEZONES:528 10274 #, kde-format 10275 msgid "Central Time - Rainy River & Fort Frances, Ontario" 10276 msgstr "" 10277 10278 #. i18n: comment to the previous timezone 10279 #: kdecore/TIMEZONES:530 10280 #, kde-format 10281 msgid "Central - ON (Rainy R, Ft Frances)" 10282 msgstr "" 10283 10284 #: kdecore/TIMEZONES:531 10285 #, kde-format 10286 msgid "America/Rankin_Inlet" 10287 msgstr "আমেরিকা/রানকিন_ইনলেট" 10288 10289 #. i18n: comment to the previous timezone 10290 #: kdecore/TIMEZONES:533 10291 #, kde-format 10292 msgid "Central Time - central Nunavut" 10293 msgstr "" 10294 10295 #. i18n: comment to the previous timezone 10296 #: kdecore/TIMEZONES:535 10297 #, kde-format 10298 msgid "Central - NU (central)" 10299 msgstr "" 10300 10301 #: kdecore/TIMEZONES:536 10302 #, kde-format 10303 msgid "America/Recife" 10304 msgstr "আমেরিকা/রেসিফ" 10305 10306 #. i18n: comment to the previous timezone 10307 #: kdecore/TIMEZONES:538 10308 #, kde-format 10309 msgid "Pernambuco" 10310 msgstr "" 10311 10312 #: kdecore/TIMEZONES:539 10313 #, kde-format 10314 msgid "America/Regina" 10315 msgstr "আমেরিকা/রেজিনা" 10316 10317 #. i18n: comment to the previous timezone 10318 #: kdecore/TIMEZONES:541 kdecore/TIMEZONES:578 kdecore/TIMEZONES:1108 10319 #: kdecore/TIMEZONES:1123 10320 #, kde-format 10321 msgid "Central Standard Time - Saskatchewan - most locations" 10322 msgstr "" 10323 10324 #. i18n: comment to the previous timezone 10325 #: kdecore/TIMEZONES:543 10326 #, kde-format 10327 msgid "CST - SK (most areas)" 10328 msgstr "" 10329 10330 #: kdecore/TIMEZONES:544 10331 #, fuzzy, kde-format 10332 msgid "America/Resolute" 10333 msgstr "আমেরিকা/বেলেম" 10334 10335 #. i18n: comment to the previous timezone 10336 #: kdecore/TIMEZONES:546 10337 #, kde-format 10338 msgid "Eastern Time - Resolute, Nunavut" 10339 msgstr "" 10340 10341 #. i18n: comment to the previous timezone 10342 #: kdecore/TIMEZONES:548 10343 #, kde-format 10344 msgid "Central Standard Time - Resolute, Nunavut" 10345 msgstr "" 10346 10347 #. i18n: comment to the previous timezone 10348 #: kdecore/TIMEZONES:550 10349 #, kde-format 10350 msgid "Central - NU (Resolute)" 10351 msgstr "" 10352 10353 #: kdecore/TIMEZONES:551 10354 #, kde-format 10355 msgid "America/Rio_Branco" 10356 msgstr "আমেরিকা/রিও_ব্রাঙ্কো" 10357 10358 #: kdecore/TIMEZONES:554 10359 #, kde-format 10360 msgid "America/Rosario" 10361 msgstr "আমেরিকা/রোসারিও" 10362 10363 #: kdecore/TIMEZONES:557 10364 #, fuzzy, kde-format 10365 msgid "America/Santa_Isabel" 10366 msgstr "আমেরিকা/সান্টিয়াগো" 10367 10368 #. i18n: comment to the previous timezone 10369 #: kdecore/TIMEZONES:559 10370 #, kde-format 10371 msgid "Mexican Pacific Time - Baja California away from US border" 10372 msgstr "" 10373 10374 #: kdecore/TIMEZONES:560 10375 #, fuzzy, kde-format 10376 msgid "America/Santarem" 10377 msgstr "আমেরিকা/সান্টিয়াগো" 10378 10379 #. i18n: comment to the previous timezone 10380 #: kdecore/TIMEZONES:562 10381 #, fuzzy, kde-format 10382 msgid "W Para" 10383 msgstr "মার্চের" 10384 10385 #. i18n: comment to the previous timezone 10386 #: kdecore/TIMEZONES:564 10387 #, kde-format 10388 msgid "Para (west)" 10389 msgstr "" 10390 10391 #: kdecore/TIMEZONES:565 10392 #, kde-format 10393 msgid "America/Santiago" 10394 msgstr "আমেরিকা/সান্টিয়াগো" 10395 10396 #. i18n: comment to the previous timezone 10397 #: kdecore/TIMEZONES:569 10398 #, kde-format 10399 msgid "Chile (most areas)" 10400 msgstr "" 10401 10402 #: kdecore/TIMEZONES:570 10403 #, kde-format 10404 msgid "America/Santo_Domingo" 10405 msgstr "আমেরিকা/সান্টো_ডোমিঙ্গো" 10406 10407 #: kdecore/TIMEZONES:571 10408 #, kde-format 10409 msgid "America/Sao_Paulo" 10410 msgstr "আমেরিকা/সাও_পাওলো" 10411 10412 #. i18n: comment to the previous timezone 10413 #: kdecore/TIMEZONES:573 kdecore/TIMEZONES:1096 10414 #, kde-format 10415 msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10416 msgstr "" 10417 10418 #. i18n: comment to the previous timezone 10419 #: kdecore/TIMEZONES:575 10420 #, kde-format 10421 msgid "Brazil (southeast: GO, DF, MG, ES, RJ, SP, PR, SC, RS)" 10422 msgstr "" 10423 10424 #: kdecore/TIMEZONES:576 10425 #, fuzzy, kde-format 10426 msgid "America/Saskatoon" 10427 msgstr "আমেরিকা/ডসন" 10428 10429 #: kdecore/TIMEZONES:579 10430 #, fuzzy, kde-format 10431 msgid "America/Scoresbysund" 10432 msgstr "আমেরিকা/" 10433 10434 #. i18n: comment to the previous timezone 10435 #: kdecore/TIMEZONES:581 10436 #, kde-format 10437 msgid "Scoresbysund / Ittoqqortoormiit" 10438 msgstr "" 10439 10440 #. i18n: comment to the previous timezone 10441 #: kdecore/TIMEZONES:583 10442 #, kde-format 10443 msgid "Scoresbysund/Ittoqqortoormiit" 10444 msgstr "" 10445 10446 #: kdecore/TIMEZONES:584 10447 #, kde-format 10448 msgid "America/Shiprock" 10449 msgstr "আমেরিকা/শিপরক" 10450 10451 #. i18n: comment to the previous timezone 10452 #: kdecore/TIMEZONES:586 10453 #, kde-format 10454 msgid "Mountain Time - Navajo" 10455 msgstr "" 10456 10457 #: kdecore/TIMEZONES:587 10458 #, fuzzy, kde-format 10459 msgid "America/Sitka" 10460 msgstr "আমেরিকা/অ্যান্টিগুয়া" 10461 10462 #. i18n: comment to the previous timezone 10463 #: kdecore/TIMEZONES:589 10464 #, kde-format 10465 msgid "Alaska Time - southeast Alaska panhandle" 10466 msgstr "" 10467 10468 #. i18n: comment to the previous timezone 10469 #: kdecore/TIMEZONES:591 10470 #, kde-format 10471 msgid "Alaska - Sitka area" 10472 msgstr "" 10473 10474 #: kdecore/TIMEZONES:592 10475 #, fuzzy, kde-format 10476 msgid "America/St_Barthelemy" 10477 msgstr "আমেরিকা/বেলেম" 10478 10479 #: kdecore/TIMEZONES:593 10480 #, kde-format 10481 msgid "America/St_Johns" 10482 msgstr "আমেরিকা/সেন্ট_জনস" 10483 10484 #. i18n: comment to the previous timezone 10485 #: kdecore/TIMEZONES:595 kdecore/TIMEZONES:1117 10486 #, kde-format 10487 msgid "Newfoundland Time, including SE Labrador" 10488 msgstr "" 10489 10490 #. i18n: comment to the previous timezone 10491 #: kdecore/TIMEZONES:597 10492 #, kde-format 10493 msgid "Newfoundland; Labrador (southeast)" 10494 msgstr "" 10495 10496 #: kdecore/TIMEZONES:598 10497 #, kde-format 10498 msgid "America/St_Kitts" 10499 msgstr "আমেরিকা/সেন্ট_কিটস" 10500 10501 #: kdecore/TIMEZONES:599 10502 #, kde-format 10503 msgid "America/St_Lucia" 10504 msgstr "আমেরিকা/সেন্ট_লুসিয়া" 10505 10506 #: kdecore/TIMEZONES:600 10507 #, kde-format 10508 msgid "America/St_Thomas" 10509 msgstr "আমেরিকা/সেন্ট_টমাস" 10510 10511 #: kdecore/TIMEZONES:601 10512 #, kde-format 10513 msgid "America/St_Vincent" 10514 msgstr "আমেরিকা/সেন্ট_ভিনসেন্ট" 10515 10516 #: kdecore/TIMEZONES:602 10517 #, kde-format 10518 msgid "America/Swift_Current" 10519 msgstr "আমেরিকা/সুইফট_কারেন্ট" 10520 10521 #. i18n: comment to the previous timezone 10522 #: kdecore/TIMEZONES:604 10523 #, kde-format 10524 msgid "Central Standard Time - Saskatchewan - midwest" 10525 msgstr "" 10526 10527 #. i18n: comment to the previous timezone 10528 #: kdecore/TIMEZONES:606 10529 #, kde-format 10530 msgid "CST - SK (midwest)" 10531 msgstr "" 10532 10533 #: kdecore/TIMEZONES:607 10534 #, fuzzy, kde-format 10535 msgid "America/Tegucigalpa" 10536 msgstr "আমেরিকা/" 10537 10538 #: kdecore/TIMEZONES:608 10539 #, kde-format 10540 msgid "America/Thule" 10541 msgstr "আমেরিকা/থুল" 10542 10543 #. i18n: comment to the previous timezone 10544 #: kdecore/TIMEZONES:610 10545 #, kde-format 10546 msgid "Thule / Pituffik" 10547 msgstr "" 10548 10549 #. i18n: comment to the previous timezone 10550 #: kdecore/TIMEZONES:612 10551 #, kde-format 10552 msgid "Thule/Pituffik" 10553 msgstr "" 10554 10555 #: kdecore/TIMEZONES:613 10556 #, kde-format 10557 msgid "America/Thunder_Bay" 10558 msgstr "আমেরিকা/থান্ডার_বে" 10559 10560 #. i18n: comment to the previous timezone 10561 #: kdecore/TIMEZONES:615 10562 #, kde-format 10563 msgid "Eastern Time - Thunder Bay, Ontario" 10564 msgstr "" 10565 10566 #. i18n: comment to the previous timezone 10567 #: kdecore/TIMEZONES:617 10568 #, kde-format 10569 msgid "Eastern - ON (Thunder Bay)" 10570 msgstr "" 10571 10572 #: kdecore/TIMEZONES:618 10573 #, kde-format 10574 msgid "America/Tijuana" 10575 msgstr "আমেরিকা/টিউয়ানা" 10576 10577 #. i18n: comment to the previous timezone 10578 #: kdecore/TIMEZONES:622 10579 #, kde-format 10580 msgid "US Pacific Time - Baja California near US border" 10581 msgstr "" 10582 10583 #. i18n: comment to the previous timezone 10584 #: kdecore/TIMEZONES:624 10585 #, kde-format 10586 msgid "Pacific Time US - Baja California" 10587 msgstr "" 10588 10589 #: kdecore/TIMEZONES:625 10590 #, kde-format 10591 msgid "America/Toronto" 10592 msgstr "আমেরিকা/টরন্টো" 10593 10594 #. i18n: comment to the previous timezone 10595 #: kdecore/TIMEZONES:627 kdecore/TIMEZONES:1111 10596 #, kde-format 10597 msgid "Eastern Time - Ontario - most locations" 10598 msgstr "" 10599 10600 #. i18n: comment to the previous timezone 10601 #: kdecore/TIMEZONES:629 10602 #, kde-format 10603 msgid "Eastern - ON, QC (most areas)" 10604 msgstr "" 10605 10606 #: kdecore/TIMEZONES:630 10607 #, kde-format 10608 msgid "America/Tortola" 10609 msgstr "আমেরিকা/টর্টোলা" 10610 10611 #: kdecore/TIMEZONES:631 10612 #, kde-format 10613 msgid "America/Vancouver" 10614 msgstr "আমেরিকা/ভ্যাঙ্কুভার" 10615 10616 #. i18n: comment to the previous timezone 10617 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:1120 10618 #, kde-format 10619 msgid "Pacific Time - west British Columbia" 10620 msgstr "" 10621 10622 #. i18n: comment to the previous timezone 10623 #: kdecore/TIMEZONES:635 10624 #, kde-format 10625 msgid "Pacific - BC (most areas)" 10626 msgstr "" 10627 10628 #: kdecore/TIMEZONES:636 10629 #, fuzzy, kde-format 10630 msgid "America/Virgin" 10631 msgstr "আমেরিকা/রেজিনা" 10632 10633 #: kdecore/TIMEZONES:637 10634 #, kde-format 10635 msgid "America/Whitehorse" 10636 msgstr "আমেরিকা/ওয়াইটহর্স" 10637 10638 #. i18n: comment to the previous timezone 10639 #: kdecore/TIMEZONES:639 kdecore/TIMEZONES:1126 10640 #, kde-format 10641 msgid "Pacific Time - south Yukon" 10642 msgstr "" 10643 10644 #. i18n: comment to the previous timezone 10645 #: kdecore/TIMEZONES:641 10646 #, kde-format 10647 msgid "MST - Yukon (east)" 10648 msgstr "" 10649 10650 #: kdecore/TIMEZONES:642 10651 #, kde-format 10652 msgid "America/Winnipeg" 10653 msgstr "আমেরিকা/উইনিপেগ" 10654 10655 #. i18n: comment to the previous timezone 10656 #: kdecore/TIMEZONES:644 kdecore/TIMEZONES:1105 10657 #, kde-format 10658 msgid "Central Time - Manitoba & west Ontario" 10659 msgstr "" 10660 10661 #. i18n: comment to the previous timezone 10662 #: kdecore/TIMEZONES:646 10663 #, kde-format 10664 msgid "Central - ON (west); Manitoba" 10665 msgstr "" 10666 10667 #: kdecore/TIMEZONES:647 10668 #, kde-format 10669 msgid "America/Yakutat" 10670 msgstr "আমেরিকা/ইয়াকুতাত" 10671 10672 #. i18n: comment to the previous timezone 10673 #: kdecore/TIMEZONES:649 10674 #, kde-format 10675 msgid "Alaska Time - Alaska panhandle neck" 10676 msgstr "" 10677 10678 #. i18n: comment to the previous timezone 10679 #: kdecore/TIMEZONES:651 10680 #, kde-format 10681 msgid "Alaska - Yakutat" 10682 msgstr "" 10683 10684 #: kdecore/TIMEZONES:652 10685 #, kde-format 10686 msgid "America/Yellowknife" 10687 msgstr "আমেরিকা/ইয়েলোনাইফ" 10688 10689 #. i18n: comment to the previous timezone 10690 #: kdecore/TIMEZONES:654 10691 #, kde-format 10692 msgid "Mountain Time - central Northwest Territories" 10693 msgstr "" 10694 10695 #. i18n: comment to the previous timezone 10696 #: kdecore/TIMEZONES:656 10697 #, kde-format 10698 msgid "Mountain - NT (central)" 10699 msgstr "" 10700 10701 #: kdecore/TIMEZONES:657 10702 #, kde-format 10703 msgid "Antarctica/Casey" 10704 msgstr "অ্যান্টার্কটিকা/কেসী" 10705 10706 #. i18n: comment to the previous timezone 10707 #: kdecore/TIMEZONES:659 10708 #, kde-format 10709 msgid "Casey Station, Bailey Peninsula" 10710 msgstr "" 10711 10712 #. i18n: comment to the previous timezone 10713 #: kdecore/TIMEZONES:661 10714 #, kde-format 10715 msgid "Casey" 10716 msgstr "" 10717 10718 #: kdecore/TIMEZONES:662 10719 #, kde-format 10720 msgid "Antarctica/Davis" 10721 msgstr "অ্যান্টার্কটিকা/ডেভিস" 10722 10723 #. i18n: comment to the previous timezone 10724 #: kdecore/TIMEZONES:664 10725 #, kde-format 10726 msgid "Davis Station, Vestfold Hills" 10727 msgstr "" 10728 10729 #. i18n: comment to the previous timezone 10730 #: kdecore/TIMEZONES:666 10731 #, kde-format 10732 msgid "Davis" 10733 msgstr "" 10734 10735 #: kdecore/TIMEZONES:667 10736 #, fuzzy, kde-format 10737 msgid "Antarctica/DumontDUrville" 10738 msgstr "অ্যান্টার্কটিকা/" 10739 10740 #. i18n: comment to the previous timezone 10741 #: kdecore/TIMEZONES:669 10742 #, kde-format 10743 msgid "Dumont-d'Urville Station, Terre Adelie" 10744 msgstr "" 10745 10746 #. i18n: comment to the previous timezone 10747 #: kdecore/TIMEZONES:671 10748 #, fuzzy, kde-format 10749 msgid "Dumont-d'Urville" 10750 msgstr "অ্যান্টার্কটিকা/" 10751 10752 #: kdecore/TIMEZONES:672 10753 #, fuzzy, kde-format 10754 #| msgid "Antarctica/McMurdo" 10755 msgid "Antarctica/Macquarie" 10756 msgstr "অ্যান্টার্কটিকা/ম্যাকমুর্ডো" 10757 10758 #. i18n: comment to the previous timezone 10759 #: kdecore/TIMEZONES:674 10760 #, kde-format 10761 msgid "Macquarie Island Station, Macquarie Island" 10762 msgstr "" 10763 10764 #. i18n: comment to the previous timezone 10765 #: kdecore/TIMEZONES:676 10766 #, kde-format 10767 msgid "Macquarie Island" 10768 msgstr "" 10769 10770 #: kdecore/TIMEZONES:677 10771 #, kde-format 10772 msgid "Antarctica/Mawson" 10773 msgstr "অ্যান্টার্কটিকা/ম'সন" 10774 10775 #. i18n: comment to the previous timezone 10776 #: kdecore/TIMEZONES:679 10777 #, kde-format 10778 msgid "Mawson Station, Holme Bay" 10779 msgstr "" 10780 10781 #. i18n: comment to the previous timezone 10782 #: kdecore/TIMEZONES:681 10783 #, kde-format 10784 msgid "Mawson" 10785 msgstr "" 10786 10787 #: kdecore/TIMEZONES:682 10788 #, kde-format 10789 msgid "Antarctica/McMurdo" 10790 msgstr "অ্যান্টার্কটিকা/ম্যাকমুর্ডো" 10791 10792 #. i18n: comment to the previous timezone 10793 #: kdecore/TIMEZONES:684 10794 #, kde-format 10795 msgid "McMurdo Station, Ross Island" 10796 msgstr "" 10797 10798 #. i18n: comment to the previous timezone 10799 #: kdecore/TIMEZONES:686 10800 #, kde-format 10801 msgid "New Zealand time - McMurdo, South Pole" 10802 msgstr "" 10803 10804 #: kdecore/TIMEZONES:687 10805 #, kde-format 10806 msgid "Antarctica/Palmer" 10807 msgstr "অ্যান্টার্কটিকা/পামার" 10808 10809 #. i18n: comment to the previous timezone 10810 #: kdecore/TIMEZONES:689 10811 #, kde-format 10812 msgid "Palmer Station, Anvers Island" 10813 msgstr "" 10814 10815 #. i18n: comment to the previous timezone 10816 #: kdecore/TIMEZONES:691 10817 #, kde-format 10818 msgid "Palmer" 10819 msgstr "" 10820 10821 #: kdecore/TIMEZONES:692 10822 #, kde-format 10823 msgid "Antarctica/Rothera" 10824 msgstr "অ্যান্টার্কটিকা/রোথেরা" 10825 10826 #. i18n: comment to the previous timezone 10827 #: kdecore/TIMEZONES:694 10828 #, kde-format 10829 msgid "Rothera Station, Adelaide Island" 10830 msgstr "" 10831 10832 #. i18n: comment to the previous timezone 10833 #: kdecore/TIMEZONES:696 10834 #, kde-format 10835 msgid "Rothera" 10836 msgstr "" 10837 10838 #: kdecore/TIMEZONES:697 10839 #, kde-format 10840 msgid "Antarctica/South_Pole" 10841 msgstr "অ্যান্টার্কটিকা/দক্ষিণ_মেরু" 10842 10843 #. i18n: comment to the previous timezone 10844 #: kdecore/TIMEZONES:699 10845 #, kde-format 10846 msgid "Amundsen-Scott Station, South Pole" 10847 msgstr "" 10848 10849 #: kdecore/TIMEZONES:700 10850 #, kde-format 10851 msgid "Antarctica/Syowa" 10852 msgstr "অ্যান্টার্কটিকা/সাইয়োভা" 10853 10854 #. i18n: comment to the previous timezone 10855 #: kdecore/TIMEZONES:702 10856 #, kde-format 10857 msgid "Syowa Station, E Ongul I" 10858 msgstr "" 10859 10860 #. i18n: comment to the previous timezone 10861 #: kdecore/TIMEZONES:704 10862 #, kde-format 10863 msgid "Syowa" 10864 msgstr "" 10865 10866 #: kdecore/TIMEZONES:705 10867 #, fuzzy, kde-format 10868 #| msgid "Antarctica/McMurdo" 10869 msgid "Antarctica/Troll" 10870 msgstr "অ্যান্টার্কটিকা/ম্যাকমুর্ডো" 10871 10872 #. i18n: comment to the previous timezone 10873 #: kdecore/TIMEZONES:707 10874 #, kde-format 10875 msgid "Troll" 10876 msgstr "" 10877 10878 #: kdecore/TIMEZONES:708 10879 #, kde-format 10880 msgid "Antarctica/Vostok" 10881 msgstr "অ্যান্টার্কটিকা/ভস্টক" 10882 10883 #. i18n: comment to the previous timezone 10884 #: kdecore/TIMEZONES:710 10885 #, kde-format 10886 msgid "Vostok Station, S Magnetic Pole" 10887 msgstr "" 10888 10889 #. i18n: comment to the previous timezone 10890 #: kdecore/TIMEZONES:712 10891 #, kde-format 10892 msgid "Vostok Station, Lake Vostok" 10893 msgstr "" 10894 10895 #. i18n: comment to the previous timezone 10896 #: kdecore/TIMEZONES:714 10897 #, kde-format 10898 msgid "Vostok" 10899 msgstr "" 10900 10901 #: kdecore/TIMEZONES:715 10902 #, kde-format 10903 msgid "Arctic/Longyearbyen" 10904 msgstr "" 10905 10906 #: kdecore/TIMEZONES:716 10907 #, kde-format 10908 msgid "Asia/Aden" 10909 msgstr "এশিয়া/এডেন" 10910 10911 #: kdecore/TIMEZONES:717 10912 #, kde-format 10913 msgid "Asia/Almaty" 10914 msgstr "এশিয়া/আলমাটি" 10915 10916 #. i18n: comment to the previous timezone 10917 #: kdecore/TIMEZONES:721 10918 #, kde-format 10919 msgid "Kazakhstan (most areas)" 10920 msgstr "" 10921 10922 #: kdecore/TIMEZONES:722 10923 #, kde-format 10924 msgid "Asia/Amman" 10925 msgstr "এশিয়া/আমমান" 10926 10927 #: kdecore/TIMEZONES:723 10928 #, kde-format 10929 msgid "Asia/Anadyr" 10930 msgstr "এশিয়া/আনাদির" 10931 10932 #. i18n: comment to the previous timezone 10933 #: kdecore/TIMEZONES:725 10934 #, kde-format 10935 msgid "Moscow+10 - Bering Sea" 10936 msgstr "" 10937 10938 #. i18n: comment to the previous timezone 10939 #: kdecore/TIMEZONES:727 10940 #, kde-format 10941 msgid "Moscow+08 - Bering Sea" 10942 msgstr "" 10943 10944 #. i18n: comment to the previous timezone 10945 #: kdecore/TIMEZONES:729 10946 #, kde-format 10947 msgid "MSK+09 - Bering Sea" 10948 msgstr "" 10949 10950 #: kdecore/TIMEZONES:730 10951 #, fuzzy, kde-format 10952 msgid "Asia/Aqtau" 10953 msgstr "এশিয়া/" 10954 10955 #. i18n: comment to the previous timezone 10956 #: kdecore/TIMEZONES:732 10957 #, kde-format 10958 msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" 10959 msgstr "" 10960 10961 #. i18n: comment to the previous timezone 10962 #: kdecore/TIMEZONES:734 10963 #, kde-format 10964 msgid "Mangghystau/Mankistau" 10965 msgstr "" 10966 10967 #: kdecore/TIMEZONES:735 10968 #, fuzzy, kde-format 10969 msgid "Asia/Aqtobe" 10970 msgstr "এশিয়া/" 10971 10972 #. i18n: comment to the previous timezone 10973 #: kdecore/TIMEZONES:737 10974 #, kde-format 10975 msgid "Aqtobe (Aktobe)" 10976 msgstr "" 10977 10978 #. i18n: comment to the previous timezone 10979 #: kdecore/TIMEZONES:739 10980 #, kde-format 10981 msgid "Aqtobe/Aktobe" 10982 msgstr "" 10983 10984 #: kdecore/TIMEZONES:740 10985 #, fuzzy, kde-format 10986 msgid "Asia/Ashgabat" 10987 msgstr "এশিয়া/" 10988 10989 #: kdecore/TIMEZONES:741 10990 #, fuzzy, kde-format 10991 msgid "Asia/Ashkhabad" 10992 msgstr "এশিয়া/" 10993 10994 #: kdecore/TIMEZONES:742 10995 #, fuzzy, kde-format 10996 msgid "Asia/Atyrau" 10997 msgstr "এশিয়া/" 10998 10999 #. i18n: comment to the previous timezone 11000 #: kdecore/TIMEZONES:744 11001 #, kde-format 11002 msgid "Atyrau/Atirau/Gur'yev" 11003 msgstr "" 11004 11005 #: kdecore/TIMEZONES:745 11006 #, kde-format 11007 msgid "Asia/Baghdad" 11008 msgstr "এশিয়া/বাগদাদ" 11009 11010 #: kdecore/TIMEZONES:746 11011 #, kde-format 11012 msgid "Asia/Bahrain" 11013 msgstr "এশিয়া/বাহরেন" 11014 11015 #: kdecore/TIMEZONES:747 11016 #, kde-format 11017 msgid "Asia/Baku" 11018 msgstr "এশিয়া/বাকু" 11019 11020 #: kdecore/TIMEZONES:748 11021 #, kde-format 11022 msgid "Asia/Bangkok" 11023 msgstr "এশিয়া/ব্যাংকক" 11024 11025 #: kdecore/TIMEZONES:749 11026 #, fuzzy, kde-format 11027 #| msgid "Asia/Baku" 11028 msgid "Asia/Barnaul" 11029 msgstr "এশিয়া/বাকু" 11030 11031 #. i18n: comment to the previous timezone 11032 #: kdecore/TIMEZONES:751 11033 #, kde-format 11034 msgid "MSK+04 - Altai" 11035 msgstr "" 11036 11037 #: kdecore/TIMEZONES:752 11038 #, fuzzy, kde-format 11039 msgid "Asia/Beijing" 11040 msgstr "এশিয়া/বেইরুট" 11041 11042 #. i18n: comment to the previous timezone 11043 #: kdecore/TIMEZONES:754 kdecore/TIMEZONES:924 kdecore/TIMEZONES:1295 11044 #, kde-format 11045 msgid "east China - Beijing, Guangdong, Shanghai, etc." 11046 msgstr "" 11047 11048 #. i18n: comment to the previous timezone 11049 #: kdecore/TIMEZONES:756 11050 #, kde-format 11051 msgid "China Standard Time" 11052 msgstr "" 11053 11054 #: kdecore/TIMEZONES:757 11055 #, kde-format 11056 msgid "Asia/Beirut" 11057 msgstr "এশিয়া/বেইরুট" 11058 11059 #: kdecore/TIMEZONES:758 11060 #, kde-format 11061 msgid "Asia/Bishkek" 11062 msgstr "এশিয়া/বিশকেক" 11063 11064 #: kdecore/TIMEZONES:759 11065 #, kde-format 11066 msgid "Asia/Brunei" 11067 msgstr "এশিয়া/ব্রুনেই" 11068 11069 #: kdecore/TIMEZONES:760 11070 #, kde-format 11071 msgid "Asia/Calcutta" 11072 msgstr "এশিয়া/কলকাতা" 11073 11074 #: kdecore/TIMEZONES:761 11075 #, fuzzy, kde-format 11076 msgid "Asia/Chita" 11077 msgstr "এশিয়া/" 11078 11079 #. i18n: comment to the previous timezone 11080 #: kdecore/TIMEZONES:763 11081 #, kde-format 11082 msgid "MSK+06 - Zabaykalsky" 11083 msgstr "" 11084 11085 #: kdecore/TIMEZONES:764 11086 #, fuzzy, kde-format 11087 msgid "Asia/Choibalsan" 11088 msgstr "এশিয়া/" 11089 11090 #. i18n: comment to the previous timezone 11091 #: kdecore/TIMEZONES:766 11092 #, kde-format 11093 msgid "Dornod, Sukhbaatar" 11094 msgstr "" 11095 11096 #: kdecore/TIMEZONES:767 11097 #, kde-format 11098 msgid "Asia/Chongqing" 11099 msgstr "এশিয়া/চংচিং" 11100 11101 #. i18n: comment to the previous timezone 11102 #: kdecore/TIMEZONES:769 kdecore/TIMEZONES:774 11103 #, kde-format 11104 msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." 11105 msgstr "" 11106 11107 #. i18n: comment to the previous timezone 11108 #: kdecore/TIMEZONES:771 11109 #, kde-format 11110 msgid "China mountains" 11111 msgstr "" 11112 11113 #: kdecore/TIMEZONES:772 11114 #, fuzzy, kde-format 11115 msgid "Asia/Chungking" 11116 msgstr "এশিয়া/চংচিং" 11117 11118 #: kdecore/TIMEZONES:775 11119 #, kde-format 11120 msgid "Asia/Colombo" 11121 msgstr "এশিয়া/কলোম্বো" 11122 11123 #: kdecore/TIMEZONES:776 11124 #, fuzzy, kde-format 11125 msgid "Asia/Dacca" 11126 msgstr "এশিয়া/ঢাকা" 11127 11128 #: kdecore/TIMEZONES:777 11129 #, kde-format 11130 msgid "Asia/Damascus" 11131 msgstr "এশিয়া/ড্যামাস্কাস" 11132 11133 #: kdecore/TIMEZONES:778 11134 #, kde-format 11135 msgid "Asia/Dhaka" 11136 msgstr "এশিয়া/ঢাকা" 11137 11138 #: kdecore/TIMEZONES:779 11139 #, kde-format 11140 msgid "Asia/Dili" 11141 msgstr "এশিয়া/ডিলি" 11142 11143 #: kdecore/TIMEZONES:780 11144 #, kde-format 11145 msgid "Asia/Dubai" 11146 msgstr "এশিয়া/দুবাই" 11147 11148 #: kdecore/TIMEZONES:781 11149 #, fuzzy, kde-format 11150 #| msgid "Do shanbe" 11151 msgid "Asia/Dushanbe" 11152 msgstr "দো শানবে" 11153 11154 #: kdecore/TIMEZONES:782 11155 #, fuzzy, kde-format 11156 #| msgid "Asia/Damascus" 11157 msgid "Asia/Famagusta" 11158 msgstr "এশিয়া/ড্যামাস্কাস" 11159 11160 #. i18n: comment to the previous timezone 11161 #: kdecore/TIMEZONES:784 11162 #, kde-format 11163 msgid "Northern Cyprus" 11164 msgstr "" 11165 11166 #: kdecore/TIMEZONES:785 11167 #, kde-format 11168 msgid "Asia/Gaza" 11169 msgstr "এশিয়া/গাজা" 11170 11171 #. i18n: comment to the previous timezone 11172 #: kdecore/TIMEZONES:787 11173 #, kde-format 11174 msgid "Gaza Strip" 11175 msgstr "" 11176 11177 #: kdecore/TIMEZONES:788 11178 #, kde-format 11179 msgid "Asia/Harbin" 11180 msgstr "এশিয়া/হার্বিন" 11181 11182 #. i18n: comment to the previous timezone 11183 #: kdecore/TIMEZONES:790 11184 #, kde-format 11185 msgid "Heilongjiang (except Mohe), Jilin" 11186 msgstr "" 11187 11188 #. i18n: comment to the previous timezone 11189 #: kdecore/TIMEZONES:792 11190 #, kde-format 11191 msgid "China north" 11192 msgstr "" 11193 11194 #: kdecore/TIMEZONES:793 11195 #, fuzzy, kde-format 11196 #| msgid "Asia/Harbin" 11197 msgid "Asia/Hebron" 11198 msgstr "এশিয়া/হার্বিন" 11199 11200 #. i18n: comment to the previous timezone 11201 #: kdecore/TIMEZONES:795 11202 #, kde-format 11203 msgid "West Bank" 11204 msgstr "" 11205 11206 #: kdecore/TIMEZONES:796 11207 #, fuzzy, kde-format 11208 msgid "Asia/Ho_Chi_Minh" 11209 msgstr "এশিয়া/চংচিং" 11210 11211 #: kdecore/TIMEZONES:797 11212 #, kde-format 11213 msgid "Asia/Hong_Kong" 11214 msgstr "এশিয়া/হংকং" 11215 11216 #: kdecore/TIMEZONES:798 11217 #, fuzzy, kde-format 11218 msgid "Asia/Hovd" 11219 msgstr "এশিয়া/" 11220 11221 #. i18n: comment to the previous timezone 11222 #: kdecore/TIMEZONES:800 11223 #, kde-format 11224 msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" 11225 msgstr "" 11226 11227 #: kdecore/TIMEZONES:801 11228 #, fuzzy, kde-format 11229 msgid "Asia/Irkutsk" 11230 msgstr "এশিয়া/" 11231 11232 #. i18n: comment to the previous timezone 11233 #: kdecore/TIMEZONES:803 11234 #, kde-format 11235 msgid "Moscow+05 - Lake Baikal" 11236 msgstr "" 11237 11238 #. i18n: comment to the previous timezone 11239 #: kdecore/TIMEZONES:805 11240 #, kde-format 11241 msgid "MSK+05 - Irkutsk, Buryatia" 11242 msgstr "" 11243 11244 #: kdecore/TIMEZONES:806 11245 #, kde-format 11246 msgid "Asia/Jakarta" 11247 msgstr "এশিয়া/জাকার্তা" 11248 11249 #. i18n: comment to the previous timezone 11250 #: kdecore/TIMEZONES:808 11251 #, kde-format 11252 msgid "Java & Sumatra" 11253 msgstr "" 11254 11255 #. i18n: comment to the previous timezone 11256 #: kdecore/TIMEZONES:810 11257 #, kde-format 11258 msgid "Java, Sumatra" 11259 msgstr "" 11260 11261 #: kdecore/TIMEZONES:811 11262 #, kde-format 11263 msgid "Asia/Jayapura" 11264 msgstr "এশিয়া/জয়পুর" 11265 11266 #. i18n: comment to the previous timezone 11267 #: kdecore/TIMEZONES:813 11268 #, kde-format 11269 msgid "Irian Jaya & the Moluccas" 11270 msgstr "" 11271 11272 #. i18n: comment to the previous timezone 11273 #: kdecore/TIMEZONES:815 11274 #, kde-format 11275 msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" 11276 msgstr "" 11277 11278 #. i18n: comment to the previous timezone 11279 #: kdecore/TIMEZONES:817 11280 #, kde-format 11281 msgid "New Guinea (West Papua / Irian Jaya); Malukus/Moluccas" 11282 msgstr "" 11283 11284 #: kdecore/TIMEZONES:818 11285 #, kde-format 11286 msgid "Asia/Jerusalem" 11287 msgstr "এশিয়া/জেরুসলেম" 11288 11289 #: kdecore/TIMEZONES:819 11290 #, kde-format 11291 msgid "Asia/Kabul" 11292 msgstr "এশিয়া/কাবুল" 11293 11294 #: kdecore/TIMEZONES:820 11295 #, kde-format 11296 msgid "Asia/Kamchatka" 11297 msgstr "এশিয়া/কামচাটকা" 11298 11299 #. i18n: comment to the previous timezone 11300 #: kdecore/TIMEZONES:822 11301 #, kde-format 11302 msgid "Moscow+09 - Kamchatka" 11303 msgstr "" 11304 11305 #. i18n: comment to the previous timezone 11306 #: kdecore/TIMEZONES:824 11307 #, kde-format 11308 msgid "Moscow+08 - Kamchatka" 11309 msgstr "" 11310 11311 #. i18n: comment to the previous timezone 11312 #: kdecore/TIMEZONES:826 11313 #, kde-format 11314 msgid "MSK+09 - Kamchatka" 11315 msgstr "" 11316 11317 #: kdecore/TIMEZONES:827 11318 #, kde-format 11319 msgid "Asia/Karachi" 11320 msgstr "এশিয়া/করাচি" 11321 11322 #: kdecore/TIMEZONES:828 11323 #, kde-format 11324 msgid "Asia/Kashgar" 11325 msgstr "এশিয়া/কশগর" 11326 11327 #. i18n: comment to the previous timezone 11328 #: kdecore/TIMEZONES:830 11329 #, kde-format 11330 msgid "west Tibet & Xinjiang" 11331 msgstr "" 11332 11333 #. i18n: comment to the previous timezone 11334 #: kdecore/TIMEZONES:832 11335 #, kde-format 11336 msgid "China west Xinjiang" 11337 msgstr "" 11338 11339 #: kdecore/TIMEZONES:833 11340 #, fuzzy, kde-format 11341 #| msgid "Asia/Katmandu" 11342 msgid "Asia/Kathmandu" 11343 msgstr "এশিয়া/কাঠমাণ্ডু" 11344 11345 #: kdecore/TIMEZONES:834 11346 #, kde-format 11347 msgid "Asia/Katmandu" 11348 msgstr "এশিয়া/কাঠমাণ্ডু" 11349 11350 #: kdecore/TIMEZONES:835 11351 #, fuzzy, kde-format 11352 #| msgid "Asia/Shanghai" 11353 msgid "Asia/Khandyga" 11354 msgstr "এশিয়া/শাংহাই" 11355 11356 #. i18n: comment to the previous timezone 11357 #: kdecore/TIMEZONES:837 11358 #, kde-format 11359 msgid "MSK+06 - Tomponsky, Ust-Maysky" 11360 msgstr "" 11361 11362 #: kdecore/TIMEZONES:838 11363 #, fuzzy, kde-format 11364 msgid "Asia/Kolkata" 11365 msgstr "এশিয়া/জাকার্তা" 11366 11367 #: kdecore/TIMEZONES:839 11368 #, kde-format 11369 msgid "Asia/Krasnoyarsk" 11370 msgstr "এশিয়া/ক্রাসনোইয়ার্স্ক" 11371 11372 #. i18n: comment to the previous timezone 11373 #: kdecore/TIMEZONES:841 11374 #, kde-format 11375 msgid "Moscow+04 - Yenisei River" 11376 msgstr "" 11377 11378 #. i18n: comment to the previous timezone 11379 #: kdecore/TIMEZONES:843 11380 #, kde-format 11381 msgid "MSK+04 - Krasnoyarsk area" 11382 msgstr "" 11383 11384 #: kdecore/TIMEZONES:844 11385 #, kde-format 11386 msgid "Asia/Kuala_Lumpur" 11387 msgstr "এশিয়া/কুয়ালা_লামপুর" 11388 11389 #. i18n: comment to the previous timezone 11390 #: kdecore/TIMEZONES:846 11391 #, kde-format 11392 msgid "peninsular Malaysia" 11393 msgstr "" 11394 11395 #. i18n: comment to the previous timezone 11396 #: kdecore/TIMEZONES:848 11397 #, kde-format 11398 msgid "Malaysia (peninsula)" 11399 msgstr "" 11400 11401 #: kdecore/TIMEZONES:849 11402 #, kde-format 11403 msgid "Asia/Kuching" 11404 msgstr "এশিয়া/কুইচিং" 11405 11406 #. i18n: comment to the previous timezone 11407 #: kdecore/TIMEZONES:851 11408 #, kde-format 11409 msgid "Sabah & Sarawak" 11410 msgstr "" 11411 11412 #. i18n: comment to the previous timezone 11413 #: kdecore/TIMEZONES:853 11414 #, kde-format 11415 msgid "Sabah, Sarawak" 11416 msgstr "" 11417 11418 #: kdecore/TIMEZONES:854 11419 #, kde-format 11420 msgid "Asia/Kuwait" 11421 msgstr "এশিয়া/কুয়েত" 11422 11423 #: kdecore/TIMEZONES:855 11424 #, fuzzy, kde-format 11425 msgid "Asia/Macao" 11426 msgstr "এশিয়া/মাকাউ" 11427 11428 #: kdecore/TIMEZONES:856 11429 #, kde-format 11430 msgid "Asia/Macau" 11431 msgstr "এশিয়া/মাকাউ" 11432 11433 #: kdecore/TIMEZONES:857 11434 #, kde-format 11435 msgid "Asia/Magadan" 11436 msgstr "এশিয়া/মাগাদান" 11437 11438 #. i18n: comment to the previous timezone 11439 #: kdecore/TIMEZONES:859 11440 #, kde-format 11441 msgid "Moscow+08 - Magadan" 11442 msgstr "" 11443 11444 #. i18n: comment to the previous timezone 11445 #: kdecore/TIMEZONES:861 11446 #, kde-format 11447 msgid "MSK+08 - Magadan" 11448 msgstr "" 11449 11450 #: kdecore/TIMEZONES:862 11451 #, fuzzy, kde-format 11452 msgid "Asia/Makassar" 11453 msgstr "এশিয়া/মাগাদান" 11454 11455 #. i18n: comment to the previous timezone 11456 #: kdecore/TIMEZONES:864 kdecore/TIMEZONES:950 11457 #, kde-format 11458 msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" 11459 msgstr "" 11460 11461 #. i18n: comment to the previous timezone 11462 #: kdecore/TIMEZONES:866 11463 #, kde-format 11464 msgid "" 11465 "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" 11466 msgstr "" 11467 11468 #. i18n: comment to the previous timezone 11469 #: kdecore/TIMEZONES:868 11470 #, kde-format 11471 msgid "" 11472 "Borneo (east, south); Sulawesi/Celebes, Bali, Nusa Tengarra; Timor (west)" 11473 msgstr "" 11474 11475 #: kdecore/TIMEZONES:869 11476 #, kde-format 11477 msgid "Asia/Manila" 11478 msgstr "এশিয়া/ম্যানিলা" 11479 11480 #: kdecore/TIMEZONES:870 11481 #, kde-format 11482 msgid "Asia/Muscat" 11483 msgstr "এশিয়া/মাস্কাট" 11484 11485 #: kdecore/TIMEZONES:871 11486 #, kde-format 11487 msgid "Asia/Nicosia" 11488 msgstr "এশিয়া/নিকোসিয়া" 11489 11490 #. i18n: comment to the previous timezone 11491 #: kdecore/TIMEZONES:873 11492 #, kde-format 11493 msgid "Cyprus (most areas)" 11494 msgstr "" 11495 11496 #: kdecore/TIMEZONES:874 11497 #, fuzzy, kde-format 11498 msgid "Asia/Novokuznetsk" 11499 msgstr "এশিয়া/" 11500 11501 #. i18n: comment to the previous timezone 11502 #: kdecore/TIMEZONES:876 11503 #, fuzzy, kde-format 11504 msgid "Moscow+03 - Novokuznetsk" 11505 msgstr "এশিয়া/নভোসিবির্স্ক" 11506 11507 #. i18n: comment to the previous timezone 11508 #: kdecore/TIMEZONES:878 11509 #, kde-format 11510 msgid "MSK+04 - Kemerovo" 11511 msgstr "" 11512 11513 #: kdecore/TIMEZONES:879 11514 #, kde-format 11515 msgid "Asia/Novosibirsk" 11516 msgstr "এশিয়া/নভোসিবির্স্ক" 11517 11518 #. i18n: comment to the previous timezone 11519 #: kdecore/TIMEZONES:881 11520 #, fuzzy, kde-format 11521 msgid "Moscow+03 - Novosibirsk" 11522 msgstr "এশিয়া/নভোসিবির্স্ক" 11523 11524 #. i18n: comment to the previous timezone 11525 #: kdecore/TIMEZONES:883 11526 #, fuzzy, kde-format 11527 msgid "MSK+04 - Novosibirsk" 11528 msgstr "এশিয়া/নভোসিবির্স্ক" 11529 11530 #: kdecore/TIMEZONES:884 11531 #, fuzzy, kde-format 11532 msgid "Asia/Omsk" 11533 msgstr "এশিয়া/" 11534 11535 #. i18n: comment to the previous timezone 11536 #: kdecore/TIMEZONES:886 11537 #, kde-format 11538 msgid "Moscow+03 - west Siberia" 11539 msgstr "" 11540 11541 #. i18n: comment to the previous timezone 11542 #: kdecore/TIMEZONES:888 11543 #, kde-format 11544 msgid "MSK+03 - Omsk" 11545 msgstr "" 11546 11547 #: kdecore/TIMEZONES:889 11548 #, kde-format 11549 msgid "Asia/Oral" 11550 msgstr "এশিয়া/ওরাল" 11551 11552 #. i18n: comment to the previous timezone 11553 #: kdecore/TIMEZONES:891 11554 #, kde-format 11555 msgid "West Kazakhstan" 11556 msgstr "" 11557 11558 #: kdecore/TIMEZONES:892 11559 #, kde-format 11560 msgid "Asia/Phnom_Penh" 11561 msgstr "এশিয়া/নম_পেন" 11562 11563 #: kdecore/TIMEZONES:893 11564 #, kde-format 11565 msgid "Asia/Pontianak" 11566 msgstr "এশিয়া/পন্টিয়ানাক" 11567 11568 #. i18n: comment to the previous timezone 11569 #: kdecore/TIMEZONES:895 11570 #, kde-format 11571 msgid "west & central Borneo" 11572 msgstr "" 11573 11574 #. i18n: comment to the previous timezone 11575 #: kdecore/TIMEZONES:897 11576 #, kde-format 11577 msgid "Borneo (west, central)" 11578 msgstr "" 11579 11580 #: kdecore/TIMEZONES:898 11581 #, kde-format 11582 msgid "Asia/Pyongyang" 11583 msgstr "এশিয়া/পিয়ংইয়াং" 11584 11585 #: kdecore/TIMEZONES:899 11586 #, kde-format 11587 msgid "Asia/Qatar" 11588 msgstr "এশিয়া/কাতার" 11589 11590 #: kdecore/TIMEZONES:900 11591 #, fuzzy, kde-format 11592 #| msgid "Asia/Pontianak" 11593 msgid "Asia/Qostanay" 11594 msgstr "এশিয়া/পন্টিয়ানাক" 11595 11596 #. i18n: comment to the previous timezone 11597 #: kdecore/TIMEZONES:902 11598 #, kde-format 11599 msgid "Qostanay/Kostanay/Kustanay" 11600 msgstr "" 11601 11602 #: kdecore/TIMEZONES:903 11603 #, fuzzy, kde-format 11604 msgid "Asia/Qyzylorda" 11605 msgstr "এশিয়া/" 11606 11607 #. i18n: comment to the previous timezone 11608 #: kdecore/TIMEZONES:905 11609 #, kde-format 11610 msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" 11611 msgstr "" 11612 11613 #. i18n: comment to the previous timezone 11614 #: kdecore/TIMEZONES:907 11615 #, kde-format 11616 msgid "Qyzylorda/Kyzylorda/Kzyl-Orda" 11617 msgstr "" 11618 11619 #: kdecore/TIMEZONES:908 11620 #, kde-format 11621 msgid "Asia/Rangoon" 11622 msgstr "এশিয়া/রেঙ্গুন" 11623 11624 #: kdecore/TIMEZONES:909 11625 #, kde-format 11626 msgid "Asia/Riyadh" 11627 msgstr "এশিয়া/রিয়াধ" 11628 11629 #: kdecore/TIMEZONES:910 11630 #, kde-format 11631 msgid "Asia/Saigon" 11632 msgstr "এশিয়া/সাইগন" 11633 11634 #: kdecore/TIMEZONES:911 11635 #, kde-format 11636 msgid "Asia/Sakhalin" 11637 msgstr "এশিয়া/সাখালিন" 11638 11639 #. i18n: comment to the previous timezone 11640 #: kdecore/TIMEZONES:913 11641 #, kde-format 11642 msgid "Moscow+07 - Sakhalin Island" 11643 msgstr "" 11644 11645 #. i18n: comment to the previous timezone 11646 #: kdecore/TIMEZONES:915 11647 #, kde-format 11648 msgid "MSK+08 - Sakhalin Island" 11649 msgstr "" 11650 11651 #: kdecore/TIMEZONES:916 11652 #, kde-format 11653 msgid "Asia/Samarkand" 11654 msgstr "এশিয়া/সমরখন্দ" 11655 11656 #. i18n: comment to the previous timezone 11657 #: kdecore/TIMEZONES:918 11658 #, kde-format 11659 msgid "west Uzbekistan" 11660 msgstr "" 11661 11662 #. i18n: comment to the previous timezone 11663 #: kdecore/TIMEZONES:920 11664 #, kde-format 11665 msgid "Uzbekistan (west)" 11666 msgstr "" 11667 11668 #: kdecore/TIMEZONES:921 11669 #, kde-format 11670 msgid "Asia/Seoul" 11671 msgstr "এশিয়া/সিওল" 11672 11673 #: kdecore/TIMEZONES:922 11674 #, kde-format 11675 msgid "Asia/Shanghai" 11676 msgstr "এশিয়া/শাংহাই" 11677 11678 #. i18n: comment to the previous timezone 11679 #: kdecore/TIMEZONES:926 11680 #, kde-format 11681 msgid "China east" 11682 msgstr "" 11683 11684 #. i18n: comment to the previous timezone 11685 #: kdecore/TIMEZONES:928 11686 #, kde-format 11687 msgid "Beijing Time" 11688 msgstr "" 11689 11690 #: kdecore/TIMEZONES:929 11691 #, kde-format 11692 msgid "Asia/Singapore" 11693 msgstr "এশিয়া/সিঙ্গাপুর" 11694 11695 #: kdecore/TIMEZONES:930 11696 #, fuzzy, kde-format 11697 #| msgid "Asia/Krasnoyarsk" 11698 msgid "Asia/Srednekolymsk" 11699 msgstr "এশিয়া/ক্রাসনোইয়ার্স্ক" 11700 11701 #. i18n: comment to the previous timezone 11702 #: kdecore/TIMEZONES:932 11703 #, kde-format 11704 msgid "MSK+08 - Sakha (E); North Kuril Is" 11705 msgstr "" 11706 11707 #: kdecore/TIMEZONES:933 11708 #, kde-format 11709 msgid "Asia/Taipei" 11710 msgstr "এশিয়া/তাইপেই" 11711 11712 #: kdecore/TIMEZONES:934 11713 #, kde-format 11714 msgid "Asia/Tashkent" 11715 msgstr "এশিয়া/তাশকেন্ত" 11716 11717 #. i18n: comment to the previous timezone 11718 #: kdecore/TIMEZONES:936 11719 #, kde-format 11720 msgid "east Uzbekistan" 11721 msgstr "" 11722 11723 #. i18n: comment to the previous timezone 11724 #: kdecore/TIMEZONES:938 11725 #, kde-format 11726 msgid "Uzbekistan (east)" 11727 msgstr "" 11728 11729 #: kdecore/TIMEZONES:939 11730 #, kde-format 11731 msgid "Asia/Tbilisi" 11732 msgstr "এশিয়া/টিবলিসি" 11733 11734 #: kdecore/TIMEZONES:940 11735 #, kde-format 11736 msgid "Asia/Tehran" 11737 msgstr "এশিয়া/তেহরান" 11738 11739 #: kdecore/TIMEZONES:941 11740 #, fuzzy, kde-format 11741 msgid "Asia/Tel_Aviv" 11742 msgstr "এশিয়া/তাইপেই" 11743 11744 #: kdecore/TIMEZONES:942 11745 #, fuzzy, kde-format 11746 msgid "Asia/Thimbu" 11747 msgstr "এশিয়া/থিম্পু" 11748 11749 #: kdecore/TIMEZONES:943 11750 #, kde-format 11751 msgid "Asia/Thimphu" 11752 msgstr "এশিয়া/থিম্পু" 11753 11754 #: kdecore/TIMEZONES:944 11755 #, kde-format 11756 msgid "Asia/Tokyo" 11757 msgstr "এশিয়া/টোকিও" 11758 11759 #: kdecore/TIMEZONES:945 11760 #, fuzzy, kde-format 11761 msgid "Asia/Tomsk" 11762 msgstr "এশিয়া/" 11763 11764 #. i18n: comment to the previous timezone 11765 #: kdecore/TIMEZONES:947 11766 #, kde-format 11767 msgid "MSK+04 - Tomsk" 11768 msgstr "" 11769 11770 #: kdecore/TIMEZONES:948 11771 #, kde-format 11772 msgid "Asia/Ujung_Pandang" 11773 msgstr "এশিয়া/উজুং_পান্ডাং" 11774 11775 #: kdecore/TIMEZONES:951 11776 #, kde-format 11777 msgid "Asia/Ulaanbaatar" 11778 msgstr "এশিয়া/উলানবাটার" 11779 11780 #. i18n: comment to the previous timezone 11781 #: kdecore/TIMEZONES:955 11782 #, kde-format 11783 msgid "Mongolia (most areas)" 11784 msgstr "" 11785 11786 #: kdecore/TIMEZONES:956 11787 #, fuzzy, kde-format 11788 msgid "Asia/Ulan_Bator" 11789 msgstr "এশিয়া/উলানবাটার" 11790 11791 #: kdecore/TIMEZONES:959 11792 #, kde-format 11793 msgid "Asia/Urumqi" 11794 msgstr "এশিয়া/উরুমচি" 11795 11796 #. i18n: comment to the previous timezone 11797 #: kdecore/TIMEZONES:961 11798 #, kde-format 11799 msgid "most of Tibet & Xinjiang" 11800 msgstr "" 11801 11802 #. i18n: comment to the previous timezone 11803 #: kdecore/TIMEZONES:963 11804 #, kde-format 11805 msgid "China Xinjiang-Tibet" 11806 msgstr "" 11807 11808 #. i18n: comment to the previous timezone 11809 #: kdecore/TIMEZONES:965 11810 #, kde-format 11811 msgid "Xinjiang Time" 11812 msgstr "" 11813 11814 #: kdecore/TIMEZONES:966 11815 #, fuzzy, kde-format 11816 #| msgid "Asia/Tehran" 11817 msgid "Asia/Ust-Nera" 11818 msgstr "এশিয়া/তেহরান" 11819 11820 #. i18n: comment to the previous timezone 11821 #: kdecore/TIMEZONES:968 11822 #, kde-format 11823 msgid "MSK+07 - Oymyakonsky" 11824 msgstr "" 11825 11826 #: kdecore/TIMEZONES:969 11827 #, fuzzy, kde-format 11828 msgid "Asia/Vientiane" 11829 msgstr "এশিয়া/" 11830 11831 #: kdecore/TIMEZONES:970 11832 #, kde-format 11833 msgid "Asia/Vladivostok" 11834 msgstr "এশিয়া/ভ্লাদিভোস্তক" 11835 11836 #. i18n: comment to the previous timezone 11837 #: kdecore/TIMEZONES:972 11838 #, kde-format 11839 msgid "Moscow+07 - Amur River" 11840 msgstr "" 11841 11842 #. i18n: comment to the previous timezone 11843 #: kdecore/TIMEZONES:974 11844 #, kde-format 11845 msgid "MSK+07 - Amur River" 11846 msgstr "" 11847 11848 #: kdecore/TIMEZONES:975 11849 #, fuzzy, kde-format 11850 msgid "Asia/Yakutsk" 11851 msgstr "এশিয়া/" 11852 11853 #. i18n: comment to the previous timezone 11854 #: kdecore/TIMEZONES:977 11855 #, kde-format 11856 msgid "Moscow+06 - Lena River" 11857 msgstr "" 11858 11859 #. i18n: comment to the previous timezone 11860 #: kdecore/TIMEZONES:979 11861 #, kde-format 11862 msgid "MSK+06 - Lena River" 11863 msgstr "" 11864 11865 #: kdecore/TIMEZONES:980 11866 #, fuzzy, kde-format 11867 #| msgid "Asia/Rangoon" 11868 msgid "Asia/Yangon" 11869 msgstr "এশিয়া/রেঙ্গুন" 11870 11871 #: kdecore/TIMEZONES:981 11872 #, kde-format 11873 msgid "Asia/Yekaterinburg" 11874 msgstr "এশিয়া/ইকেঠারিনবেরগ" 11875 11876 #. i18n: comment to the previous timezone 11877 #: kdecore/TIMEZONES:983 11878 #, kde-format 11879 msgid "Moscow+02 - Urals" 11880 msgstr "" 11881 11882 #. i18n: comment to the previous timezone 11883 #: kdecore/TIMEZONES:985 11884 #, kde-format 11885 msgid "MSK+02 - Urals" 11886 msgstr "" 11887 11888 #: kdecore/TIMEZONES:986 11889 #, kde-format 11890 msgid "Asia/Yerevan" 11891 msgstr "এশিয়া/য়েরেভান" 11892 11893 #: kdecore/TIMEZONES:987 11894 #, kde-format 11895 msgid "Atlantic/Azores" 11896 msgstr "অ্যাটলান্টিক/অ্যাজোরেস" 11897 11898 #. i18n: comment to the previous timezone 11899 #: kdecore/TIMEZONES:989 11900 #, kde-format 11901 msgid "Azores" 11902 msgstr "" 11903 11904 #: kdecore/TIMEZONES:990 11905 #, kde-format 11906 msgid "Atlantic/Bermuda" 11907 msgstr "অ্যাটলান্টিক/বার্মুডা" 11908 11909 #: kdecore/TIMEZONES:991 11910 #, kde-format 11911 msgid "Atlantic/Canary" 11912 msgstr "অ্যাটলান্টিক/ক্যানারি" 11913 11914 #. i18n: comment to the previous timezone 11915 #: kdecore/TIMEZONES:993 11916 #, kde-format 11917 msgid "Canary Islands" 11918 msgstr "" 11919 11920 #: kdecore/TIMEZONES:994 11921 #, kde-format 11922 msgid "Atlantic/Cape_Verde" 11923 msgstr "অ্যাটলান্টিক/কেপ_ভার্ডি" 11924 11925 #: kdecore/TIMEZONES:995 11926 #, kde-format 11927 msgid "Atlantic/Faeroe" 11928 msgstr "অ্যাটলান্টিক/ফেরো" 11929 11930 #: kdecore/TIMEZONES:996 11931 #, fuzzy, kde-format 11932 msgid "Atlantic/Faroe" 11933 msgstr "অ্যাটলান্টিক/ফেরো" 11934 11935 #: kdecore/TIMEZONES:997 11936 #, fuzzy, kde-format 11937 msgid "Atlantic/Jan_Mayen" 11938 msgstr "অ্যাটলান্টিক/" 11939 11940 #: kdecore/TIMEZONES:998 11941 #, kde-format 11942 msgid "Atlantic/Madeira" 11943 msgstr "অ্যাটলান্টিক/মদিরা" 11944 11945 #. i18n: comment to the previous timezone 11946 #: kdecore/TIMEZONES:1000 11947 #, kde-format 11948 msgid "Madeira Islands" 11949 msgstr "" 11950 11951 #: kdecore/TIMEZONES:1001 11952 #, kde-format 11953 msgid "Atlantic/Reykjavik" 11954 msgstr "অ্যাটলান্টিক/রেইকজাভিক" 11955 11956 #: kdecore/TIMEZONES:1002 11957 #, kde-format 11958 msgid "Atlantic/South_Georgia" 11959 msgstr "অ্যাটলান্টিক/দক্ষিণ_জর্জিয়া" 11960 11961 #: kdecore/TIMEZONES:1003 11962 #, kde-format 11963 msgid "Atlantic/St_Helena" 11964 msgstr "অ্যাটলান্টিক/সেন্ট_হেলেনা" 11965 11966 #: kdecore/TIMEZONES:1004 11967 #, kde-format 11968 msgid "Atlantic/Stanley" 11969 msgstr "অ্যাটলান্টিক/স্ট্যানলি" 11970 11971 #: kdecore/TIMEZONES:1005 11972 #, fuzzy, kde-format 11973 msgid "Australia/ACT" 11974 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 11975 11976 #. i18n: comment to the previous timezone 11977 #: kdecore/TIMEZONES:1007 kdecore/TIMEZONES:1023 kdecore/TIMEZONES:1056 11978 #: kdecore/TIMEZONES:1073 11979 #, kde-format 11980 msgid "New South Wales - most locations" 11981 msgstr "" 11982 11983 #: kdecore/TIMEZONES:1008 11984 #, kde-format 11985 msgid "Australia/Adelaide" 11986 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 11987 11988 #. i18n: comment to the previous timezone 11989 #: kdecore/TIMEZONES:1010 kdecore/TIMEZONES:1070 11990 #, fuzzy, kde-format 11991 msgid "South Australia" 11992 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 11993 11994 #: kdecore/TIMEZONES:1011 11995 #, kde-format 11996 msgid "Australia/Brisbane" 11997 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 11998 11999 #. i18n: comment to the previous timezone 12000 #: kdecore/TIMEZONES:1013 kdecore/TIMEZONES:1067 12001 #, kde-format 12002 msgid "Queensland - most locations" 12003 msgstr "" 12004 12005 #. i18n: comment to the previous timezone 12006 #: kdecore/TIMEZONES:1015 12007 #, kde-format 12008 msgid "Queensland (most areas)" 12009 msgstr "" 12010 12011 #: kdecore/TIMEZONES:1016 12012 #, kde-format 12013 msgid "Australia/Broken_Hill" 12014 msgstr "অস্ট্রেলিয়া/ব্রোকেন_হিল" 12015 12016 #. i18n: comment to the previous timezone 12017 #: kdecore/TIMEZONES:1018 kdecore/TIMEZONES:1087 12018 #, kde-format 12019 msgid "New South Wales - Yancowinna" 12020 msgstr "" 12021 12022 #. i18n: comment to the previous timezone 12023 #: kdecore/TIMEZONES:1020 12024 #, kde-format 12025 msgid "New South Wales (Yancowinna)" 12026 msgstr "" 12027 12028 #: kdecore/TIMEZONES:1021 12029 #, fuzzy, kde-format 12030 msgid "Australia/Canberra" 12031 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 12032 12033 #: kdecore/TIMEZONES:1024 12034 #, fuzzy, kde-format 12035 msgid "Australia/Currie" 12036 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 12037 12038 #. i18n: comment to the previous timezone 12039 #: kdecore/TIMEZONES:1026 12040 #, kde-format 12041 msgid "Tasmania - King Island" 12042 msgstr "" 12043 12044 #: kdecore/TIMEZONES:1027 12045 #, kde-format 12046 msgid "Australia/Darwin" 12047 msgstr "অস্ট্রেলিয়া/ডারউইন" 12048 12049 #. i18n: comment to the previous timezone 12050 #: kdecore/TIMEZONES:1029 kdecore/TIMEZONES:1059 12051 #, kde-format 12052 msgid "Northern Territory" 12053 msgstr "" 12054 12055 #: kdecore/TIMEZONES:1030 12056 #, fuzzy, kde-format 12057 msgid "Australia/Eucla" 12058 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12059 12060 #. i18n: comment to the previous timezone 12061 #: kdecore/TIMEZONES:1032 12062 #, fuzzy, kde-format 12063 msgid "Western Australia - Eucla area" 12064 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12065 12066 #. i18n: comment to the previous timezone 12067 #: kdecore/TIMEZONES:1034 12068 #, fuzzy, kde-format 12069 msgid "Western Australia (Eucla)" 12070 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12071 12072 #: kdecore/TIMEZONES:1035 12073 #, kde-format 12074 msgid "Australia/Hobart" 12075 msgstr "অস্ট্রেলিয়া/হোবার্ট" 12076 12077 #. i18n: comment to the previous timezone 12078 #: kdecore/TIMEZONES:1037 kdecore/TIMEZONES:1078 12079 #, kde-format 12080 msgid "Tasmania - most locations" 12081 msgstr "" 12082 12083 #. i18n: comment to the previous timezone 12084 #: kdecore/TIMEZONES:1039 12085 #, fuzzy, kde-format 12086 msgid "Tasmania" 12087 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 12088 12089 #: kdecore/TIMEZONES:1040 12090 #, fuzzy, kde-format 12091 msgid "Australia/LHI" 12092 msgstr "অস্ট্রেলিয়া/হোবার্ট" 12093 12094 #. i18n: comment to the previous timezone 12095 #: kdecore/TIMEZONES:1042 kdecore/TIMEZONES:1050 12096 #, kde-format 12097 msgid "Lord Howe Island" 12098 msgstr "" 12099 12100 #: kdecore/TIMEZONES:1043 12101 #, kde-format 12102 msgid "Australia/Lindeman" 12103 msgstr "অস্ট্রেলিয়া/লিন্ডারম্যান" 12104 12105 #. i18n: comment to the previous timezone 12106 #: kdecore/TIMEZONES:1045 12107 #, kde-format 12108 msgid "Queensland - Holiday Islands" 12109 msgstr "" 12110 12111 #. i18n: comment to the previous timezone 12112 #: kdecore/TIMEZONES:1047 12113 #, kde-format 12114 msgid "Queensland (Whitsunday Islands)" 12115 msgstr "" 12116 12117 #: kdecore/TIMEZONES:1048 12118 #, kde-format 12119 msgid "Australia/Lord_Howe" 12120 msgstr "অস্ট্রেলিয়া/লর্ড_হাওই" 12121 12122 #: kdecore/TIMEZONES:1051 12123 #, kde-format 12124 msgid "Australia/Melbourne" 12125 msgstr "অস্ট্রেলিয়া/মেলবোর্ন" 12126 12127 #. i18n: comment to the previous timezone 12128 #: kdecore/TIMEZONES:1053 kdecore/TIMEZONES:1081 12129 #, kde-format 12130 msgid "Victoria" 12131 msgstr "" 12132 12133 #: kdecore/TIMEZONES:1054 12134 #, fuzzy, kde-format 12135 msgid "Australia/NSW" 12136 msgstr "অস্ট্রেলিয়া/সিডনি" 12137 12138 #: kdecore/TIMEZONES:1057 12139 #, fuzzy, kde-format 12140 msgid "Australia/North" 12141 msgstr "অস্ট্রেলিয়া/পার্থ" 12142 12143 #: kdecore/TIMEZONES:1060 12144 #, kde-format 12145 msgid "Australia/Perth" 12146 msgstr "অস্ট্রেলিয়া/পার্থ" 12147 12148 #. i18n: comment to the previous timezone 12149 #: kdecore/TIMEZONES:1062 kdecore/TIMEZONES:1084 12150 #, kde-format 12151 msgid "Western Australia - most locations" 12152 msgstr "" 12153 12154 #. i18n: comment to the previous timezone 12155 #: kdecore/TIMEZONES:1064 12156 #, fuzzy, kde-format 12157 msgid "Western Australia (most areas)" 12158 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12159 12160 #: kdecore/TIMEZONES:1065 12161 #, fuzzy, kde-format 12162 msgid "Australia/Queensland" 12163 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12164 12165 #: kdecore/TIMEZONES:1068 12166 #, fuzzy, kde-format 12167 msgid "Australia/South" 12168 msgstr "অস্ট্রেলিয়া/পার্থ" 12169 12170 #: kdecore/TIMEZONES:1071 12171 #, kde-format 12172 msgid "Australia/Sydney" 12173 msgstr "অস্ট্রেলিয়া/সিডনি" 12174 12175 #. i18n: comment to the previous timezone 12176 #: kdecore/TIMEZONES:1075 12177 #, kde-format 12178 msgid "New South Wales (most areas)" 12179 msgstr "" 12180 12181 #: kdecore/TIMEZONES:1076 12182 #, fuzzy, kde-format 12183 msgid "Australia/Tasmania" 12184 msgstr "অস্ট্রেলিয়া/ব্রিসবেন" 12185 12186 #: kdecore/TIMEZONES:1079 12187 #, fuzzy, kde-format 12188 msgid "Australia/Victoria" 12189 msgstr "অস্ট্রেলিয়া/অ্যাডিলেড" 12190 12191 #: kdecore/TIMEZONES:1082 12192 #, fuzzy, kde-format 12193 msgid "Australia/West" 12194 msgstr "অস্ট্রেলিয়া/পার্থ" 12195 12196 #: kdecore/TIMEZONES:1085 12197 #, fuzzy, kde-format 12198 msgid "Australia/Yancowinna" 12199 msgstr "অস্ট্রেলিয়া/ডারউইন" 12200 12201 #: kdecore/TIMEZONES:1088 12202 #, kde-format 12203 msgid "Brazil/Acre" 12204 msgstr "" 12205 12206 #: kdecore/TIMEZONES:1091 12207 #, fuzzy, kde-format 12208 msgid "Brazil/DeNoronha" 12209 msgstr "আমেরিকা/নোরোনহা" 12210 12211 #: kdecore/TIMEZONES:1094 12212 #, kde-format 12213 msgid "Brazil/East" 12214 msgstr "" 12215 12216 #: kdecore/TIMEZONES:1097 12217 #, kde-format 12218 msgid "Brazil/West" 12219 msgstr "" 12220 12221 #: kdecore/TIMEZONES:1100 12222 #, kde-format 12223 msgid "Canada/Atlantic" 12224 msgstr "" 12225 12226 #: kdecore/TIMEZONES:1103 12227 #, kde-format 12228 msgid "Canada/Central" 12229 msgstr "" 12230 12231 #: kdecore/TIMEZONES:1106 12232 #, kde-format 12233 msgid "Canada/East-Saskatchewan" 12234 msgstr "" 12235 12236 #: kdecore/TIMEZONES:1109 12237 #, kde-format 12238 msgid "Canada/Eastern" 12239 msgstr "" 12240 12241 #: kdecore/TIMEZONES:1112 12242 #, kde-format 12243 msgid "Canada/Mountain" 12244 msgstr "" 12245 12246 #: kdecore/TIMEZONES:1115 12247 #, kde-format 12248 msgid "Canada/Newfoundland" 12249 msgstr "" 12250 12251 #: kdecore/TIMEZONES:1118 12252 #, kde-format 12253 msgid "Canada/Pacific" 12254 msgstr "" 12255 12256 #: kdecore/TIMEZONES:1121 12257 #, kde-format 12258 msgid "Canada/Saskatchewan" 12259 msgstr "" 12260 12261 #: kdecore/TIMEZONES:1124 12262 #, kde-format 12263 msgid "Canada/Yukon" 12264 msgstr "" 12265 12266 #: kdecore/TIMEZONES:1127 12267 #, kde-format 12268 msgid "Chile/Continental" 12269 msgstr "" 12270 12271 #: kdecore/TIMEZONES:1130 12272 #, kde-format 12273 msgid "Chile/EasterIsland" 12274 msgstr "" 12275 12276 #. i18n: comment to the previous timezone 12277 #: kdecore/TIMEZONES:1132 kdecore/TIMEZONES:1315 12278 #, kde-format 12279 msgid "Easter Island & Sala y Gomez" 12280 msgstr "" 12281 12282 #: kdecore/TIMEZONES:1133 12283 #, kde-format 12284 msgid "Cuba" 12285 msgstr "" 12286 12287 #: kdecore/TIMEZONES:1134 12288 #, kde-format 12289 msgid "Egypt" 12290 msgstr "" 12291 12292 #: kdecore/TIMEZONES:1135 12293 #, kde-format 12294 msgid "Eire" 12295 msgstr "" 12296 12297 #: kdecore/TIMEZONES:1136 12298 #, kde-format 12299 msgid "Europe/Amsterdam" 12300 msgstr "ইউরোপ/আমস্টারড্যাম" 12301 12302 #: kdecore/TIMEZONES:1137 12303 #, kde-format 12304 msgid "Europe/Andorra" 12305 msgstr "ইউরোপ/অ্যাণ্ডোরা" 12306 12307 #: kdecore/TIMEZONES:1138 12308 #, fuzzy, kde-format 12309 #| msgid "Europe/Athens" 12310 msgid "Europe/Astrakhan" 12311 msgstr "ইউরোপ/এথেন্স" 12312 12313 #. i18n: comment to the previous timezone 12314 #: kdecore/TIMEZONES:1140 12315 #, kde-format 12316 msgid "MSK+01 - Astrakhan" 12317 msgstr "" 12318 12319 #: kdecore/TIMEZONES:1141 12320 #, kde-format 12321 msgid "Europe/Athens" 12322 msgstr "ইউরোপ/এথেন্স" 12323 12324 #: kdecore/TIMEZONES:1142 12325 #, kde-format 12326 msgid "Europe/Belfast" 12327 msgstr "ইউরোপ/বেলফাস্ট" 12328 12329 #: kdecore/TIMEZONES:1143 12330 #, kde-format 12331 msgid "Europe/Belgrade" 12332 msgstr "ইউরোপ/বেলগ্রেড" 12333 12334 #: kdecore/TIMEZONES:1144 12335 #, kde-format 12336 msgid "Europe/Berlin" 12337 msgstr "ইউরোপ/বার্লিন" 12338 12339 #. i18n: comment to the previous timezone 12340 #: kdecore/TIMEZONES:1146 12341 #, kde-format 12342 msgid "Germany (most areas)" 12343 msgstr "" 12344 12345 #: kdecore/TIMEZONES:1147 12346 #, kde-format 12347 msgid "Europe/Bratislava" 12348 msgstr "ইউরোপ/ব্রাতিস্লাভা" 12349 12350 #: kdecore/TIMEZONES:1148 12351 #, kde-format 12352 msgid "Europe/Brussels" 12353 msgstr "ইউরোপ/ব্রাসেল্স" 12354 12355 #: kdecore/TIMEZONES:1149 12356 #, kde-format 12357 msgid "Europe/Bucharest" 12358 msgstr "ইউরোপ/বুকারেস্ট" 12359 12360 #: kdecore/TIMEZONES:1150 12361 #, kde-format 12362 msgid "Europe/Budapest" 12363 msgstr "ইউরোপ/বুদাপেস্ট" 12364 12365 #: kdecore/TIMEZONES:1151 12366 #, fuzzy, kde-format 12367 #| msgid "Europe/Brussels" 12368 msgid "Europe/Busingen" 12369 msgstr "ইউরোপ/ব্রাসেল্স" 12370 12371 #. i18n: comment to the previous timezone 12372 #: kdecore/TIMEZONES:1153 12373 #, kde-format 12374 msgid "Busingen" 12375 msgstr "" 12376 12377 #: kdecore/TIMEZONES:1154 12378 #, kde-format 12379 msgid "Europe/Chisinau" 12380 msgstr "ইউরোপ/চিসিনাউ" 12381 12382 #: kdecore/TIMEZONES:1155 12383 #, kde-format 12384 msgid "Europe/Copenhagen" 12385 msgstr "ইউরোপ/কোপেনহাগেন" 12386 12387 #: kdecore/TIMEZONES:1156 12388 #, kde-format 12389 msgid "Europe/Dublin" 12390 msgstr "ইউরোপ/ডাবলিন" 12391 12392 #: kdecore/TIMEZONES:1157 12393 #, kde-format 12394 msgid "Europe/Gibraltar" 12395 msgstr "ইউরোপ/জিব্রল্টার" 12396 12397 #: kdecore/TIMEZONES:1158 12398 #, fuzzy, kde-format 12399 msgid "Europe/Guernsey" 12400 msgstr "ইউরোপ/এথেন্স" 12401 12402 #: kdecore/TIMEZONES:1159 12403 #, kde-format 12404 msgid "Europe/Helsinki" 12405 msgstr "ইউরোপ/হেলসিঙ্কি" 12406 12407 #: kdecore/TIMEZONES:1160 12408 #, fuzzy, kde-format 12409 msgid "Europe/Isle_of_Man" 12410 msgstr "ইউরোপ/অসলো" 12411 12412 #: kdecore/TIMEZONES:1161 12413 #, kde-format 12414 msgid "Europe/Istanbul" 12415 msgstr "ইউরোপ/ইস্তানবুল" 12416 12417 #: kdecore/TIMEZONES:1162 12418 #, fuzzy, kde-format 12419 msgid "Europe/Jersey" 12420 msgstr "ইউরোপ/প্যারিস" 12421 12422 #: kdecore/TIMEZONES:1163 12423 #, kde-format 12424 msgid "Europe/Kaliningrad" 12425 msgstr "ইউরোপ/কালিনিনগ্রাদ" 12426 12427 #. i18n: comment to the previous timezone 12428 #: kdecore/TIMEZONES:1165 12429 #, kde-format 12430 msgid "Moscow-01 - Kaliningrad" 12431 msgstr "" 12432 12433 #. i18n: comment to the previous timezone 12434 #: kdecore/TIMEZONES:1167 12435 #, kde-format 12436 msgid "MSK-01 - Kaliningrad" 12437 msgstr "" 12438 12439 #: kdecore/TIMEZONES:1168 12440 #, kde-format 12441 msgid "Europe/Kiev" 12442 msgstr "ইউরোপ/কিয়েভ" 12443 12444 #. i18n: comment to the previous timezone 12445 #: kdecore/TIMEZONES:1172 12446 #, kde-format 12447 msgid "Ukraine (most areas)" 12448 msgstr "" 12449 12450 #: kdecore/TIMEZONES:1173 12451 #, fuzzy, kde-format 12452 #| msgid "Europe/Kiev" 12453 msgid "Europe/Kirov" 12454 msgstr "ইউরোপ/কিয়েভ" 12455 12456 #. i18n: comment to the previous timezone 12457 #: kdecore/TIMEZONES:1175 12458 #, kde-format 12459 msgid "MSK+00 - Kirov" 12460 msgstr "" 12461 12462 #: kdecore/TIMEZONES:1176 12463 #, kde-format 12464 msgid "Europe/Lisbon" 12465 msgstr "ইউরোপ/লিসবন" 12466 12467 #. i18n: comment to the previous timezone 12468 #: kdecore/TIMEZONES:1180 12469 #, kde-format 12470 msgid "Portugal (mainland)" 12471 msgstr "" 12472 12473 #: kdecore/TIMEZONES:1181 12474 #, kde-format 12475 msgid "Europe/Ljubljana" 12476 msgstr "ইউরোপ/লিউবলিয়ানা" 12477 12478 #: kdecore/TIMEZONES:1182 12479 #, kde-format 12480 msgid "Europe/London" 12481 msgstr "ইউরোপ/লণ্ডন" 12482 12483 #: kdecore/TIMEZONES:1183 12484 #, kde-format 12485 msgid "Europe/Luxembourg" 12486 msgstr "ইউরোপ/লাক্সেমবুর্গ" 12487 12488 #: kdecore/TIMEZONES:1184 12489 #, kde-format 12490 msgid "Europe/Madrid" 12491 msgstr "ইউরোপ/মাদ্রিদ" 12492 12493 #. i18n: comment to the previous timezone 12494 #: kdecore/TIMEZONES:1188 12495 #, kde-format 12496 msgid "Spain (mainland)" 12497 msgstr "" 12498 12499 #: kdecore/TIMEZONES:1189 12500 #, kde-format 12501 msgid "Europe/Malta" 12502 msgstr "ইউরোপ/মল্টা" 12503 12504 #: kdecore/TIMEZONES:1190 12505 #, fuzzy, kde-format 12506 msgid "Europe/Mariehamn" 12507 msgstr "ইউরোপ/মাদ্রিদ" 12508 12509 #: kdecore/TIMEZONES:1191 12510 #, kde-format 12511 msgid "Europe/Minsk" 12512 msgstr "ইউরোপ/মিনস্ক" 12513 12514 #: kdecore/TIMEZONES:1192 12515 #, kde-format 12516 msgid "Europe/Monaco" 12517 msgstr "ইউরোপ/মোনাকো" 12518 12519 #: kdecore/TIMEZONES:1193 12520 #, kde-format 12521 msgid "Europe/Moscow" 12522 msgstr "ইউরোপ/মস্কো" 12523 12524 #. i18n: comment to the previous timezone 12525 #: kdecore/TIMEZONES:1195 kdecore/TIMEZONES:1441 12526 #, kde-format 12527 msgid "Moscow+00 - west Russia" 12528 msgstr "" 12529 12530 #. i18n: comment to the previous timezone 12531 #: kdecore/TIMEZONES:1197 12532 #, kde-format 12533 msgid "MSK+00 - Moscow area" 12534 msgstr "" 12535 12536 #: kdecore/TIMEZONES:1198 12537 #, kde-format 12538 msgid "Europe/Oslo" 12539 msgstr "ইউরোপ/অসলো" 12540 12541 #: kdecore/TIMEZONES:1199 12542 #, kde-format 12543 msgid "Europe/Paris" 12544 msgstr "ইউরোপ/প্যারিস" 12545 12546 #: kdecore/TIMEZONES:1200 12547 #, fuzzy, kde-format 12548 msgid "Europe/Podgorica" 12549 msgstr "ইউরোপ/অ্যাণ্ডোরা" 12550 12551 #: kdecore/TIMEZONES:1201 12552 #, kde-format 12553 msgid "Europe/Prague" 12554 msgstr "ইউরোপ/প্রাগ" 12555 12556 #: kdecore/TIMEZONES:1202 12557 #, kde-format 12558 msgid "Europe/Riga" 12559 msgstr "ইউরোপ/রিগা" 12560 12561 #: kdecore/TIMEZONES:1203 12562 #, kde-format 12563 msgid "Europe/Rome" 12564 msgstr "ইউরোপ/রোম" 12565 12566 #: kdecore/TIMEZONES:1204 12567 #, kde-format 12568 msgid "Europe/Samara" 12569 msgstr "ইউরোপ/সামারা" 12570 12571 #. i18n: comment to the previous timezone 12572 #: kdecore/TIMEZONES:1206 12573 #, kde-format 12574 msgid "Moscow+01 - Samara, Udmurtia" 12575 msgstr "" 12576 12577 #. i18n: comment to the previous timezone 12578 #: kdecore/TIMEZONES:1208 12579 #, kde-format 12580 msgid "Moscow+00 - Samara, Udmurtia" 12581 msgstr "" 12582 12583 #. i18n: comment to the previous timezone 12584 #: kdecore/TIMEZONES:1210 12585 #, kde-format 12586 msgid "MSK+01 - Samara, Udmurtia" 12587 msgstr "" 12588 12589 #: kdecore/TIMEZONES:1211 12590 #, kde-format 12591 msgid "Europe/San_Marino" 12592 msgstr "ইউরোপ/সান_মারিনো" 12593 12594 #: kdecore/TIMEZONES:1212 12595 #, kde-format 12596 msgid "Europe/Sarajevo" 12597 msgstr "ইউরোপ/সারায়েভো" 12598 12599 #: kdecore/TIMEZONES:1213 12600 #, fuzzy, kde-format 12601 #| msgid "Europe/Sarajevo" 12602 msgid "Europe/Saratov" 12603 msgstr "ইউরোপ/সারায়েভো" 12604 12605 #. i18n: comment to the previous timezone 12606 #: kdecore/TIMEZONES:1215 12607 #, kde-format 12608 msgid "MSK+01 - Saratov" 12609 msgstr "" 12610 12611 #: kdecore/TIMEZONES:1216 12612 #, fuzzy, kde-format 12613 msgid "Europe/Simferopol" 12614 msgstr "ইউরোপ/" 12615 12616 #. i18n: comment to the previous timezone 12617 #: kdecore/TIMEZONES:1218 12618 #, kde-format 12619 msgid "central Crimea" 12620 msgstr "" 12621 12622 #. i18n: comment to the previous timezone 12623 #: kdecore/TIMEZONES:1220 12624 #, kde-format 12625 msgid "Crimea" 12626 msgstr "" 12627 12628 #: kdecore/TIMEZONES:1221 12629 #, fuzzy, kde-format 12630 msgid "Europe/Skopje" 12631 msgstr "ইউরোপ/" 12632 12633 #: kdecore/TIMEZONES:1222 12634 #, kde-format 12635 msgid "Europe/Sofia" 12636 msgstr "ইউরোপ/সোফিয়া" 12637 12638 #: kdecore/TIMEZONES:1223 12639 #, kde-format 12640 msgid "Europe/Stockholm" 12641 msgstr "ইউরোপ/স্টকহোম" 12642 12643 #: kdecore/TIMEZONES:1224 12644 #, kde-format 12645 msgid "Europe/Tallinn" 12646 msgstr "ইউরোপ/টালিন" 12647 12648 #: kdecore/TIMEZONES:1225 12649 #, kde-format 12650 msgid "Europe/Tirane" 12651 msgstr "ইউরোপ/টিরানে" 12652 12653 #: kdecore/TIMEZONES:1226 12654 #, fuzzy, kde-format 12655 msgid "Europe/Tiraspol" 12656 msgstr "ইউরোপ/টিরানে" 12657 12658 #: kdecore/TIMEZONES:1227 12659 #, fuzzy, kde-format 12660 #| msgid "Europe/Minsk" 12661 msgid "Europe/Ulyanovsk" 12662 msgstr "ইউরোপ/মিনস্ক" 12663 12664 #. i18n: comment to the previous timezone 12665 #: kdecore/TIMEZONES:1229 12666 #, kde-format 12667 msgid "MSK+01 - Ulyanovsk" 12668 msgstr "" 12669 12670 #: kdecore/TIMEZONES:1230 12671 #, kde-format 12672 msgid "Europe/Uzhgorod" 12673 msgstr "ইউরোপ/উসগোরড" 12674 12675 #. i18n: comment to the previous timezone 12676 #: kdecore/TIMEZONES:1232 12677 #, kde-format 12678 msgid "Ruthenia" 12679 msgstr "" 12680 12681 #. i18n: comment to the previous timezone 12682 #: kdecore/TIMEZONES:1234 12683 #, kde-format 12684 msgid "Transcarpathia" 12685 msgstr "" 12686 12687 #: kdecore/TIMEZONES:1235 12688 #, fuzzy, kde-format 12689 msgid "Europe/Vaduz" 12690 msgstr "ইউরোপ/" 12691 12692 #: kdecore/TIMEZONES:1236 12693 #, kde-format 12694 msgid "Europe/Vatican" 12695 msgstr "ইউরোপ/ভ্যাটিকান" 12696 12697 #: kdecore/TIMEZONES:1237 12698 #, kde-format 12699 msgid "Europe/Vienna" 12700 msgstr "ইউরোপ/ভিয়েনা" 12701 12702 #: kdecore/TIMEZONES:1238 12703 #, kde-format 12704 msgid "Europe/Vilnius" 12705 msgstr "ইউরোপ/ভিলনিয়াস" 12706 12707 #: kdecore/TIMEZONES:1239 12708 #, fuzzy, kde-format 12709 msgid "Europe/Volgograd" 12710 msgstr "ইউরোপ/বেলগ্রেড" 12711 12712 #. i18n: comment to the previous timezone 12713 #: kdecore/TIMEZONES:1241 12714 #, kde-format 12715 msgid "Moscow+00 - Caspian Sea" 12716 msgstr "" 12717 12718 #. i18n: comment to the previous timezone 12719 #: kdecore/TIMEZONES:1243 12720 #, kde-format 12721 msgid "MSK+00 - Volgograd" 12722 msgstr "" 12723 12724 #: kdecore/TIMEZONES:1244 12725 #, kde-format 12726 msgid "Europe/Warsaw" 12727 msgstr "ইউরোপ/ওয়ারস" 12728 12729 #: kdecore/TIMEZONES:1245 12730 #, fuzzy, kde-format 12731 msgid "Europe/Zagreb" 12732 msgstr "ইউরোপ/" 12733 12734 #: kdecore/TIMEZONES:1246 12735 #, fuzzy, kde-format 12736 msgid "Europe/Zaporozhye" 12737 msgstr "ইউরোপ/" 12738 12739 #. i18n: comment to the previous timezone 12740 #: kdecore/TIMEZONES:1248 12741 #, kde-format 12742 msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" 12743 msgstr "" 12744 12745 #. i18n: comment to the previous timezone 12746 #: kdecore/TIMEZONES:1250 12747 #, kde-format 12748 msgid "Zaporozhye and east Lugansk" 12749 msgstr "" 12750 12751 #: kdecore/TIMEZONES:1251 12752 #, kde-format 12753 msgid "Europe/Zurich" 12754 msgstr "ইউরোপ/জুরিচ" 12755 12756 #: kdecore/TIMEZONES:1252 12757 #, kde-format 12758 msgid "GB" 12759 msgstr "" 12760 12761 #: kdecore/TIMEZONES:1253 12762 #, kde-format 12763 msgid "GB-Eire" 12764 msgstr "" 12765 12766 #: kdecore/TIMEZONES:1254 12767 #, fuzzy, kde-format 12768 msgid "Hongkong" 12769 msgstr "এশিয়া/হংকং" 12770 12771 #: kdecore/TIMEZONES:1255 12772 #, kde-format 12773 msgid "Iceland" 12774 msgstr "" 12775 12776 #: kdecore/TIMEZONES:1256 12777 #, kde-format 12778 msgid "Indian/Antananarivo" 12779 msgstr "ইণ্ডিয়ান/আন্তানানারিভো" 12780 12781 #: kdecore/TIMEZONES:1257 12782 #, kde-format 12783 msgid "Indian/Chagos" 12784 msgstr "ইণ্ডিয়ান/চাগোস" 12785 12786 #: kdecore/TIMEZONES:1258 12787 #, kde-format 12788 msgid "Indian/Christmas" 12789 msgstr "ইণ্ডিয়ান/খ্রিস্টমাস" 12790 12791 #: kdecore/TIMEZONES:1259 12792 #, kde-format 12793 msgid "Indian/Cocos" 12794 msgstr "ইণ্ডিয়ান/কোকোস" 12795 12796 #: kdecore/TIMEZONES:1260 12797 #, kde-format 12798 msgid "Indian/Comoro" 12799 msgstr "ইণ্ডিয়ান/কোমোরো" 12800 12801 #: kdecore/TIMEZONES:1261 12802 #, fuzzy, kde-format 12803 msgid "Indian/Kerguelen" 12804 msgstr "ইণ্ডিয়ান/" 12805 12806 #: kdecore/TIMEZONES:1262 12807 #, kde-format 12808 msgid "Indian/Mahe" 12809 msgstr "ইণ্ডিয়ান/মাহে" 12810 12811 #: kdecore/TIMEZONES:1263 12812 #, kde-format 12813 msgid "Indian/Maldives" 12814 msgstr "ইণ্ডিয়ান/মালদ্বীপ" 12815 12816 #: kdecore/TIMEZONES:1264 12817 #, kde-format 12818 msgid "Indian/Mauritius" 12819 msgstr "ইণ্ডিয়ান/মরিশাস" 12820 12821 #: kdecore/TIMEZONES:1265 12822 #, kde-format 12823 msgid "Indian/Mayotte" 12824 msgstr "ইণ্ডিয়ান/মেয়ট" 12825 12826 #: kdecore/TIMEZONES:1266 12827 #, kde-format 12828 msgid "Indian/Reunion" 12829 msgstr "ইণ্ডিয়ান/রিইউনিয়ন" 12830 12831 #: kdecore/TIMEZONES:1267 12832 #, kde-format 12833 msgid "Iran" 12834 msgstr "" 12835 12836 #: kdecore/TIMEZONES:1268 12837 #, fuzzy, kde-format 12838 msgid "Israel" 12839 msgstr "প্যাসিফিক/কসরে" 12840 12841 #: kdecore/TIMEZONES:1269 12842 #, fuzzy, kde-format 12843 msgid "Jamaica" 12844 msgstr "আমেরিকা/জামাইকা" 12845 12846 #: kdecore/TIMEZONES:1270 12847 #, kde-format 12848 msgid "Japan" 12849 msgstr "" 12850 12851 #. i18n: comment to the previous timezone 12852 #: kdecore/TIMEZONES:1271 kdecore/TIMEZONES:1273 kdecore/TIMEZONES:1347 12853 #, fuzzy, kde-format 12854 msgid "Kwajalein" 12855 msgstr "প্যাসিফিক/" 12856 12857 #: kdecore/TIMEZONES:1274 12858 #, kde-format 12859 msgid "Libya" 12860 msgstr "" 12861 12862 #: kdecore/TIMEZONES:1275 12863 #, kde-format 12864 msgid "Mexico/BajaNorte" 12865 msgstr "" 12866 12867 #: kdecore/TIMEZONES:1278 12868 #, kde-format 12869 msgid "Mexico/BajaSur" 12870 msgstr "" 12871 12872 #: kdecore/TIMEZONES:1281 12873 #, kde-format 12874 msgid "Mexico/General" 12875 msgstr "" 12876 12877 #: kdecore/TIMEZONES:1284 12878 #, kde-format 12879 msgid "NZ" 12880 msgstr "" 12881 12882 #: kdecore/TIMEZONES:1287 12883 #, kde-format 12884 msgid "NZ-CHAT" 12885 msgstr "" 12886 12887 #. i18n: comment to the previous timezone 12888 #: kdecore/TIMEZONES:1289 kdecore/TIMEZONES:1307 12889 #, kde-format 12890 msgid "Chatham Islands" 12891 msgstr "" 12892 12893 #: kdecore/TIMEZONES:1290 12894 #, kde-format 12895 msgid "Navajo" 12896 msgstr "" 12897 12898 #: kdecore/TIMEZONES:1293 12899 #, kde-format 12900 msgid "PRC" 12901 msgstr "" 12902 12903 #: kdecore/TIMEZONES:1296 12904 #, kde-format 12905 msgid "Pacific/Apia" 12906 msgstr "প্যাসিফিক/আপিয়া" 12907 12908 #: kdecore/TIMEZONES:1297 12909 #, kde-format 12910 msgid "Pacific/Auckland" 12911 msgstr "প্যাসিফিক/অকল্যাণ্ড" 12912 12913 #. i18n: comment to the previous timezone 12914 #: kdecore/TIMEZONES:1301 12915 #, kde-format 12916 msgid "New Zealand (most areas)" 12917 msgstr "" 12918 12919 #: kdecore/TIMEZONES:1302 12920 #, fuzzy, kde-format 12921 #| msgid "Pacific/Honolulu" 12922 msgid "Pacific/Bougainville" 12923 msgstr "প্যাসিফিক/হনলুলু" 12924 12925 #. i18n: comment to the previous timezone 12926 #: kdecore/TIMEZONES:1304 12927 #, kde-format 12928 msgid "Bougainville" 12929 msgstr "" 12930 12931 #: kdecore/TIMEZONES:1305 12932 #, kde-format 12933 msgid "Pacific/Chatham" 12934 msgstr "প্যাসিফিক/চ্যাটহ্যাম" 12935 12936 #: kdecore/TIMEZONES:1308 12937 #, fuzzy, kde-format 12938 #| msgid "Pacific/Truk" 12939 msgid "Pacific/Chuuk" 12940 msgstr "প্যাসিফিক/ট্রুক" 12941 12942 #. i18n: comment to the previous timezone 12943 #: kdecore/TIMEZONES:1310 12944 #, kde-format 12945 msgid "Chuuk (Truk) and Yap" 12946 msgstr "" 12947 12948 #. i18n: comment to the previous timezone 12949 #: kdecore/TIMEZONES:1312 12950 #, kde-format 12951 msgid "Chuuk/Truk, Yap" 12952 msgstr "" 12953 12954 #: kdecore/TIMEZONES:1313 12955 #, kde-format 12956 msgid "Pacific/Easter" 12957 msgstr "প্যাসিফিক/ঈস্টার" 12958 12959 #. i18n: comment to the previous timezone 12960 #: kdecore/TIMEZONES:1317 12961 #, fuzzy, kde-format 12962 #| msgctxt "digit set" 12963 #| msgid "Eastern Arabic-Indic" 12964 msgid "Easter Island" 12965 msgstr "পূর্ব আরবী-ভারতীয়" 12966 12967 #: kdecore/TIMEZONES:1318 12968 #, kde-format 12969 msgid "Pacific/Efate" 12970 msgstr "প্যাসিফিক/এফাতে" 12971 12972 #: kdecore/TIMEZONES:1319 12973 #, kde-format 12974 msgid "Pacific/Enderbury" 12975 msgstr "প্যাসিফিক/এন্ডারবেরি" 12976 12977 #. i18n: comment to the previous timezone 12978 #: kdecore/TIMEZONES:1321 12979 #, kde-format 12980 msgid "Phoenix Islands" 12981 msgstr "" 12982 12983 #: kdecore/TIMEZONES:1322 12984 #, fuzzy, kde-format 12985 msgid "Pacific/Fakaofo" 12986 msgstr "প্যাসিফিক/" 12987 12988 #: kdecore/TIMEZONES:1323 12989 #, kde-format 12990 msgid "Pacific/Fiji" 12991 msgstr "প্যাসিফিক/ফিজি" 12992 12993 #: kdecore/TIMEZONES:1324 12994 #, fuzzy, kde-format 12995 msgid "Pacific/Funafuti" 12996 msgstr "প্যাসিফিক/" 12997 12998 #: kdecore/TIMEZONES:1325 12999 #, kde-format 13000 msgid "Pacific/Galapagos" 13001 msgstr "প্যাসিফিক/গালাপাগোস" 13002 13003 #. i18n: comment to the previous timezone 13004 #: kdecore/TIMEZONES:1327 13005 #, kde-format 13006 msgid "Galapagos Islands" 13007 msgstr "" 13008 13009 #: kdecore/TIMEZONES:1328 13010 #, kde-format 13011 msgid "Pacific/Gambier" 13012 msgstr "প্যাসিফিক/গ্যাম্বিয়ের" 13013 13014 #. i18n: comment to the previous timezone 13015 #: kdecore/TIMEZONES:1330 13016 #, kde-format 13017 msgid "Gambier Islands" 13018 msgstr "" 13019 13020 #: kdecore/TIMEZONES:1331 13021 #, fuzzy, kde-format 13022 msgid "Pacific/Guadalcanal" 13023 msgstr "প্যাসিফিক/" 13024 13025 #: kdecore/TIMEZONES:1332 13026 #, kde-format 13027 msgid "Pacific/Guam" 13028 msgstr "প্যাসিফিক/গুয়াম" 13029 13030 #: kdecore/TIMEZONES:1333 13031 #, kde-format 13032 msgid "Pacific/Honolulu" 13033 msgstr "প্যাসিফিক/হনলুলু" 13034 13035 #. i18n: comment to the previous timezone 13036 #: kdecore/TIMEZONES:1335 kdecore/TIMEZONES:1425 13037 #, kde-format 13038 msgid "Hawaii" 13039 msgstr "" 13040 13041 #: kdecore/TIMEZONES:1336 13042 #, kde-format 13043 msgid "Pacific/Johnston" 13044 msgstr "প্যাসিফিক/জনস্টন" 13045 13046 #. i18n: comment to the previous timezone 13047 #: kdecore/TIMEZONES:1338 13048 #, kde-format 13049 msgid "Johnston Atoll" 13050 msgstr "" 13051 13052 #: kdecore/TIMEZONES:1339 13053 #, kde-format 13054 msgid "Pacific/Kiritimati" 13055 msgstr "প্যাসিফিক/কিরিটিমাটি" 13056 13057 #. i18n: comment to the previous timezone 13058 #: kdecore/TIMEZONES:1341 13059 #, kde-format 13060 msgid "Line Islands" 13061 msgstr "" 13062 13063 #: kdecore/TIMEZONES:1342 13064 #, fuzzy, kde-format 13065 msgid "Pacific/Kosrae" 13066 msgstr "প্যাসিফিক/কসরে" 13067 13068 #. i18n: comment to the previous timezone 13069 #: kdecore/TIMEZONES:1344 13070 #, fuzzy, kde-format 13071 msgid "Kosrae" 13072 msgstr "প্যাসিফিক/কসরে" 13073 13074 #: kdecore/TIMEZONES:1345 13075 #, fuzzy, kde-format 13076 msgid "Pacific/Kwajalein" 13077 msgstr "প্যাসিফিক/" 13078 13079 #: kdecore/TIMEZONES:1348 13080 #, kde-format 13081 msgid "Pacific/Majuro" 13082 msgstr "প্যাসিফিক/মাজুরো" 13083 13084 #. i18n: comment to the previous timezone 13085 #: kdecore/TIMEZONES:1352 13086 #, kde-format 13087 msgid "Marshall Islands (most areas)" 13088 msgstr "" 13089 13090 #: kdecore/TIMEZONES:1353 13091 #, kde-format 13092 msgid "Pacific/Marquesas" 13093 msgstr "প্যাসিফিক/মার্কেসা" 13094 13095 #. i18n: comment to the previous timezone 13096 #: kdecore/TIMEZONES:1355 13097 #, kde-format 13098 msgid "Marquesas Islands" 13099 msgstr "" 13100 13101 #: kdecore/TIMEZONES:1356 13102 #, kde-format 13103 msgid "Pacific/Midway" 13104 msgstr "প্যাসিফিক/মিডওয়ে" 13105 13106 #. i18n: comment to the previous timezone 13107 #: kdecore/TIMEZONES:1358 13108 #, kde-format 13109 msgid "Midway Islands" 13110 msgstr "" 13111 13112 #: kdecore/TIMEZONES:1359 13113 #, kde-format 13114 msgid "Pacific/Nauru" 13115 msgstr "প্যাসিফিক/নাউরু" 13116 13117 #: kdecore/TIMEZONES:1360 13118 #, fuzzy, kde-format 13119 msgid "Pacific/Niue" 13120 msgstr "প্যাসিফিক/" 13121 13122 #: kdecore/TIMEZONES:1361 13123 #, kde-format 13124 msgid "Pacific/Norfolk" 13125 msgstr "প্যাসিফিক/নরফোক" 13126 13127 #: kdecore/TIMEZONES:1362 13128 #, fuzzy, kde-format 13129 msgid "Pacific/Noumea" 13130 msgstr "প্যাসিফিক/" 13131 13132 #: kdecore/TIMEZONES:1363 13133 #, kde-format 13134 msgid "Pacific/Pago_Pago" 13135 msgstr "প্যাসিফিক/পাগো_পাগো" 13136 13137 #: kdecore/TIMEZONES:1364 13138 #, kde-format 13139 msgid "Pacific/Palau" 13140 msgstr "প্যাসিফিক/পালাউ" 13141 13142 #: kdecore/TIMEZONES:1365 13143 #, kde-format 13144 msgid "Pacific/Pitcairn" 13145 msgstr "প্যাসিফিক/পিটকেম" 13146 13147 #: kdecore/TIMEZONES:1366 13148 #, fuzzy, kde-format 13149 #| msgid "Pacific/Ponape" 13150 msgid "Pacific/Pohnpei" 13151 msgstr "প্যাসিফিক/পোনাপে" 13152 13153 #. i18n: comment to the previous timezone 13154 #: kdecore/TIMEZONES:1368 13155 #, kde-format 13156 msgid "Pohnpei (Ponape)" 13157 msgstr "" 13158 13159 #. i18n: comment to the previous timezone 13160 #: kdecore/TIMEZONES:1370 13161 #, fuzzy, kde-format 13162 #| msgid "Pacific/Ponape" 13163 msgid "Pohnpei/Ponape" 13164 msgstr "প্যাসিফিক/পোনাপে" 13165 13166 #: kdecore/TIMEZONES:1371 13167 #, kde-format 13168 msgid "Pacific/Ponape" 13169 msgstr "প্যাসিফিক/পোনাপে" 13170 13171 #. i18n: comment to the previous timezone 13172 #: kdecore/TIMEZONES:1373 13173 #, kde-format 13174 msgid "Ponape (Pohnpei)" 13175 msgstr "" 13176 13177 #: kdecore/TIMEZONES:1374 13178 #, kde-format 13179 msgid "Pacific/Port_Moresby" 13180 msgstr "প্যাসিফিক/পোর্ট_মোরেসবি" 13181 13182 #. i18n: comment to the previous timezone 13183 #: kdecore/TIMEZONES:1376 13184 #, kde-format 13185 msgid "Papua New Guinea (most areas)" 13186 msgstr "" 13187 13188 #: kdecore/TIMEZONES:1377 13189 #, kde-format 13190 msgid "Pacific/Rarotonga" 13191 msgstr "প্যাসিফিক/রারোটংগা" 13192 13193 #: kdecore/TIMEZONES:1378 13194 #, kde-format 13195 msgid "Pacific/Saipan" 13196 msgstr "প্যাসিফিক/সাইপান" 13197 13198 #: kdecore/TIMEZONES:1379 13199 #, fuzzy, kde-format 13200 msgid "Pacific/Samoa" 13201 msgstr "প্যাসিফিক/সাইপান" 13202 13203 #: kdecore/TIMEZONES:1380 13204 #, kde-format 13205 msgid "Pacific/Tahiti" 13206 msgstr "প্যাসিফিক/তাহিতি" 13207 13208 #. i18n: comment to the previous timezone 13209 #: kdecore/TIMEZONES:1382 13210 #, kde-format 13211 msgid "Society Islands" 13212 msgstr "" 13213 13214 #: kdecore/TIMEZONES:1383 13215 #, kde-format 13216 msgid "Pacific/Tarawa" 13217 msgstr "প্যাসিফিক/তারাওয়া" 13218 13219 #. i18n: comment to the previous timezone 13220 #: kdecore/TIMEZONES:1385 13221 #, kde-format 13222 msgid "Gilbert Islands" 13223 msgstr "" 13224 13225 #: kdecore/TIMEZONES:1386 13226 #, kde-format 13227 msgid "Pacific/Tongatapu" 13228 msgstr "প্যাসিফিক/টোংগাটাপু" 13229 13230 #: kdecore/TIMEZONES:1387 13231 #, kde-format 13232 msgid "Pacific/Truk" 13233 msgstr "প্যাসিফিক/ট্রুক" 13234 13235 #. i18n: comment to the previous timezone 13236 #: kdecore/TIMEZONES:1389 kdecore/TIMEZONES:1396 13237 #, kde-format 13238 msgid "Truk (Chuuk) and Yap" 13239 msgstr "" 13240 13241 #: kdecore/TIMEZONES:1390 13242 #, kde-format 13243 msgid "Pacific/Wake" 13244 msgstr "প্যাসিফিক/ওয়েক" 13245 13246 #. i18n: comment to the previous timezone 13247 #: kdecore/TIMEZONES:1392 13248 #, kde-format 13249 msgid "Wake Island" 13250 msgstr "" 13251 13252 #: kdecore/TIMEZONES:1393 13253 #, kde-format 13254 msgid "Pacific/Wallis" 13255 msgstr "প্যাসিফিক/ওয়ালিস" 13256 13257 #: kdecore/TIMEZONES:1394 13258 #, kde-format 13259 msgid "Pacific/Yap" 13260 msgstr "প্যাসিফিক/য়াপ" 13261 13262 #: kdecore/TIMEZONES:1397 13263 #, kde-format 13264 msgid "Poland" 13265 msgstr "" 13266 13267 #: kdecore/TIMEZONES:1398 13268 #, kde-format 13269 msgid "Portugal" 13270 msgstr "" 13271 13272 #: kdecore/TIMEZONES:1401 13273 #, kde-format 13274 msgid "ROC" 13275 msgstr "" 13276 13277 #: kdecore/TIMEZONES:1402 13278 #, kde-format 13279 msgid "ROK" 13280 msgstr "" 13281 13282 #: kdecore/TIMEZONES:1403 13283 #, fuzzy, kde-format 13284 msgid "Singapore" 13285 msgstr "এশিয়া/সিঙ্গাপুর" 13286 13287 #: kdecore/TIMEZONES:1404 13288 #, kde-format 13289 msgid "Turkey" 13290 msgstr "" 13291 13292 #: kdecore/TIMEZONES:1405 13293 #, kde-format 13294 msgid "US/Alaska" 13295 msgstr "" 13296 13297 #: kdecore/TIMEZONES:1408 13298 #, kde-format 13299 msgid "US/Aleutian" 13300 msgstr "" 13301 13302 #: kdecore/TIMEZONES:1411 13303 #, kde-format 13304 msgid "US/Arizona" 13305 msgstr "" 13306 13307 #: kdecore/TIMEZONES:1414 13308 #, kde-format 13309 msgid "US/Central" 13310 msgstr "" 13311 13312 #: kdecore/TIMEZONES:1417 13313 #, kde-format 13314 msgid "US/East-Indiana" 13315 msgstr "" 13316 13317 #: kdecore/TIMEZONES:1420 13318 #, kde-format 13319 msgid "US/Eastern" 13320 msgstr "" 13321 13322 #: kdecore/TIMEZONES:1423 13323 #, kde-format 13324 msgid "US/Hawaii" 13325 msgstr "" 13326 13327 #: kdecore/TIMEZONES:1426 13328 #, kde-format 13329 msgid "US/Indiana-Starke" 13330 msgstr "" 13331 13332 #: kdecore/TIMEZONES:1429 13333 #, kde-format 13334 msgid "US/Michigan" 13335 msgstr "" 13336 13337 #: kdecore/TIMEZONES:1432 13338 #, kde-format 13339 msgid "US/Mountain" 13340 msgstr "" 13341 13342 #: kdecore/TIMEZONES:1435 13343 #, fuzzy, kde-format 13344 msgid "US/Pacific" 13345 msgstr "প্যাসিফিক/য়াপ" 13346 13347 #: kdecore/TIMEZONES:1438 13348 #, kde-format 13349 msgid "US/Samoa" 13350 msgstr "" 13351 13352 #: kdecore/TIMEZONES:1439 13353 #, kde-format 13354 msgid "W-SU" 13355 msgstr "" 13356 13357 #. i18n: Generic sans serif font presented in font choosers. When selected, 13358 #. the system will choose a real font, mandated by distro settings. 13359 #: kdeui/fonthelpers.cpp:29 13360 #, kde-format 13361 msgctxt "@item Font name" 13362 msgid "Sans Serif" 13363 msgstr "Sans Serif" 13364 13365 #. i18n: Generic serif font presented in font choosers. When selected, 13366 #. the system will choose a real font, mandated by distro settings. 13367 #: kdeui/fonthelpers.cpp:32 13368 #, kde-format 13369 msgctxt "@item Font name" 13370 msgid "Serif" 13371 msgstr "Serif" 13372 13373 #. i18n: Generic monospace font presented in font choosers. When selected, 13374 #. the system will choose a real font, mandated by distro settings. 13375 #: kdeui/fonthelpers.cpp:35 13376 #, kde-format 13377 msgctxt "@item Font name" 13378 msgid "Monospace" 13379 msgstr "Monospace" 13380 13381 #: kdeui/k4timezonewidget.cpp:62 13382 #, kde-format 13383 msgctxt "Define an area in the time zone, like a town area" 13384 msgid "Area" 13385 msgstr "ক্ষেত্র" 13386 13387 #: kdeui/k4timezonewidget.cpp:62 13388 #, kde-format 13389 msgctxt "Time zone" 13390 msgid "Region" 13391 msgstr "এলাকা" 13392 13393 #: kdeui/k4timezonewidget.cpp:62 13394 #, fuzzy, kde-format 13395 msgid "Comment" 13396 msgstr "মন্তব্য" 13397 13398 #: kdeui/kapplication.cpp:741 13399 #, kde-format 13400 msgid "The style '%1' was not found" 13401 msgstr "'%1' স্টাইল পাওয়া যায়নি" 13402 13403 #: kdeui/kcolordialog.cpp:102 13404 #, kde-format 13405 msgctxt "palette name" 13406 msgid "* Recent Colors *" 13407 msgstr "* সাম্প্রতিক রং *" 13408 13409 #: kdeui/kcolordialog.cpp:103 13410 #, kde-format 13411 msgctxt "palette name" 13412 msgid "* Custom Colors *" 13413 msgstr "* স্বনির্বাচিত রং *" 13414 13415 #: kdeui/kcolordialog.cpp:104 13416 #, kde-format 13417 msgctxt "palette name" 13418 msgid "Forty Colors" 13419 msgstr "চল্লিশটি রং" 13420 13421 #: kdeui/kcolordialog.cpp:105 13422 #, kde-format 13423 msgctxt "palette name" 13424 msgid "Oxygen Colors" 13425 msgstr "অক্সিজেন রং" 13426 13427 #: kdeui/kcolordialog.cpp:106 13428 #, kde-format 13429 msgctxt "palette name" 13430 msgid "Rainbow Colors" 13431 msgstr "রামধনু রং" 13432 13433 #: kdeui/kcolordialog.cpp:107 13434 #, kde-format 13435 msgctxt "palette name" 13436 msgid "Royal Colors" 13437 msgstr "রাজকীয় রং" 13438 13439 #: kdeui/kcolordialog.cpp:108 13440 #, kde-format 13441 msgctxt "palette name" 13442 msgid "Web Colors" 13443 msgstr "ওয়েব রং" 13444 13445 #: kdeui/kcolordialog.cpp:572 13446 #, kde-format 13447 msgid "Named Colors" 13448 msgstr "নাম দেওয়া রং" 13449 13450 #: kdeui/kcolordialog.cpp:746 13451 #, kde-format 13452 msgctxt "" 13453 "%1 is the number of paths, %2 is the list of paths (with newlines between " 13454 "them)" 13455 msgid "" 13456 "Unable to read X11 RGB color strings. The following file location was " 13457 "examined:\n" 13458 "%2" 13459 msgid_plural "" 13460 "Unable to read X11 RGB color strings. The following file locations were " 13461 "examined:\n" 13462 "%2" 13463 msgstr[0] "" 13464 msgstr[1] "" 13465 13466 #: kdeui/kcolordialog.cpp:997 13467 #, kde-format 13468 msgid "Select Color" 13469 msgstr "রং বেছে নিন" 13470 13471 #: kdeui/kcolordialog.cpp:1077 13472 #, kde-format 13473 msgid "Hue:" 13474 msgstr "Hue:" 13475 13476 #: kdeui/kcolordialog.cpp:1083 13477 #, kde-format 13478 msgctxt "The angular degree unit (for hue)" 13479 msgid "°" 13480 msgstr "°" 13481 13482 #: kdeui/kcolordialog.cpp:1088 13483 #, fuzzy, kde-format 13484 #| msgid "Saturday" 13485 msgid "Saturation:" 13486 msgstr "শনিবার" 13487 13488 #: kdeui/kcolordialog.cpp:1098 13489 #, kde-format 13490 msgctxt "This is the V of HSV" 13491 msgid "Value:" 13492 msgstr "মান:" 13493 13494 #: kdeui/kcolordialog.cpp:1111 13495 #, kde-format 13496 msgid "Red:" 13497 msgstr "লাল:" 13498 13499 #: kdeui/kcolordialog.cpp:1121 13500 #, kde-format 13501 msgid "Green:" 13502 msgstr "সবুজ:" 13503 13504 #: kdeui/kcolordialog.cpp:1131 13505 #, kde-format 13506 msgid "Blue:" 13507 msgstr "নীল:" 13508 13509 #: kdeui/kcolordialog.cpp:1152 13510 #, kde-format 13511 msgid "Alpha:" 13512 msgstr "Alpha:" 13513 13514 #: kdeui/kcolordialog.cpp:1206 13515 #, kde-format 13516 msgid "&Add to Custom Colors" 13517 msgstr "স্বনির্বাচিত রঙের তালিকায় যো&গ করো" 13518 13519 #: kdeui/kcolordialog.cpp:1234 13520 #, kde-format 13521 msgid "Name:" 13522 msgstr "নাম:" 13523 13524 #: kdeui/kcolordialog.cpp:1241 13525 #, kde-format 13526 msgid "HTML:" 13527 msgstr "এইচ-টি-এম-এল:" 13528 13529 #: kdeui/kcolordialog.cpp:1328 13530 #, kde-format 13531 msgid "Default color" 13532 msgstr "ডিফল্ট রং" 13533 13534 #: kdeui/kcolordialog.cpp:1393 13535 #, kde-format 13536 msgid "-default-" 13537 msgstr "-ডিফল্ট-" 13538 13539 #: kdeui/kcolordialog.cpp:1668 13540 #, kde-format 13541 msgid "-unnamed-" 13542 msgstr "-অনামিকা-" 13543 13544 #: kdeui/kdeprintdialog.cpp:40 13545 #, kde-format 13546 msgctxt "@title:window" 13547 msgid "Print" 13548 msgstr "ছাপাও" 13549 13550 #: kdeui/kdialog.cpp:271 13551 #, kde-format 13552 msgid "&Try" 13553 msgstr "চেষ্টা &করো" 13554 13555 #: kdeui/kdialog.cpp:484 13556 #, kde-format 13557 msgid "modified" 13558 msgstr "পরিবর্তিত" 13559 13560 #: kdeui/kdialog.cpp:495 13561 #, kde-format 13562 msgctxt "Document/application separator in titlebar" 13563 msgid " – " 13564 msgstr " – " 13565 13566 #: kdeui/kdialog.cpp:896 13567 #, kde-format 13568 msgid "&Details" 13569 msgstr "বিস্তারি&ত বর্ণনা" 13570 13571 #: kdeui/kdialog.cpp:1054 13572 #, kde-format 13573 msgid "Get help..." 13574 msgstr "সাহায্য চাও..." 13575 13576 #: kdeui/keditlistbox.cpp:324 13577 #, kde-format 13578 msgid "&Add" 13579 msgstr "যো&গ করো" 13580 13581 #: kdeui/keditlistbox.cpp:336 13582 #, kde-format 13583 msgid "&Remove" 13584 msgstr "&সরাও" 13585 13586 #: kdeui/keditlistbox.cpp:348 13587 #, kde-format 13588 msgid "Move &Up" 13589 msgstr "&উপরে তোলো" 13590 13591 #: kdeui/keditlistbox.cpp:353 13592 #, kde-format 13593 msgid "Move &Down" 13594 msgstr "নীচে নামা&ও" 13595 13596 #. i18n: A shorter version of the alphabet test phrase translated in 13597 #. another message. It is displayed in the dropdown list of font previews 13598 #. (the font selection combo box), so keep it under the length equivalent 13599 #. to 60 or so proportional Latin characters. 13600 #: kdeui/kfontcombobox.cpp:48 13601 #, kde-format 13602 msgctxt "short" 13603 msgid "The Quick Brown Fox Jumps Over The Lazy Dog" 13604 msgstr "The Quick Brown Fox Jumps Over The Lazy Dog" 13605 13606 #. i18n: Integer which indicates the script you used in the sample text 13607 #. for font previews in your language. For the possible values, see 13608 #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum 13609 #. If the sample text contains several scripts, their IDs can be given 13610 #. as a comma-separated list (e.g. for Japanese it is "1,27"). 13611 #: kdeui/kfontcombobox.cpp:119 13612 #, kde-format 13613 msgctxt "Numeric IDs of scripts for font previews" 13614 msgid "1" 13615 msgstr "1" 13616 13617 #: kdeui/kfontdialog.cpp:51 13618 #, kde-format 13619 msgid "Select Font" 13620 msgstr "ফন্ট পছন্দ করুন" 13621 13622 #: kdeui/kprintpreview.cpp:118 13623 #, kde-format 13624 msgid "Could not load print preview part" 13625 msgstr "মুদ্রণ প্রাকদর্শন পার্ট লোড করা যায়নি" 13626 13627 #: kdeui/kprintpreview.cpp:135 13628 #, kde-format 13629 msgid "Print Preview" 13630 msgstr "মুদ্রণ প্রাক্দর্শন" 13631 13632 #: kdeui/ksystemtrayicon.cpp:153 13633 #, kde-format 13634 msgid "Minimize" 13635 msgstr "মিনিমাইজ" 13636 13637 #: kdeui/ksystemtrayicon.cpp:205 13638 #, kde-format 13639 msgid "&Minimize" 13640 msgstr "মিনিমাই&জ" 13641 13642 #: kdeui/ksystemtrayicon.cpp:207 13643 #, kde-format 13644 msgid "&Restore" 13645 msgstr "&আগের মত" 13646 13647 #: kdeui/ksystemtrayicon.cpp:226 13648 #, kde-format 13649 msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" 13650 msgstr "<qt>আপনি কি নিশ্চিত যে আপনি <b>%1</b> থেকে প্রস্থান করতে চান ?</qt>" 13651 13652 #: kdeui/ksystemtrayicon.cpp:229 13653 #, kde-format 13654 msgid "Confirm Quit From System Tray" 13655 msgstr "সিস্টেম ট্রে থেকে প্রস্থান কনফার্ম করুন" 13656 13657 #: kdeui/kundostack.cpp:47 13658 #, kde-format 13659 msgid "Redo" 13660 msgstr "আবার করো" 13661 13662 #: kdeui/kundostack.cpp:66 13663 #, kde-format 13664 msgid "Undo" 13665 msgstr "বাতিল করো" 13666 13667 #: kdeui/kuniqueapplication.cpp:79 13668 #, kde-format 13669 msgid "Do not run in the background." 13670 msgstr "পটভূমিতে চালিও না।" 13671 13672 #: kdeui/kuniqueapplication.cpp:81 13673 #, fuzzy, kde-format 13674 msgid "Internally added if launched from Finder" 13675 msgstr "অভ্যন্তরীণভাবে যোগ করেছিল Finder থেকে যদি launched" 13676 13677 #: kio/kcommentwidget.cpp:68 13678 #, fuzzy, kde-format 13679 #| msgid "Add Entry..." 13680 msgctxt "@label" 13681 msgid "Add Comment..." 13682 msgstr "এন্ট্রি যোগ করো..." 13683 13684 #: kio/kcommentwidget.cpp:74 13685 #, kde-format 13686 msgctxt "@label" 13687 msgid "Change..." 13688 msgstr "বদলাও..." 13689 13690 #: kio/kcommentwidget.cpp:128 13691 #, fuzzy, kde-format 13692 #| msgid "Comment" 13693 msgctxt "@title:window" 13694 msgid "Change Comment" 13695 msgstr "মন্তব্য" 13696 13697 #: kio/kcommentwidget.cpp:129 13698 #, fuzzy, kde-format 13699 #| msgid "Comment" 13700 msgctxt "@title:window" 13701 msgid "Add Comment" 13702 msgstr "মন্তব্য" 13703 13704 #: kio/kdevicelistmodel.cpp:115 13705 #, fuzzy, kde-format 13706 msgid "Device name" 13707 msgstr "ডিভাইস" 13708 13709 #: kio/kdirselectdialog.cpp:136 13710 #, fuzzy, kde-format 13711 msgctxt "folder name" 13712 msgid "New Folder" 13713 msgstr "নতুন ফোল্ডার" 13714 13715 #: kio/kdirselectdialog.cpp:141 13716 #, fuzzy, kde-format 13717 msgctxt "@title:window" 13718 msgid "New Folder" 13719 msgstr "বাড়ির ফোন" 13720 13721 #: kio/kdirselectdialog.cpp:142 13722 #, fuzzy, kde-format 13723 msgctxt "@label:textbox" 13724 msgid "" 13725 "Create new folder in:\n" 13726 "%1" 13727 msgstr "" 13728 "%1-এ \n" 13729 "নতুন ফোল্ডার তৈরি করো" 13730 13731 #: kio/kdirselectdialog.cpp:172 13732 #, kde-format 13733 msgid "A file or folder named %1 already exists." 13734 msgstr "%1 নামে একটি ফাইল বা ফোল্ডার আগে থেকেই আছে।" 13735 13736 #: kio/kdirselectdialog.cpp:175 13737 #, kde-format 13738 msgid "You do not have permission to create that folder." 13739 msgstr "আপনার ঐ ফোল্ডারটি তৈরি করার অনুমতি নেই।" 13740 13741 #: kio/kdirselectdialog.cpp:290 13742 #, fuzzy, kde-format 13743 msgctxt "@title:window" 13744 msgid "Select Folder" 13745 msgstr "রং বেছে নিন" 13746 13747 #: kio/kdirselectdialog.cpp:299 13748 #, fuzzy, kde-format 13749 msgctxt "@action:button" 13750 msgid "New Folder..." 13751 msgstr "বাড়ির ফোন" 13752 13753 #: kio/kdirselectdialog.cpp:345 13754 #, fuzzy, kde-format 13755 msgctxt "@action:inmenu" 13756 msgid "New Folder..." 13757 msgstr "বাড়ির ফোন" 13758 13759 #: kio/kdirselectdialog.cpp:352 13760 #, fuzzy, kde-format 13761 #| msgid "Nothing to Trash" 13762 msgctxt "@action:inmenu" 13763 msgid "Move to Trash" 13764 msgstr "আবর্জনার বাক্সে পাঠাবার মত কিছু নেই" 13765 13766 #: kio/kdirselectdialog.cpp:359 13767 #, fuzzy, kde-format 13768 msgctxt "@action:inmenu" 13769 msgid "Delete" 13770 msgstr "মুছে ফেলা হচ্ছে" 13771 13772 #: kio/kdirselectdialog.cpp:368 13773 #, fuzzy, kde-format 13774 msgctxt "@option:check" 13775 msgid "Show Hidden Folders" 13776 msgstr "সহায়িকা দেখাও" 13777 13778 #: kio/kdirselectdialog.cpp:375 13779 #, fuzzy, kde-format 13780 msgctxt "@action:inmenu" 13781 msgid "Properties" 13782 msgstr "এখানে বুকমার্ক যোগ করো" 13783 13784 #: kio/kfiledialog.cpp:132 13785 #, fuzzy, kde-format 13786 msgid "*|All files" 13787 msgstr "*|সব ফাইল" 13788 13789 #: kio/kfiledialog.cpp:332 13790 #, fuzzy, kde-format 13791 msgid "All Supported Files" 13792 msgstr "ফাইল পাঠা&ও" 13793 13794 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 13795 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 13796 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 13797 #, kde-format 13798 msgid "Open" 13799 msgstr "খোলো" 13800 13801 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 13802 #: kio/kfiledialog.cpp:838 13803 #, kde-format 13804 msgid "Save As" 13805 msgstr "নতুন নামে সংরক্ষণ করো" 13806 13807 #: kio/kfilemetadataprovider.cpp:245 13808 #, kde-format 13809 msgctxt "@item:intable" 13810 msgid "%1 item" 13811 msgid_plural "%1 items" 13812 msgstr[0] "" 13813 msgstr[1] "" 13814 13815 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 13816 #, fuzzy, kde-format 13817 msgctxt "@label" 13818 msgid "Comment" 13819 msgstr "মন্তব্য" 13820 13821 #: kio/kfilemetadataprovider.cpp:447 13822 #, fuzzy, kde-format 13823 msgctxt "@label" 13824 msgid "Modified" 13825 msgstr "পরিবর্তিত:" 13826 13827 #: kio/kfilemetadataprovider.cpp:448 13828 #, fuzzy, kde-format 13829 #| msgid "Owner" 13830 msgctxt "@label" 13831 msgid "Owner" 13832 msgstr "মালিক" 13833 13834 #: kio/kfilemetadataprovider.cpp:449 13835 #, fuzzy, kde-format 13836 #| msgid "Permissions" 13837 msgctxt "@label" 13838 msgid "Permissions" 13839 msgstr "অনুমতি" 13840 13841 #: kio/kfilemetadataprovider.cpp:450 13842 #, fuzzy, kde-format 13843 msgctxt "@label" 13844 msgid "Rating" 13845 msgstr "ক্রমবিন্যাস" 13846 13847 #: kio/kfilemetadataprovider.cpp:451 13848 #, fuzzy, kde-format 13849 #| msgid "Size" 13850 msgctxt "@label" 13851 msgid "Size" 13852 msgstr "মাপ" 13853 13854 #: kio/kfilemetadataprovider.cpp:452 13855 #, fuzzy, kde-format 13856 msgctxt "@label" 13857 msgid "Tags" 13858 msgstr "ক্যাশ (Cache) ফাঁকা করো" 13859 13860 #: kio/kfilemetadataprovider.cpp:453 13861 #, fuzzy, kde-format 13862 #| msgid "Size:" 13863 msgctxt "@label" 13864 msgid "Total Size" 13865 msgstr "মাপ:" 13866 13867 #: kio/kfilemetadataprovider.cpp:454 13868 #, fuzzy, kde-format 13869 #| msgid "Type" 13870 msgctxt "@label" 13871 msgid "Type" 13872 msgstr "ধরন" 13873 13874 #: kio/kfilemetadatareaderprocess.cpp:234 13875 #, kde-format 13876 msgid "KFileMetaDataReader" 13877 msgstr "" 13878 13879 #: kio/kfilemetadatareaderprocess.cpp:236 13880 #, kde-format 13881 msgid "KFileMetaDataReader can be used to read metadata from a file" 13882 msgstr "" 13883 13884 #: kio/kfilemetadatareaderprocess.cpp:238 13885 #, kde-format 13886 msgid "(C) 2011, Peter Penz" 13887 msgstr "" 13888 13889 #: kio/kfilemetadatareaderprocess.cpp:239 13890 #, kde-format 13891 msgid "Peter Penz" 13892 msgstr "" 13893 13894 #: kio/kfilemetadatareaderprocess.cpp:239 13895 #, fuzzy, kde-format 13896 #| msgid "Current location" 13897 msgid "Current maintainer" 13898 msgstr "বর্তমান অবস্থান" 13899 13900 #: kio/kfilemetadatareaderprocess.cpp:244 13901 #, kde-format 13902 msgid "Only the meta data that is part of the file is read" 13903 msgstr "" 13904 13905 #: kio/kfilemetadatareaderprocess.cpp:245 13906 #, kde-format 13907 msgid "List of URLs where the meta-data should be read from" 13908 msgstr "" 13909 13910 #: kio/kfilemetainfowidget.cpp:161 13911 #, kde-format 13912 msgid "<Error>" 13913 msgstr "<ভুল>" 13914 13915 #: kio/kfiletreeview.cpp:192 13916 #, fuzzy, kde-format 13917 msgid "Show Hidden Folders" 13918 msgstr "সহায়িকা দেখাও" 13919 13920 #: kio/kimageio.cpp:46 13921 #, kde-format 13922 msgid "All Pictures" 13923 msgstr "সব ছবি" 13924 13925 #: kio/kmetaprops.cpp:57 13926 #, fuzzy, kde-format 13927 msgctxt "@title:window" 13928 msgid "Configure Shown Data" 13929 msgstr "চালিয়ে যা&ও" 13930 13931 #: kio/kmetaprops.cpp:60 13932 #, kde-format 13933 msgctxt "@label::textbox" 13934 msgid "Select which data should be shown:" 13935 msgstr "" 13936 13937 #: kio/kmetaprops.cpp:123 13938 #, fuzzy, kde-format 13939 msgctxt "@action:button" 13940 msgid "Configure..." 13941 msgstr "চালিয়ে যা&ও" 13942 13943 #: kio/kmetaprops.cpp:133 13944 #, fuzzy, kde-format 13945 msgctxt "@title:tab" 13946 msgid "Information" 13947 msgstr "তথ্য দেখাও:" 13948 13949 #: kio/knfotranslator.cpp:40 13950 #, fuzzy, kde-format 13951 #| msgid "Created:" 13952 msgctxt "@label creation date" 13953 msgid "Created" 13954 msgstr "তৈরি:" 13955 13956 #: kio/knfotranslator.cpp:41 13957 #, fuzzy, kde-format 13958 #| msgid "Size" 13959 msgctxt "@label file content size" 13960 msgid "Size" 13961 msgstr "মাপ" 13962 13963 #: kio/knfotranslator.cpp:42 13964 #, kde-format 13965 msgctxt "@label file depends from" 13966 msgid "Depends" 13967 msgstr "" 13968 13969 #: kio/knfotranslator.cpp:43 13970 #, fuzzy, kde-format 13971 #| msgid "Description" 13972 msgctxt "@label" 13973 msgid "Description" 13974 msgstr "বর্ণনা" 13975 13976 #: kio/knfotranslator.cpp:44 13977 #, fuzzy, kde-format 13978 #| msgid "&General" 13979 msgctxt "@label Software used to generate content" 13980 msgid "Generator" 13981 msgstr "সাধা&রণ" 13982 13983 #: kio/knfotranslator.cpp:45 13984 #, kde-format 13985 msgctxt "" 13986 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" 13987 msgid "Has Part" 13988 msgstr "" 13989 13990 #: kio/knfotranslator.cpp:46 13991 #, kde-format 13992 msgctxt "" 13993 "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" 13994 "nie#hasLogicalPart" 13995 msgid "Has Logical Part" 13996 msgstr "" 13997 13998 #: kio/knfotranslator.cpp:47 13999 #, fuzzy, kde-format 14000 #| msgid "Parent Folder" 14001 msgctxt "@label parent directory" 14002 msgid "Part of" 14003 msgstr "উর্ধ্বস্থ ফোল্ডার" 14004 14005 #: kio/knfotranslator.cpp:48 14006 #, kde-format 14007 msgctxt "@label" 14008 msgid "Keyword" 14009 msgstr "" 14010 14011 #: kio/knfotranslator.cpp:49 14012 #, fuzzy, kde-format 14013 msgctxt "@label modified date of file" 14014 msgid "Modified" 14015 msgstr "পরিবর্তিত:" 14016 14017 #: kio/knfotranslator.cpp:50 14018 #, fuzzy, kde-format 14019 #| msgid "Mime Type" 14020 msgctxt "@label" 14021 msgid "MIME Type" 14022 msgstr "মাইম টাইপ" 14023 14024 #: kio/knfotranslator.cpp:51 14025 #, fuzzy, kde-format 14026 #| msgid "Contents:" 14027 msgctxt "@label" 14028 msgid "Content" 14029 msgstr "বিষয়বস্তু:" 14030 14031 #: kio/knfotranslator.cpp:52 14032 #, fuzzy, kde-format 14033 #| msgid "created on %1" 14034 msgctxt "@label" 14035 msgid "Related To" 14036 msgstr "%1-এ তৈরি" 14037 14038 #: kio/knfotranslator.cpp:53 14039 #, fuzzy, kde-format 14040 msgctxt "@label" 14041 msgid "Subject" 14042 msgstr "বিষয়" 14043 14044 #: kio/knfotranslator.cpp:54 14045 #, fuzzy, kde-format 14046 msgctxt "@label music title" 14047 msgid "Title" 14048 msgstr "কোন ফাইল নেই" 14049 14050 #: kio/knfotranslator.cpp:55 14051 #, kde-format 14052 msgctxt "@label file URL" 14053 msgid "File Location" 14054 msgstr "" 14055 14056 #: kio/knfotranslator.cpp:56 14057 #, fuzzy, kde-format 14058 #| msgid "Created:" 14059 msgctxt "@label" 14060 msgid "Creator" 14061 msgstr "তৈরি:" 14062 14063 #: kio/knfotranslator.cpp:57 14064 #, kde-format 14065 msgctxt "@label" 14066 msgid "Average Bitrate" 14067 msgstr "" 14068 14069 #: kio/knfotranslator.cpp:58 14070 #, kde-format 14071 msgctxt "@label" 14072 msgid "Channels" 14073 msgstr "" 14074 14075 #: kio/knfotranslator.cpp:59 14076 #, kde-format 14077 msgctxt "@label number of characters" 14078 msgid "Characters" 14079 msgstr "" 14080 14081 #: kio/knfotranslator.cpp:60 14082 #, fuzzy, kde-format 14083 #| msgid "C&onnect" 14084 msgctxt "@label" 14085 msgid "Codec" 14086 msgstr "যোগাযোগ স্থাপ&ন করো" 14087 14088 #: kio/knfotranslator.cpp:61 14089 #, kde-format 14090 msgctxt "@label" 14091 msgid "Color Depth" 14092 msgstr "" 14093 14094 #: kio/knfotranslator.cpp:62 14095 #, fuzzy, kde-format 14096 msgctxt "@label" 14097 msgid "Duration" 14098 msgstr "গন্তব্য:" 14099 14100 #: kio/knfotranslator.cpp:63 14101 #, fuzzy, kde-format 14102 msgctxt "@label" 14103 msgid "Filename" 14104 msgstr "ডিভাইস" 14105 14106 #: kio/knfotranslator.cpp:64 14107 #, kde-format 14108 msgctxt "@label" 14109 msgid "Hash" 14110 msgstr "" 14111 14112 #: kio/knfotranslator.cpp:65 14113 #, kde-format 14114 msgctxt "@label" 14115 msgid "Height" 14116 msgstr "" 14117 14118 #: kio/knfotranslator.cpp:66 14119 #, kde-format 14120 msgctxt "@label" 14121 msgid "Interlace Mode" 14122 msgstr "" 14123 14124 #: kio/knfotranslator.cpp:67 14125 #, fuzzy, kde-format 14126 #| msgid "Link" 14127 msgctxt "@label number of lines" 14128 msgid "Lines" 14129 msgstr "লিঙ্ক" 14130 14131 #: kio/knfotranslator.cpp:68 14132 #, kde-format 14133 msgctxt "@label" 14134 msgid "Programming Language" 14135 msgstr "" 14136 14137 #: kio/knfotranslator.cpp:69 14138 #, kde-format 14139 msgctxt "@label" 14140 msgid "Sample Rate" 14141 msgstr "" 14142 14143 #: kio/knfotranslator.cpp:70 14144 #, kde-format 14145 msgctxt "@label" 14146 msgid "Width" 14147 msgstr "" 14148 14149 #: kio/knfotranslator.cpp:71 14150 #, kde-format 14151 msgctxt "@label number of words" 14152 msgid "Words" 14153 msgstr "" 14154 14155 #: kio/knfotranslator.cpp:72 14156 #, kde-format 14157 msgctxt "@label EXIF aperture value" 14158 msgid "Aperture" 14159 msgstr "" 14160 14161 #: kio/knfotranslator.cpp:73 14162 #, kde-format 14163 msgctxt "@label EXIF" 14164 msgid "Exposure Bias Value" 14165 msgstr "" 14166 14167 #: kio/knfotranslator.cpp:74 14168 #, fuzzy, kde-format 14169 #| msgid "Exposure:" 14170 msgctxt "@label EXIF" 14171 msgid "Exposure Time" 14172 msgstr "এক্সপোজার:" 14173 14174 #: kio/knfotranslator.cpp:75 14175 #, kde-format 14176 msgctxt "@label EXIF" 14177 msgid "Flash" 14178 msgstr "" 14179 14180 #: kio/knfotranslator.cpp:76 14181 #, kde-format 14182 msgctxt "@label EXIF" 14183 msgid "Focal Length" 14184 msgstr "" 14185 14186 #: kio/knfotranslator.cpp:77 14187 #, kde-format 14188 msgctxt "@label EXIF" 14189 msgid "Focal Length 35 mm" 14190 msgstr "" 14191 14192 #: kio/knfotranslator.cpp:78 14193 #, kde-format 14194 msgctxt "@label EXIF" 14195 msgid "ISO Speed Ratings" 14196 msgstr "" 14197 14198 #: kio/knfotranslator.cpp:79 14199 #, kde-format 14200 msgctxt "@label EXIF" 14201 msgid "Make" 14202 msgstr "" 14203 14204 #: kio/knfotranslator.cpp:80 14205 #, fuzzy, kde-format 14206 #| msgid "Creating Folder" 14207 msgctxt "@label EXIF" 14208 msgid "Metering Mode" 14209 msgstr "ফোল্ডার তৈরি হচ্ছে" 14210 14211 #: kio/knfotranslator.cpp:81 14212 #, fuzzy, kde-format 14213 msgctxt "@label EXIF" 14214 msgid "Model" 14215 msgstr "পরিবর্তিত:" 14216 14217 #: kio/knfotranslator.cpp:82 14218 #, fuzzy, kde-format 14219 #| msgid "Organization:" 14220 msgctxt "@label EXIF" 14221 msgid "Orientation" 14222 msgstr "সংস্থা:" 14223 14224 #: kio/knfotranslator.cpp:83 14225 #, kde-format 14226 msgctxt "@label EXIF" 14227 msgid "White Balance" 14228 msgstr "" 14229 14230 #: kio/knfotranslator.cpp:84 14231 #, kde-format 14232 msgctxt "@label video director" 14233 msgid "Director" 14234 msgstr "" 14235 14236 #: kio/knfotranslator.cpp:85 14237 #, fuzzy, kde-format 14238 #| msgid "&General" 14239 msgctxt "@label music genre" 14240 msgid "Genre" 14241 msgstr "সাধা&রণ" 14242 14243 #: kio/knfotranslator.cpp:86 14244 #, kde-format 14245 msgctxt "@label music album" 14246 msgid "Album" 14247 msgstr "" 14248 14249 #: kio/knfotranslator.cpp:87 14250 #, kde-format 14251 msgctxt "@label" 14252 msgid "Performer" 14253 msgstr "" 14254 14255 #: kio/knfotranslator.cpp:88 14256 #, fuzzy, kde-format 14257 msgctxt "@label" 14258 msgid "Release Date" 14259 msgstr "&এন্ট্রি মুছে ফেলো" 14260 14261 #: kio/knfotranslator.cpp:89 14262 #, kde-format 14263 msgctxt "@label music track number" 14264 msgid "Track" 14265 msgstr "" 14266 14267 #: kio/knfotranslator.cpp:90 14268 #, fuzzy, kde-format 14269 #| msgid "Created:" 14270 msgctxt "@label resource created time" 14271 msgid "Resource Created" 14272 msgstr "তৈরি:" 14273 14274 #: kio/knfotranslator.cpp:91 14275 #, fuzzy, kde-format 14276 msgctxt "@label" 14277 msgid "Sub Resource" 14278 msgstr "উত্স:" 14279 14280 #: kio/knfotranslator.cpp:92 14281 #, fuzzy, kde-format 14282 msgctxt "@label resource last modified" 14283 msgid "Resource Modified" 14284 msgstr "পরিবর্তিত:" 14285 14286 #: kio/knfotranslator.cpp:93 14287 #, fuzzy, kde-format 14288 msgctxt "@label" 14289 msgid "Numeric Rating" 14290 msgstr "ক্রমবিন্যাস" 14291 14292 #: kio/knfotranslator.cpp:94 14293 #, kde-format 14294 msgctxt "@label" 14295 msgid "Copied From" 14296 msgstr "" 14297 14298 #: kio/knfotranslator.cpp:95 14299 #, kde-format 14300 msgctxt "@label" 14301 msgid "First Usage" 14302 msgstr "" 14303 14304 #: kio/knfotranslator.cpp:96 14305 #, kde-format 14306 msgctxt "@label" 14307 msgid "Last Usage" 14308 msgstr "" 14309 14310 #: kio/knfotranslator.cpp:97 14311 #, fuzzy, kde-format 14312 #| msgid "Comment" 14313 msgctxt "@label" 14314 msgid "Usage Count" 14315 msgstr "মন্তব্য" 14316 14317 #: kio/knfotranslator.cpp:98 14318 #, kde-format 14319 msgctxt "@label" 14320 msgid "Unix File Group" 14321 msgstr "" 14322 14323 #: kio/knfotranslator.cpp:99 14324 #, kde-format 14325 msgctxt "@label" 14326 msgid "Unix File Mode" 14327 msgstr "" 14328 14329 #: kio/knfotranslator.cpp:100 14330 #, fuzzy, kde-format 14331 #| msgid "Open file dialog" 14332 msgctxt "@label" 14333 msgid "Unix File Owner" 14334 msgstr "ফাইল ডায়ালগ খোলো" 14335 14336 #: kio/knfotranslator.cpp:101 14337 #, fuzzy, kde-format 14338 #| msgid "Type" 14339 msgctxt "@label file type" 14340 msgid "Type" 14341 msgstr "ধরন" 14342 14343 #: kio/knfotranslator.cpp:102 14344 #, kde-format 14345 msgctxt "@label Number of fuzzy translations" 14346 msgid "Fuzzy Translations" 14347 msgstr "" 14348 14349 #: kio/knfotranslator.cpp:103 14350 #, kde-format 14351 msgctxt "@label Name of last translator" 14352 msgid "Last Translator" 14353 msgstr "" 14354 14355 #: kio/knfotranslator.cpp:104 14356 #, kde-format 14357 msgctxt "@label Number of obsolete translations" 14358 msgid "Obsolete Translations" 14359 msgstr "" 14360 14361 #: kio/knfotranslator.cpp:105 14362 #, kde-format 14363 msgctxt "@label" 14364 msgid "Translation Source Date" 14365 msgstr "" 14366 14367 #: kio/knfotranslator.cpp:106 14368 #, kde-format 14369 msgctxt "@label Number of total translations" 14370 msgid "Total Translations" 14371 msgstr "" 14372 14373 #: kio/knfotranslator.cpp:107 14374 #, fuzzy, kde-format 14375 msgctxt "@label Number of translated strings" 14376 msgid "Translated" 14377 msgstr "তৈরি:" 14378 14379 #: kio/knfotranslator.cpp:108 14380 #, kde-format 14381 msgctxt "@label" 14382 msgid "Translation Date" 14383 msgstr "" 14384 14385 #: kio/knfotranslator.cpp:109 14386 #, kde-format 14387 msgctxt "@label Number of untranslated strings" 14388 msgid "Untranslated" 14389 msgstr "" 14390 14391 #: kio/kpreviewprops.cpp:51 14392 #, kde-format 14393 msgid "P&review" 14394 msgstr "প্রাক&দর্শন" 14395 14396 #: kio/kscan.cpp:49 14397 #, kde-format 14398 msgid "Acquire Image" 14399 msgstr "চিত্র অর্জন করো" 14400 14401 #: kio/kscan.cpp:97 14402 #, kde-format 14403 msgid "OCR Image" 14404 msgstr "চিত্র ও-সি-আর (OCR) করো" 14405 14406 #: kio/netaccess.cpp:102 14407 #, kde-format 14408 msgid "File '%1' is not readable" 14409 msgstr "ফাইল '%1' পড়া যাচ্ছে না" 14410 14411 #: kio/netaccess.cpp:435 14412 #, fuzzy, kde-format 14413 msgid "ERROR: Unknown protocol '%1'" 14414 msgstr "অজ্ঞাত প্রোটোকল '%1'।" 14415 14416 #: kio/passworddialog.cpp:56 14417 #, kde-format 14418 msgid "Authorization Dialog" 14419 msgstr "" 14420 14421 #: kioslave/metainfo/metainfo.cpp:98 14422 #, kde-format 14423 msgid "No metainfo for %1" 14424 msgstr "%1-এর জন্য কোনো মেটা-তথ্য জানা নেই" 14425 14426 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14427 #: kssl/kcm/cacertificates.ui:24 14428 #, fuzzy, kde-format 14429 #| msgid "Organization:" 14430 msgid "Organization / Common Name" 14431 msgstr "সংস্থা:" 14432 14433 #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) 14434 #: kssl/kcm/cacertificates.ui:29 14435 #, fuzzy, kde-format 14436 msgid "Organizational Unit" 14437 msgstr "সংস্থা:" 14438 14439 #. i18n: ectx: property (text), widget (QPushButton, displaySelection) 14440 #: kssl/kcm/cacertificates.ui:42 14441 #, kde-format 14442 msgid "Display..." 14443 msgstr "" 14444 14445 #. i18n: ectx: property (text), widget (QPushButton, disableSelection) 14446 #: kssl/kcm/cacertificates.ui:68 14447 #, fuzzy, kde-format 14448 #| msgid "disable XIM" 14449 msgid "Disable" 14450 msgstr "XIM (এক্স ইনপুট মেথড) নিষ্ক্রিয় করো" 14451 14452 #. i18n: ectx: property (text), widget (QPushButton, enableSelection) 14453 #: kssl/kcm/cacertificates.ui:78 14454 #, kde-format 14455 msgid "Enable" 14456 msgstr "" 14457 14458 #. i18n: ectx: property (text), widget (QPushButton, removeSelection) 14459 #: kssl/kcm/cacertificates.ui:104 14460 #, kde-format 14461 msgid "Remove" 14462 msgstr "সরিয়ে ফেলো" 14463 14464 #. i18n: ectx: property (text), widget (QPushButton, add) 14465 #: kssl/kcm/cacertificates.ui:111 14466 #, kde-format 14467 msgid "Add..." 14468 msgstr "যোগ করো..." 14469 14470 #: kssl/kcm/cacertificatespage.cpp:140 14471 #, fuzzy, kde-format 14472 msgid "System certificates" 14473 msgstr "সার্টিফিকেট পাঠাও..." 14474 14475 #: kssl/kcm/cacertificatespage.cpp:147 14476 #, fuzzy, kde-format 14477 msgid "User-added certificates" 14478 msgstr "সার্টিফিকেট পাঠাও..." 14479 14480 #: kssl/kcm/cacertificatespage.cpp:302 14481 #, fuzzy, kde-format 14482 #| msgid "Certificate" 14483 msgid "Pick Certificates" 14484 msgstr "সার্টিফিকেট" 14485 14486 #. i18n: ectx: property (text), widget (QLabel, subjectHeading) 14487 #: kssl/kcm/displaycert.ui:23 14488 #, fuzzy, kde-format 14489 #| msgid "Security Information" 14490 msgid "<b>Subject Information</b>" 14491 msgstr "নিরাপত্তা তথ্য" 14492 14493 #. i18n: ectx: property (text), widget (QLabel, issuerHeading) 14494 #: kssl/kcm/displaycert.ui:39 14495 #, fuzzy, kde-format 14496 msgid "<b>Issuer Information</b>" 14497 msgstr " <b>[Cross Domain!]</b>" 14498 14499 #. i18n: ectx: property (text), widget (QLabel, label) 14500 #: kssl/kcm/displaycert.ui:55 14501 #, fuzzy, kde-format 14502 #| msgid "<b>%1</b>" 14503 msgid "<b>Other</b>" 14504 msgstr "<b>%1</b>" 14505 14506 #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) 14507 #: kssl/kcm/displaycert.ui:64 14508 #, kde-format 14509 msgid "Validity period" 14510 msgstr "" 14511 14512 #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) 14513 #: kssl/kcm/displaycert.ui:78 14514 #, kde-format 14515 msgid "Serial number" 14516 msgstr "" 14517 14518 #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) 14519 #: kssl/kcm/displaycert.ui:92 14520 #, kde-format 14521 msgid "MD5 digest" 14522 msgstr "" 14523 14524 #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) 14525 #: kssl/kcm/displaycert.ui:106 14526 #, kde-format 14527 msgid "SHA1 digest" 14528 msgstr "" 14529 14530 #: kssl/kcm/displaycertdialog.cpp:73 14531 #, fuzzy, kde-format 14532 #| msgid "%1 / %2" 14533 msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" 14534 msgid "%1 to %2" 14535 msgstr "%1 / %2" 14536 14537 #: kssl/kcm/kcmssl.cpp:37 14538 #, fuzzy, kde-format 14539 #| msgid "Reload configuration file" 14540 msgid "SSL Configuration Module" 14541 msgstr "কনফিগারেশন ফাইল আবার পড়ো" 14542 14543 #: kssl/kcm/kcmssl.cpp:39 14544 #, kde-format 14545 msgid "Copyright 2010 Andreas Hartmetz" 14546 msgstr "" 14547 14548 #: kssl/kcm/kcmssl.cpp:40 14549 #, kde-format 14550 msgid "Andreas Hartmetz" 14551 msgstr "" 14552 14553 #: kssl/kcm/kcmssl.cpp:52 14554 #, fuzzy, kde-format 14555 #| msgid "Link" 14556 msgid "SSL Signers" 14557 msgstr "লিঙ্ক" 14558 14559 #: kssl/ksslcertificate.cpp:202 14560 #, kde-format 14561 msgid "Signature Algorithm: " 14562 msgstr "" 14563 14564 #: kssl/ksslcertificate.cpp:203 14565 #, kde-format 14566 msgid "Unknown" 14567 msgstr "Unknown" 14568 14569 #: kssl/ksslcertificate.cpp:206 14570 #, kde-format 14571 msgid "Signature Contents:" 14572 msgstr "" 14573 14574 #: kssl/ksslcertificate.cpp:341 14575 #, kde-format 14576 msgctxt "Unknown" 14577 msgid "Unknown key algorithm" 14578 msgstr "" 14579 14580 #: kssl/ksslcertificate.cpp:347 14581 #, kde-format 14582 msgid "Key type: RSA (%1 bit)" 14583 msgstr "" 14584 14585 #: kssl/ksslcertificate.cpp:349 14586 #, kde-format 14587 msgid "Modulus: " 14588 msgstr "" 14589 14590 #: kssl/ksslcertificate.cpp:362 14591 #, kde-format 14592 msgid "Exponent: 0x" 14593 msgstr "" 14594 14595 #: kssl/ksslcertificate.cpp:374 14596 #, kde-format 14597 msgid "Key type: DSA (%1 bit)" 14598 msgstr "" 14599 14600 #: kssl/ksslcertificate.cpp:376 14601 #, kde-format 14602 msgid "Prime: " 14603 msgstr "" 14604 14605 #: kssl/ksslcertificate.cpp:389 14606 #, kde-format 14607 msgid "160 bit prime factor: " 14608 msgstr "" 14609 14610 #: kssl/ksslcertificate.cpp:417 14611 #, kde-format 14612 msgid "Public key: " 14613 msgstr "" 14614 14615 #: kssl/ksslcertificate.cpp:1065 14616 #, kde-format 14617 msgid "The certificate is valid." 14618 msgstr "সার্টিফিকেট-টি বৈধ" 14619 14620 #: kssl/ksslcertificate.cpp:1067 14621 #, kde-format 14622 msgid "" 14623 "Retrieval of the issuer certificate failed. This means the CA's (Certificate " 14624 "Authority) certificate can not be found." 14625 msgstr "" 14626 14627 #: kssl/ksslcertificate.cpp:1069 14628 #, kde-format 14629 msgid "" 14630 "Retrieval of the CRL (Certificate Revocation List) failed. This means the " 14631 "CA's (Certificate Authority) CRL can not be found." 14632 msgstr "" 14633 14634 #: kssl/ksslcertificate.cpp:1071 14635 #, kde-format 14636 msgid "" 14637 "The decryption of the certificate's signature failed. This means it could " 14638 "not even be calculated as opposed to just not matching the expected result." 14639 msgstr "" 14640 14641 #: kssl/ksslcertificate.cpp:1073 14642 #, kde-format 14643 msgid "" 14644 "The decryption of the CRL's (Certificate Revocation List) signature failed. " 14645 "This means it could not even be calculated as opposed to just not matching " 14646 "the expected result." 14647 msgstr "" 14648 14649 #: kssl/ksslcertificate.cpp:1075 14650 #, kde-format 14651 msgid "" 14652 "The decoding of the public key of the issuer failed. This means that the " 14653 "CA's (Certificate Authority) certificate can not be used to verify the " 14654 "certificate you wanted to use." 14655 msgstr "" 14656 14657 #: kssl/ksslcertificate.cpp:1077 14658 #, kde-format 14659 msgid "" 14660 "The certificate's signature is invalid. This means that the certificate can " 14661 "not be verified." 14662 msgstr "" 14663 14664 #: kssl/ksslcertificate.cpp:1079 14665 #, fuzzy, kde-format 14666 msgid "" 14667 "The CRL's (Certificate Revocation List) signature is invalid. This means " 14668 "that the CRL can not be verified." 14669 msgstr "সার্টিফিকেট-টি অবৈধ" 14670 14671 #: kssl/ksslcertificate.cpp:1081 14672 #, fuzzy, kde-format 14673 msgid "The certificate is not valid, yet." 14674 msgstr "সার্টিফিকেট-টি অবৈধ" 14675 14676 #: kssl/ksslcertificate.cpp:1083 14677 #, fuzzy, kde-format 14678 msgid "The certificate is not valid, any more." 14679 msgstr "সার্টিফিকেট-টি অবৈধ" 14680 14681 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 14682 #, fuzzy, kde-format 14683 msgid "The CRL (Certificate Revocation List) is not valid, yet." 14684 msgstr "সার্টিফিকেট-টি অবৈধ" 14685 14686 #: kssl/ksslcertificate.cpp:1089 14687 #, kde-format 14688 msgid "The time format of the certificate's 'notBefore' field is invalid." 14689 msgstr "" 14690 14691 #: kssl/ksslcertificate.cpp:1091 14692 #, kde-format 14693 msgid "The time format of the certificate's 'notAfter' field is invalid." 14694 msgstr "" 14695 14696 #: kssl/ksslcertificate.cpp:1093 14697 #, fuzzy, kde-format 14698 msgid "" 14699 "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " 14700 "field is invalid." 14701 msgstr "সার্টিফিকেট-টি অবৈধ" 14702 14703 #: kssl/ksslcertificate.cpp:1095 14704 #, fuzzy, kde-format 14705 msgid "" 14706 "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " 14707 "field is invalid." 14708 msgstr "সার্টিফিকেট-টি অবৈধ" 14709 14710 #: kssl/ksslcertificate.cpp:1097 14711 #, kde-format 14712 msgid "The OpenSSL process ran out of memory." 14713 msgstr "" 14714 14715 #: kssl/ksslcertificate.cpp:1099 14716 #, kde-format 14717 msgid "" 14718 "The certificate is self-signed and not in the list of trusted certificates. " 14719 "If you want to accept this certificate, import it into the list of trusted " 14720 "certificates." 14721 msgstr "" 14722 14723 #: kssl/ksslcertificate.cpp:1102 14724 #, kde-format 14725 msgid "" 14726 "The certificate is self-signed. While the trust chain could be built up, the " 14727 "root CA's (Certificate Authority) certificate can not be found." 14728 msgstr "" 14729 14730 #: kssl/ksslcertificate.cpp:1104 14731 #, kde-format 14732 msgid "" 14733 "The CA's (Certificate Authority) certificate can not be found. Most likely, " 14734 "your trust chain is broken." 14735 msgstr "" 14736 14737 #: kssl/ksslcertificate.cpp:1106 14738 #, kde-format 14739 msgid "" 14740 "The certificate can not be verified as it is the only certificate in the " 14741 "trust chain and not self-signed. If you self-sign the certificate, make sure " 14742 "to import it into the list of trusted certificates." 14743 msgstr "" 14744 14745 #: kssl/ksslcertificate.cpp:1108 14746 #, kde-format 14747 msgid "The certificate chain is longer than the maximum depth specified." 14748 msgstr "" 14749 14750 #: kssl/ksslcertificate.cpp:1111 14751 #, fuzzy, kde-format 14752 msgid "The certificate has been revoked." 14753 msgstr "সার্টিফিকেট-টি অবৈধ" 14754 14755 #: kssl/ksslcertificate.cpp:1113 14756 #, fuzzy, kde-format 14757 msgid "The certificate's CA (Certificate Authority) is invalid." 14758 msgstr "সার্টিফিকেট-টি অবৈধ" 14759 14760 #: kssl/ksslcertificate.cpp:1115 14761 #, kde-format 14762 msgid "" 14763 "The length of the trust chain exceeded one of the CA's (Certificate " 14764 "Authority) 'pathlength' parameters, making all subsequent signatures invalid." 14765 msgstr "" 14766 14767 #: kssl/ksslcertificate.cpp:1117 14768 #, kde-format 14769 msgid "" 14770 "The certificate has not been signed for the purpose you tried to use it for. " 14771 "This means the CA (Certificate Authority) does not allow this usage." 14772 msgstr "" 14773 14774 #: kssl/ksslcertificate.cpp:1120 14775 #, kde-format 14776 msgid "" 14777 "The root CA (Certificate Authority) is not trusted for the purpose you tried " 14778 "to use this certificate for." 14779 msgstr "" 14780 14781 #: kssl/ksslcertificate.cpp:1123 14782 #, kde-format 14783 msgid "" 14784 "The root CA (Certificate Authority) has been marked to be rejected for the " 14785 "purpose you tried to use it for." 14786 msgstr "" 14787 14788 #: kssl/ksslcertificate.cpp:1125 14789 #, fuzzy, kde-format 14790 msgid "" 14791 "The certificate's CA (Certificate Authority) does not match the CA name of " 14792 "the certificate." 14793 msgstr "" 14794 "সার্টিফিকেটটি যে আই-পি অ্যাড্রেসকে দেওয়া হয়েছিল, %1 হোস্টটির অ্যাড্রেস তার সাথে " 14795 "মিলছে না।" 14796 14797 #: kssl/ksslcertificate.cpp:1127 14798 #, fuzzy, kde-format 14799 msgid "" 14800 "The CA (Certificate Authority) certificate's key ID does not match the key " 14801 "ID in the 'Issuer' section of the certificate you are trying to use." 14802 msgstr "" 14803 "সার্টিফিকেটটি যে আই-পি অ্যাড্রেসকে দেওয়া হয়েছিল, %1 হোস্টটির অ্যাড্রেস তার সাথে " 14804 "মিলছে না।" 14805 14806 #: kssl/ksslcertificate.cpp:1129 14807 #, kde-format 14808 msgid "" 14809 "The CA (Certificate Authority) certificate's key ID and name do not match " 14810 "the key ID and name in the 'Issuer' section of the certificate you are " 14811 "trying to use." 14812 msgstr "" 14813 14814 #: kssl/ksslcertificate.cpp:1131 14815 #, kde-format 14816 msgid "" 14817 "The certificate's CA (Certificate Authority) is not allowed to sign " 14818 "certificates." 14819 msgstr "" 14820 14821 #: kssl/ksslcertificate.cpp:1133 14822 #, kde-format 14823 msgid "OpenSSL could not be verified." 14824 msgstr "" 14825 14826 #: kssl/ksslcertificate.cpp:1137 14827 #, kde-format 14828 msgid "" 14829 "The signature test for this certificate failed. This could mean that the " 14830 "signature of this certificate or any in its trust path are invalid, could " 14831 "not be decoded or that the CRL (Certificate Revocation List) could not be " 14832 "verified. If you see this message, please let the author of the software you " 14833 "are using know that he or she should use the new, more specific error " 14834 "messages." 14835 msgstr "" 14836 14837 #: kssl/ksslcertificate.cpp:1139 14838 #, kde-format 14839 msgid "" 14840 "This certificate, any in its trust path or its CA's (Certificate Authority) " 14841 "CRL (Certificate Revocation List) is not valid. Any of them could not be " 14842 "valid yet or not valid any more. If you see this message, please let the " 14843 "author of the software you are using know that he or she should use the new, " 14844 "more specific error messages." 14845 msgstr "" 14846 14847 #: kssl/ksslcertificate.cpp:1145 14848 #, kde-format 14849 msgid "" 14850 "Certificate signing authority root files could not be found so the " 14851 "certificate is not verified." 14852 msgstr "" 14853 14854 #: kssl/ksslcertificate.cpp:1147 14855 #, kde-format 14856 msgid "SSL support was not found." 14857 msgstr "" 14858 14859 #: kssl/ksslcertificate.cpp:1149 14860 #, kde-format 14861 msgid "Private key test failed." 14862 msgstr "" 14863 14864 #: kssl/ksslcertificate.cpp:1151 14865 #, kde-format 14866 msgid "The certificate has not been issued for this host." 14867 msgstr "" 14868 14869 #: kssl/ksslcertificate.cpp:1153 14870 #, kde-format 14871 msgid "This certificate is not relevant." 14872 msgstr "সার্টিফিকেট-টি প্রাসঙ্গিক নয়।" 14873 14874 #: kssl/ksslcertificate.cpp:1158 14875 #, kde-format 14876 msgid "The certificate is invalid." 14877 msgstr "সার্টিফিকেট-টি অবৈধ" 14878 14879 #: kssl/ksslutils.cpp:90 14880 #, kde-format 14881 msgid "GMT" 14882 msgstr "" 14883 14884 #, fuzzy 14885 #~ msgctxt "color" 14886 #~ msgid "hot" 14887 #~ msgstr "সালাসা (মঙ্গল)" 14888 14889 #, fuzzy 14890 #~ msgctxt "color" 14891 #~ msgid "sea" 14892 #~ msgstr "স্থগিত রাখো" 14893 14894 #, fuzzy 14895 #~ msgctxt "@item Calendar system" 14896 #~ msgid "Gregorian (Proleptic)" 14897 #~ msgstr "গ্রেগরিয়ান" 14898 14899 #, fuzzy 14900 #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" 14901 #~ msgid "of Mes" 14902 #~ msgstr "of Meh" 14903 14904 #, fuzzy 14905 #~ msgctxt "Ethiopian month 5 - LongNamePossessive" 14906 #~ msgid "of Ter" 14907 #~ msgstr "of Tir" 14908 14909 #, fuzzy 14910 #~ msgctxt "Ethiopian month 1 - ShortName" 14911 #~ msgid "Mes" 14912 #~ msgstr "হ্যাঁ" 14913 14914 #, fuzzy 14915 #~ msgctxt "Ethiopian month 5 - LongName" 14916 #~ msgid "Ter" 14917 #~ msgstr "মঙ্গল" 14918 14919 #, fuzzy 14920 #~ msgctxt "Ethiopian weekday 4 - ShortDayName" 14921 #~ msgid "Ham" 14922 #~ msgstr "এ.এম." 14923 14924 #, fuzzy 14925 #~ msgctxt "Ethiopian weekday 5 - ShortDayName" 14926 #~ msgid "Arb" 14927 #~ msgstr "আরবা (বুধ)" 14928 14929 #, fuzzy 14930 #~ msgctxt "Ethiopian weekday 3 - LongDayName" 14931 #~ msgid "Rob" 14932 #~ msgstr "কাজ (Job)" 14933 14934 #, fuzzy 14935 #~ msgctxt "Ethiopian weekday 5 - LongDayName" 14936 #~ msgid "Arb" 14937 #~ msgstr "আরবা (বুধ)" 14938 14939 #~ msgctxt "of May long" 14940 #~ msgid "of May" 14941 #~ msgstr "মের" 14942 14943 #~ msgctxt "May long" 14944 #~ msgid "May" 14945 #~ msgstr "মে" 14946 14947 #~ msgid "R. Thaani" 14948 #~ msgstr "রবিউস সানি" 14949 14950 #~ msgid "J. Thaani" 14951 #~ msgstr "জামাদিউস সানি" 14952 14953 #~ msgid "Hijjah" 14954 #~ msgstr "হাজ (?)" 14955 14956 #~ msgctxt "of Tir long" 14957 #~ msgid "of Tir" 14958 #~ msgstr "of Tir" 14959 14960 #~ msgctxt "of Dei long" 14961 #~ msgid "of Dei" 14962 #~ msgstr "of Dei" 14963 14964 #~ msgctxt "Tir long" 14965 #~ msgid "Tir" 14966 #~ msgstr "Tir" 14967 14968 #~ msgctxt "Dei long" 14969 #~ msgid "Dei" 14970 #~ msgstr "Dei" 14971 14972 #~ msgctxt "Shanbe short" 14973 #~ msgid "shn" 14974 #~ msgstr "shn"